,``@00ھ004 `@# ` "" $@` `T@  p b@"@H*/+  "b   0  "# "# * "#!` "#@㿐@#  a"a @ "  "8@c@  @   " @@㿐 c@T    "P@c# @ D ?#c' / - + ,`2 h@k㨒   # #@^㨒@a#@`b@S@?@2 @a aa @F`#@Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @"1?㿘 #@(1 @"1㿘@ʐ " ܒ㿘 @  㿘 #` @ "  `  "  ` ""J  *@J` )*@㿘@  #` @ "  `  €b  $€b 2$   " @ɐ"0   $  $`$` 㿘# b `   ``*  `b    '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "   @@ 0(@  㿘  @ $ ? `$ *㿐 " /  0T@㿘  㿘 " `t€㿘) ! ?N  @  "!Т!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ "+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @# 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #0@ \   #         #H@y` ` #@  #8 <?*  ` آ&@  `  #`@㿘?( ,1 \&" H L` T ` X P d l$ p  t @  .@ dd ? * `:```?  `h "`h"     d?"  d㿘 a'H'L'P'T 'X "a@/H @#h㿘 #p4 (4 4444444444 444p4444 44444̝㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #x@ @,@  ?L?㿘  l`  !  cJ@ #! @ @   @ *0   @ *` ( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx %%%%&&& 44,44444444   444p4p44444p 4-4 D84A4L4Z4 He4r4\4`44 4h4 44 l444@4p444 E3   @@E2h@``(/mntj[[@@<@`bT E2   @@E2h@``@@<@`bT UE3 (($E3 *aA E2E3 6=E3 6=U_ZAE2E24΀E24΀CZAXE2E3-LE3-LP`X,gb1AE2E3 ׄE3 ׄuvAE2E2E2hEAE2E2E2bPAE2E2E2nbAE2z9E2z9E2z9AE2z9E3 .}E3 .}ICE2z9E2z9E2z9`TaGAE2z9E2E2ܓge_AE2z9E2/qE2/q-`AE!$E3% E3% uAE2E205E205^FAE2E2ܓE2ܓ4(AE2E3 tE3 tOJsAE2ܓE2ܓE2ܓ$9EAE2ܓE2u*E2u*XfHCE2ܓE22E22.AE2ܓE2ܓE2ܓVAE2u*E2u*E2u* MAE2u*E2u*E2u*9pE25 RE2) E3 6= (0hpxX ໼ E2pE2E2hiE2tE2(E2( (0PF)E2!E2!E2!8=LE2$[܀E2$[܀E2$[܀9`[E2,E22bE22b:QpE25 RE29E2!;AME21-E2 E2!@ ;rE2 E2eE2e8@HP:mpE22E22E22/tmpQlE3#FE2]JE2]JHHAmE3NE32bE3)'F-yaE3vE3vE3 S+72G!E3vE3vE3 S+o#JaE3vE3vE3 S+SA!E3I E3I E3 S+1aE3I E3I E3 S+:f!E3I E3I E3 S+d'aE3I E3I E3 S+r!E3I E3I E3 S+ʍgaE3I E3I E3 S+UZY!E3I E3I E3 S+aE3I E3I E3 S+N7!E3I E3I E3 S+XHaE3I E3I E3 S+?6!E3I E3I E3 S+Q,BaE3E3E3 S+#!E3E3E3 S+$3aE3E3E3 S+{!E3E3E3 uaE3E3E3  zNm!E3E3E3  qaaE3E3E3  M!E3E3E3  0RaE3E3E3  M#U!E3E3E3  aE3E3E3  UX!E3z9E3z9E3  rxmaE3z9E3z9E3  ޔ}!E3z9E3z9E3  GaE3z9E3z9E3 =]!E3z9E3z9E3 Q[aE3z9E3z9E3 e>8!E3z9E3z9E3 >!E3z9E3z9E3z9h)ZaE3z9E3z9E3 z!E3z9E3z9E3  IaE3E3E3 eaz!E3E3E3 aE3E3E3 j3!E3E3E3 ,aaE3E3E3 p-!E3E3E3 K9}aE3E3E3 M!E3E3E3 5maE3E3E3 !E3E3E3 aE3E3E3 ['*!E3fE3fE3 (aE3fE3fE3 e`t!E3fE3fE3 놋xaE3fE3fE3 G!E3fE3fE3 aE3fE3fE3 [m!E3fE3fE3  ?{aE3fE3fE3 !E3fE3fE3 X *aE3fE3fE3 X MQ!E3CE3CE3 X aE3CE3CE3 X s5!E3CE3CE3 X ;aE3CE3CE3 X ِv!E3CE3CE3 X SaE3CE3CE3 X ٧H!E3CE3CE3 XI WaE3CE3CE3 X j !E3CE3CE3 XyaE3CE3CE3 X [!E3ܓE3ܓE3 XgeaE3ܓE3ܓE3 X 2T>!E3ܓE3ܓE3 X޵aE3ܓE3ܓE3 X }{ـ!E3ܓE3ܓE3 XqVaE3ܓE3ܓE3 X W!E3ܓE3ܓE3 XauaE3ܓE3ܓE3 X g!E3ܓE3ܓE3 X~OaE3ܓE3ܓE3 X .!E3u*E3u*E3 X$HaE3u*E3u*E3 X 5!E3u*E3u*E3 X]*aE3u*E3u*E3 X ;!E3u*E3u*E3 Xv8aE3u*E3u*E3 X Ӆ!E3u*E3u*E3 X4 QWaE3u*E3u*E3 X \e!E3u*E3u*E3 XdrxaE3u*E3u*E3 X 8!E3 E3 E3 XYJaE3 E3 E3 X m1!E3 E3 E3 <aE3 E3 E3  "j!E3 E3 E3 <aE3 E3 E3  NyX!E3>E3>E3 ǐx&aE3>E3>E3  su!E3>E3>E3 5aE3>E3>E3  )!E3>E3>E3 G[aE3>E3>E3  :!E3>E3>E3  ǛaE3>E3>E3  !(!!E3>E3>E3 !IUaE3ׄE3ׄE3  "/%!E3ׄE3ׄE3 "^aE3ׄE3ׄE3  #@!E3ׄE3ׄE3 #ZaE3ׄE3ׄE3  $aC&!E3ׄE3ׄE3 $'dmaE3ׄE3ׄE3  %fG!E3ׄE3ׄE3 %aE3ׄE3ׄE3  &wϷ!E3ׄE3ׄE3 &J!aE3pE3pE3  '&!E3pE3pE3 'VaE3pE3pE3  ([!E3pE3pE3 (}aE3pE3pE3  )!E3GE3GE3 )VZaE3GE3GE3  *!E3GE3GE3 *aE3GE3GE3  +mǧ!E3GE3GE3 +NǹaE3GE3GE3  ,!E3GE3GE3 ,:aE3GE3GE3  -S!E3GE3GE3 -aE3GE3GE3 .^!E3GE3GE3 .ȯaE39E39E3 /Ba!E39E39E3 /1aE39E39E3 0!E39E39E3 0|CraE39E39E3 1Dq!E39E39E3 1odaE39E39E3 2{͸!E39E39E3 2 ~aE39E39E3 3:(!E39E39E3 3ɲaE39E39E3 4!E3tE3tE3 4haE3tE3tE3 5~+7!E3tE3tE3 5ӔaE3tE3tE3 6t!E3tE3tE3 6/RaE3tE3tE3 7|!E3tE3tE3 7aE3tE3tE3 8(Xh!E3tE3tE3 8m)aE3tE3tE3 96!E3k E3k E3 97-4aE3k E3k E3 :'>!E3k E3k E3 :aaE3k E3k E3 ;Ae!E3k E3k E3 ;fhaE3k E3k E3 <=!E3k E3k E3 <0%aE3k E3k E3 =@!E3E3E3 =<aE34΀E34΀E3 >a1!E3eE3eE3 >$E[aE3E3E3 ?!E3 /E3 /E3N?2aE3 UE3 UE3N`2q!E3!E3!E3Nn{aE3#*E3#*E3N@fε!E3#FE3#FE3NnFaE3$sE3$sE3N!E3&%E3&%E3Nn|TaE3&6E3&6E3N!E3'cE3'cE3Nn+paE3) E3) E3Nύ!E3)'E3)'E3Nnt aE3*TE3*TE3N1!E3,E3,E3Nnj pHaE3,E3,E3Nfq!E3-DE3-DE3Nn3IaE3/qE3/qE3N>k!E3/E3/E3NnyaE305E305E3N:!E32bE32bE3Nn(yaE32E32E3N !E35 RE35 RE3Nn YaE35 RE35 RE3N G!E35 RE35 RE3Nn d1aE35 RE35 RE3N L0x!E35 RE35 RE3Nn z, aE35 RE35 RE3N mB!E35 RE35 RE3Nn wMaE35 RE35 RE3N 1Z!E35 RE35 RE3Nn 76aE35 RE35 RE3N@m!E35E35E3Nn UaE35E35E3N;P!E35E35E3Nn!aE35E35E3N2:զ!E35E35E3Nn/aE35E35E3沀 !E35E35E3沀niaE35E35E3沀C1!E35E35E3沀n;/aE35E35E3沀"F!E35E35E3沀nu8aE35E35E3沀W!E36=E36=E3沀nFaE36=E36=E3沀W E!E36=E36=E3沀n{^FaE36=E36=E3沀(!E36=E36=E3沀n mXaE36=E36=E3沀dm">!E36=E36=E3沀nCՏaE36=E36=E3沀<!E36=E36=E3沀n(aE36=E36=E3沀 ؂!E36E36E3沀n taE36E36E3沀 喆!E36E36E3沀n 'o,aE36E36E3沀 `G!E36E36E3沀n JraE36E36E3沀 Zם!E36E36E3沀n TPaE36E36E3沀 F!E36E36E3沀n ċ aE36E36E3沀!E37nE37nE3沀nwBaE37nE37nE3沀h!E37nE37nE3沀n§aE37nE37nE3沀R?!E37nE37nE3沀nیGaE37nE37nE3沀!E37nE37nE3沀n}|UaE37nE37nE3沀Z%N!E37nE37nE3In|#QaE37nE37nE3IR)S=!E37nE37nE3InIpaE38CE38CE3If!E38CE38CE3In4~_aE38CE38CE3Ieɒ!E38CE38CE3InEaE38CE38CE3ID!!E38CE38CE3In!3aE38CE38CE3IK!E38CE38CE3InܰaE38CE38CE3I8!E38CE38CE3In ~aE38ـE38ـE3Iҟܲ!E38ـE38ـE3InaE38ـE38ـE3I!E38ـE38ـE3In2-aE38ـE38ـE3I!E38ـE38ـE3InuaE38ـE38ـE3I&& !E38ـE38ـE3InVqs6aE38ـE38ـE3IQYKs!E398pE398pE3Inj_'aE398pE398pE3Ie#!E398pE398pE3InUbaE398pE398pE3I +X"!E398pE398pE3In aE398pE398pE3I!E398pE398pE3InܰߕaE398pE398pE3ILI!E398pE398pE3Inw' aE398pE398pE3Iq.!E39E39E3In)aE39E39E3I֙/!E39E39E3In baE39E39E3߀{!E39E39E3߀n΋aE39E39E3߀{!E39E39E3߀naaE39E39E3߀o^!E39E39E3߀nBaE39E39E3߀Ф!E39E39E3߀n_aE3:iE3:iE3߀(?!E3:iE3:iE3߀nN1aE3:iE3:iE3߀}&!E3:iE3:iE3߀n\aE3:iE3:iE3߀ N!E3:iE3:iE3߀n\aE3:iE3:iE3߀i-!E3:iE3:iE3߀naE3:iE3:iE3߀C!E3:iE3:iE3߀niaE3;3E3;3E3߀!!E3;3E3;3E3߀nOQhaE3;3E3;3E3߀#P!E3;3E3;3E3߀nPaE3;3E3;3E3߀:q!E3;3E3;3E3߀naE3;3E3;3E3߀ p!E3;3E3;3E3߀n SaE3;3E3;3E3߀!e!E3;3E3;3E3߀n!xaE3E3E3߀"X!E3E3E3߀n"1aE3E3E3߀#k!E3E3E3߀n#aE3E3E3߀$!E3E3E3߀n$aE3E3E3߀%6[x!E3E3E3߀n%FӬaE3E3E3v&:!E3E3E3vn&nS?faE3E3E3v'uu',!E3E3E3vn'ynLaE3E3E3v(.!E3E3E3vn(j-aE3E3E3v)#d!E3E3E3vn)aE3E3E3v*'!E3E3E3vn*nUaE3E3E3v+6!E3E3E3vn+BaE31-E31-E3v,6꟰!E31-E31-E3vn,aE31-E31-E3v-f!E31-E31-E3vn- ìaE31-E31-E3v.^h!E31-E31-E3vn.aE31-E31-E3v/v!E31-E31-E3vn/>daE31-E31-E3v 7A!E31-E31-E3vn .WaE31-E31-E3v!'!E3ÀE3ÀE3vn!|aaE3ÀE3ÀE3v"!E3ÀE3ÀE3vn"{paE3ÀE3ÀE3v#G!E3ÀE3ÀE3vn#x5zaE3ÀE3ÀE3v$!E3ÀE3ÀE3vn$.aE3ÀE3ÀE3v%,z!E3ÀE3ÀE3vn%3&aE3ÀE3ÀE3v&y!E3bZE3bZE3vn&7tvaE3bZE3bZE3v'$Je !E3bZE3bZE3vn'̀Y`aE3bZE3bZE3I (Z!E3bZE3bZE3I n(t2aE3bZE3bZE3I )Jd!E3bZE3bZE3I n)}aE3bZE3bZE3I *!>!E3bZE3bZE3I n*citaE3bZE3bZE3I ++,!E3bZE3bZE3I n+SaE3E3E3I ,Ke!E3E3E3I n,pRaE3E3E3I -1W!E3E3E3I n-0aE3E3E3I .!E3E3E3I n1,aE3E3E3I 2aD!E3E3E3I n2ſ6aE3E3E3I 3!E3E3E3I n3OC]aE3E3E3I 4IJ!E3E3E3I n4)aE3E3E3I 5;9!E3E3E3I n5R\ĒaE3E3E3I 6 !E3,E3,E3I n6 IaE3,E3,E3I 7l!E3,E3,E3I n7/aE3,E3,E3I 8qj !E3,E3,E3I n8raE3,E3,E3I 9LcO`!E3,E3,E3I n9VXƸaE3,E3,E3:!E3,E3,E3n:D/CaE3,E3,E3;!E3,E3,E3n;=aE3ĴE3ĴE3<c!E3ĴE3ĴE3n<YqaE3ĴE3ĴE3=}!E3ĴE3ĴE3n=caE3ĴE3ĴE3>$!E3ĴE3ĴE3n>~yaE3ĴE3ĴE3?"߫!E3ĴE3ĴE3n?LXaE3ĴE3ĴE30uC!E3ĴE3ĴE3n0>aE3]JE3]JE31)!E3]JE3]JE3n1$aE3]JE3]JE32gZS!E3]JE3]JE3n2DaE3]JE3]JE33x !E3]JE3]JE3n3`%aE3]JE3]JE34?9!E3]JE3]JE3n4$IaE3]JE3]JE358!E3]JE3]JE3n5b,aE3]JE3]JE36 !E3E3E3n6raE3E3E37Kt!E3E3E3n75QaE3E3E38-,n!E3E3E3n8zaE3E3E39S!E3E3E3n9aE3E3E3:C`!E3E3E3n:\aE3E3E3;[8!E3wE3wE3z9n;)aE3wE3wE3z9<ҏ!E3wE3wE3z9n<*PaE3wE3wE3z9=z!E3wE3wE3z9n=+&aE3wE3wE3z9>uqa!E3wE3wE3z9n>1aE3wE3wE3z9?!E3wE3wE3z9n?xqaE3wE3wE3z9SDB!E3'E3'E3z9@FaE3'E3'E3z9ސ!E3'E3'E3z9@;aE3'E3'E3z9!E3'E3'E3z9oaE3'E3'E3z9!E3'E3'E3z9K1aE3'E3'E3z9l!E3'E3'E3z9OtpaE3'E3'E3z9ю!E3E3E3z9"BaE3E3E3z9KA!E3E3E3z9aE3E3E3z9 U!E3E3E3z9aE3E3E3z9 !E3E3E3z96aE3E3E3z9 Y!E3E3E3z9 5aE3X;E3X;E3z9 R}!E3X;E3X;E3z9 u>aE3X;E3X;E3z9 e h!E3X;E3X;E3z9 aE3X;E3X;E3z9 ff!E3X;E3X;E3z9 RaE3X;E3X;E3z9 YiZ!E3X;E3X;E3 IaE3X;E3X;E3Ҭ!E3X;E3X;E3NU&UaE3рE3рE3^ax!E3рE3рE3naE3рE3рE3}L!E3рE3рE3: aE3рE3рE3bJC!E3рE3рE3auaE3рE3рE3,y!E3рE3рE3YaE3рE3рE3I!E3рE3рE3ӼaE3 hE3 hE3!E3 hE3 hE35'aE3 hE3 hE3r!E3 hE3 hE3@JaE3 hE3 hE3b^!E3 hE3 hE3N AaE3 hE3 hE3N!E3 hE3 hE3 aE3 hE3 hE3:A!E3 hE3 hE3@_aE3 !E3 !E3y !E3 !E3 !E3PaE3 !E3 !E3DZ!E3 !E3 !E3 aE3 !E3 !E3?!E3 !E3 !E3$QaE3 !E3 !E3!E3 !E3 !E3>aE3 !E3 !E3k!E3 !E3 !E3FJ~aE3 E3 E3.{!E3 E3 E3!g=aE3 E3 E3fRl !E3 E3 E3f6zUaE3 E3 E3f b!E3 E3 E3f yFʇaE3 E3 E3f!P@!E3 E3 E3f!"aE3 E3 E3f"_E!E3 E3 E3f"!aE3 S+E3 S+E3f#!E3 S+E3 S+E3f#=D{aE3 S+E3 S+E3f$ࢱ!E3 S+E3 S+E3f$7paE3 S+E3 S+E3f%q;!E3 S+E3 S+E3f%N?KaE3 S+E3 S+E3f&Ȩ!E3 S+E3 S+E3f&jaE3 S+E3 S+E3f'Ȕ!E3 S+E3 S+E3f'5aE3 E3 E3f(5!E3 E3 E3f(aE3 E3 E3f)!E3 E3 E3f)-KaE3 E3 E3f*sk!E3 E3 E3f*baE3 E3 E3f+!E3 E3 E3f+-WLaE3 E3 E3f,h1!E3 E3 E3f, HaE3 E3 E3f-aDJ!E3 XE3 XE3f-,aE3 XE3 XE3f..A!E3 XE3 XE3f./RaE3 XE3 XE3f/71!E3 XE3 XE3f/aE3 XE3 XE3f0M>!E3 XE3 XE3f0qaE3 XE3 XE3C1]*!E3 XE3 XE3C1xaE3 XE3 XE3C2"e!E3 XE3 XE3C2paE3 XE3 XE3C3X:!E3 E3 E3C3C2aE3 E3 E3C4ǵD!E3 E3 E3C4LGaE3 E3 E3C5Fj!E3 E3 E3C5VPaE3 E3 E3C6[!E3 E3 E3C6\aE3 E3 E3C7ՑQ#!E3 E3 E3C7|+8aE3 E3 E3C8 !E3 E3 E3C8@\aE3 E3 E3C98!E3 E3 E3C9caE3 E3 E3C:o!E3 E3 E3C:g aE3 E3 E3C;.b`!E3 E3 E3C; AaE3 E3 E3C<TB/!E3 E3 E3C<5aE3 E3 E3C=S!E3 E3 E3C=}OVaE3 E3 E3C>O!E3NE3NE3C>]aE3NE3NE3C?`!E3NE3NE3C?ܰaE3NE3NE3C@v.x!E3NE3NE3C@ aE3NE3NE3CAN5!E3NE3NE3CAc aE3NE3NE3CB`q!E3NE3NE3CB3aE3NE3NE3CCR T!E3NE3NE3ܓCaraE3沀E3沀E3ܓDJE{!E3沀E3沀E3ܓD,jbaE3沀E3沀E3ܓE'uS!E3沀E3沀E3ܓE]'}aE3沀E3沀E3ܓF!E3沀E3沀E3ܓF؅ϒaE3沀E3沀E3ܓG}//\!E3沀E3沀E3ܓG`CaE3沀E3沀E3ܓH!E3沀E3沀E3ܓH@yaE3沀E3沀E3ܓIk!E3߀E3߀E3ܓITaE3߀E3߀E3ܓJ'D!E3߀E3߀E3ܓJs@aE3߀E3߀E3ܓK0!E3߀E3߀E3ܓK ~aE3߀E3߀E3ܓL!E3߀E3߀E3ܓLǯSaE3߀E3߀E3ܓMΡf!E3߀E3߀E3ܓM d"aE3߀E3߀E3ܓNi^!E3߀E3߀E3ܓN䃅aE3vE3vE3ܓOB!E3vE3vE3ܓOaE3vE3vE3ܓ;b!E3vE3vE3ܓ:*caE3vE3vE3ܓBoJ!E3vE3vE3ܓ:3aE3vE3vE3ܓ5k!E3vE3vE3ܓ:aE3vE3vE3ܓ;.!E3vE3vE3ܓ:$aE3vE3vE3ܓ(!E3vE3vE3ܓjo;aE3I E3I E3ܓ8"!E3I E3I E3u*j ,CaE3I E3I E3u*2,!E3I E3I E3u* FaE3I E3I E3u*4%!E3I E3I E3u* [JaE3I E3I E3u*2`!E3I E3I E3u* M aE3I E3I E3u*^E!E3I E3I E3u* UAaE3I E3I E3u*13r!E3E3E3u*  L gaE3E3E3u*6Tҙ!E3E3E3u* ^laE3E3E3u*|~!E3E3E3u* =+#aE3E3E3u*Tq!E3E3E3u* #aE3E3E3u*xɜ!E3E3E3u* baE3E3E3u* H6KA!E3E3E3u* aE3z9E3z9E3u* b!E3z9E3z9E3u* kaE3z9E3z9E3u* !E3z9E3z9E3u* iSaE3z9E3z9E3u* cR!E3z9E3z9E3u* 3aE3z9E3z9E3u* 9Af!E3z9E3z9E3u* vaE3z9E3z9E3u*8z!E3z9E3z9E3u* W7aE3E3E3u*z=!E3E3E3u* EaE3E3E3u*!E3E3E3u* +CaE3E3E3u*n!E3E3E3 8VaE3E3E3 o!E3E3E3 ꔟaE3E3E3 "!E3E3E3 paE3E3E3 k6O!E3fE3fE3 aE3fE3fE3  dP!E3fE3fE3 OEaE3fE3fE3 ^o!E3fE3fE3  %aE3fE3fE3 |R!E3fE3fE3 v)zaE3fE3fE3 <!E3fE3fE3 K'aE3fE3fE3 ǂ!E3fE3fE3 JaE3CE3CE3 '!E3CE3CE3 &:aE3CE3CE3 q!E3CE3CE3 aZaE3CE3CE3 R!E3CE3CE3 ^aE3CE3CE3  )[!E3CE3CE3 P KaE3CE3CE3 !E3CE3CE3 m aE3CE3CE3 lY`!E3ܓE3ܓE3 r_naE3ܓE3ܓE3  okW!E3ܓE3ܓE3 'aE3ܓE3ܓE3 !wSN!E3ܓE3ܓE3 !εNaE3ܓE3ܓE3 "5M}!E3ܓE3ܓE3 "RӄaE3ܓE3ܓE3 #vJ!E3ܓE3ܓE3W #KaE3ܓE3ܓE3W$6FJ!E3u*E3u*E3W $"H0aE3u*E3u*E3W%*Y!E3u*E3u*E3W %?aE3u*E3u*E3W&>K߸!E3u*E3u*E3W & OaE3u*E3u*E3W';t޿!E3u*E3u*E3W '9ZaE3u*E3u*E3W(s!E3u*E3u*E3W (]aE3u*E3u*E3W){H4&!E3u*E3u*E3W )aE3 E3 E3W*f`N!E3 E3 E3W *IaE3 E3 E3W+>.!E3 E3 E3W +HlaE3 E3 E3W,)1!E3 E3 E3W ,WaE3 E3 E3W-i!E3 E3 E3W -baE3 E3 E3W.W!E3 E3 E3W .*h{aE3WE3WE3W/hV!E3WE3WE3W /h\XbaE3WE3WE3W0 fi!E3WE3WE3W 07vaE3WE3WE3W1f!E3WE3WE3W 14naE3WE3WE3W2[!E3WE3WE3W 2ZaE3WE3WE3W3>!E3ׄE3ׄE3W 3RaE3ׄE3ׄE3W4?r!E3ׄE3ׄE3W 4{w"aE3ׄE3ׄE3W5N3d>!E3ׄE3ׄE3W 5υaE3ׄE3ׄE3>6:Q8!E3ׄE3ׄE3> 6ZOaE3ׄE3ׄE3>7,!E3pE3pE3> 7+aE3pE3pE3>8ұ!E3pE3pE3> 8!aE3pE3pE3>9SrT!E3pE3pE3> 9JaE3pE3pE3>: G!E3pE3pE3> :NaE3pE3pE3>;!E3pE3pE3> ;aE3pE3pE3><Ǖ!E3pE3pE3> <7!aE3E3E3>=J !E3E3E3> =<(aE3E3E3>>Ff!E3E3E3> > ŨaE3E3E3>?!E3E3E3> ?$l!E3E3E3od*E!E3E3E3oI!E3E3E3oOVa!E3E3E3orI!E3E3E3i^L!E3GE3GE3Gi+!E3GE3GE3Gi!E3GE3GE3Gi3!E3GE3GE3Gi/̍!E3GE3GE3GiT>!E3GE3GE3Gi#x!E3GE3GE3Gi?OԷ!E39E39E39iP5!E39E39E39i .!E39E39E39#!E39E39E39j#!E39E39E39yҺ!E39E39E39W!E39E39E39'?<!E39E39E39pI!E39E39E39cR5F!E39E39E39h!E3tE3tE3tB!E3tE3tE3tR\!E3tE3tE3t PN!E3tE3tE3t2"!E3tE3tE3t?"Q!E3tE3tE3t{T!E3tE3tE3tn!E3tE3tE3t_]e!E3tE3tE3t!E3k E3k E3k  ϥ!E3k E3k E3k  5!E3k E3k E3k  i!!E3k E3k E3k  ֢!E3k E3k E3k  fث!E3k E3k E3k  r;!E3k E3k E3k  zg!E3k E3k E3k n!E3k E3k E3k !E3E3E3 i!E3E3E3'!E3E3E3!E3E3E3I!E3E3E3&!E3E3E3S!E3E3E3#\!E3E3E36;!E3E3E3q!E3E3E3B7!E38E38E38|!E38E38E38^<!E38E38E38_!E38E38E38s!E38E38E38<%!E38E38E38I!E38E38E38^2G!E38E38E38!E38E38E38tc!E38E38E38sr!E38E38E388ҽ6!E34΀E34΀E34΀O\!E34΀E34΀E34΀ێ+r!E34΀E34΀E34΀S+!E34΀E34΀E34΀Tl5!E34΀E34΀E34΀إ!E34΀E34΀E34΀U!E34΀E34΀E34΀R7!E34΀E34΀E34΀ck:!E34΀E34΀E34΀'ވ!E34΀E34΀E34΀#!E3eE3eE3e͌!E3eE3eE3eҵi!E3eE3eE3e?2!E3eE3eE3e !E3eE3eE3e !E3!`E3!`E3!`!)!E3% E3% E3% !cv!E3'cE3'cE3'c"{!E3(E3(E3("a]!E3)'E3)'E3)'#Pc!E3)'E3)'E3)'#W!E3*QE3*QE3*Q$zH!E3*QE3*QE3*Q$֧!E3*QE3*QE3*Q%.!E3*QE3*QE3*Q%!E3*QE3*QE3*Q& !E3*QE3*QE3*Q&]!E3*QE3*QE3*Q'>!E3*QE3*QE3*Q''!E3*QE3*QE3*Q(ei!E3*QE3*QE3*Q(WmM!E3*TE3*TE3*T)jr!E3*TE3*TE3*T)6!E3*TE3*TE3*T*MaE3.}E3.}E3>ۛaE3/qE3/qE3>SI!E3/qE3/qE3>6-a!E3/qE3/qE3>6\^!E3/qE3/qE3>6aE3/qE3/qE3>6*aE3/qE3/qE3>{aE3/qE3/qE3>B!E3/qE3/qE3>6#K!E3/qE3/qE3>6h!E3/qE3/qE3>6=AZaE3/E3/E3>VbCaE3/E3/E3>qaE3/E3/E3>%!E3/E3/E3>69vS!E3/E3/E3ׄ6_E0!E3/E3/E3ׄ6b^aE3/E3/E3ׄCğaE3/E3/E3ׄmUaE3/E3/E3ׄD!E3/E3/E3ׄ6I!E30GE30GE3ׄ6u—!E30GE30GE3ׄ6,Q^aE30GE30GE3ׄ,aE30GE30GE3ׄ%aE30GE30GE3ׄqќ!E30GE30GE3ׄ6f!E30GE30GE3ׄ6N!E30GE30GE3ׄ6o8aE30GE30GE3ׄDaE305E305E3ׄyaE305E305E3ׄoE!E305E305E3ׄ6!E305E305E3ׄ6cu!E305E305E3ׄ66 6aE305E305E3ׄ֊SaE305E305E3ׄ<aE305E305E3ׄ`w!E305E305E3ׄ6y7!E305E305E3ׄ6ML!E31xˀE31xˀE3ׄ6aw80aE31xˀE31xˀE3ׄ+raE31xˀE31xˀE3ׄaE31xˀE31xˀE3ׄY!E31xˀE31xˀE3ׄ6;!E31xˀE31xˀE3ׄ6OY!E31xˀE31xˀE3ׄ6!'aE31xˀE31xˀE3ׄ_ZaE31xˀE31xˀE3ׄ.iaE31xˀE31xˀE3p o!E32bE32bE3p6H'!E32bE32bE3p6Ճ!E32bE32bE3p6!aE32bE32bE3pjaE32bE32bE3pa$aE32bE32bE3p[V!E32bE32bE3p6i(!E32bE32bE3p6`R!E32bE32bE3p6z>aE32bE32bE3p 3aE32E32E3p!oT%aE32E32E3p"DX!E32E32E3p6 ,!E32E32E3p6!!E32E32E3p6"aE32E32E3p0j:+:aE32E32E3p1gaE32E32E3p2Ãܬ!E32E32E3p607Qj!E32E32E3p61;v74!E33BE33BE3p62/@aE33BE33BE3p@lPaE33BE33BE3pA0yaE33BE33BE3pB!E33BE33BE3p6@>m!E33BE33BE3p6A!=!E33BE33BE3p6BaE33BE33BE3pP/KaE33BE33BE3pQDaE33BE33BE3pRpY!E33%E33%E3p6Pu!E33%E33%E3p6Q!E33%E33%E3p6RH#caE33%E33%E3`maE33%E33%E3a?o!gaE33%E33%E3b밊!E33%E33%E36`*:!E33%E33%E36a$a!E33%E33%E36btSaE33%E33%E3paE34sE34sE3qaE34sE34sE3rO[h!E34sE34sE36pݞ w!E34sE34sE36q9s!E34sE34sE36rf!E34sE34sE34s3U¯!E34sE34sE3yo;!E34sE34sE3yL!E34sE34sE3y[[j!E34sE34sE3yk=!E35 RE35 RE3y^!E35 RE35 RE3yWvQ!E35 RE35 RE30T!E35 RE35 RE39 SBu!E35 RE35 RE3 VlBu!E35 RE35 RE3À ͯBu!E35 RE35 RE3 GBu!E35 RE35 RE3Ĵ xBu!E35 RE35 RE3w 1ؒBu!E35 RE35 RE3 uvBu!E35E35E3 h JBu!E35E35E35}!E35E35E35P!E35E35E35PFs!E35E35E35P!E35E35E35P]oX!E35E35E35Oò!E35E35E35OvY!E35E35E35Ox!E35E35E35O}@!E36=E36=E36=Q! !E36=E36=E36=QS!E36=E36=E36=N2yO!E36=E36=E36=NF^!E36=E36=E36=Ns!E36=E36=E36=N9!E36=E36=E36=Nk!E36=E36=E36=N!E36=E36=E36=Nw!E36E36E36NЙ~=!E36E36E36Ns!E36E36E36N !E36E36E36N {(O!E36E36E36N !E36E36E36N h !E36E36E36N1Rk!E36E36E36N!E36E36E36N;!E36E36E36NR!E37nE37nE37nNPa!E37nE37nE37nN߀#!E37nE37nE37nNb;!E37nE37nE37nNuW؟!E37nE37nE37nNc!E37nE37nE37nNyn!E37nE37nE37nN SLn}!E37nE37nE37nN Z!E37nE37nE37nN Nc!E37nE37nE37nN!E38CE38CE38CN+z!E38CE38CE38CN}D5!E38CE38CE38CN\.!E38CE38CE38CNlu0!E38CE38CE38CNK!E38CE38CE38CND!E38CE38CE38CNkMp !E38CE38CE38CN!E38CE38CE38CN>!E38ـE38ـE38ـN f>ǖ!E38ـE38ـE38ـN FY !E38ـE38ـE38ـN C!E38ـE38ـE38ـNs!E38ـE38ـE38ـN!E38ـE38ـE38ـN:9!E38ـE38ـE38ـNFu!E38ـE38ـE38ـNi0!E38ـE38ـE38ـNm!E38ـE38ـE38ـN)!E38ـE38ـE38ـN+!E38ـE38ـE38ـN(!E398pE398pE398pN {!E398pE398pE398pN ד!E398pE398pE398pN P!E398pE398pE398pN !!E398pE398pE398pNd]!E398pE398pE398pNz!E398pE398pE398pNn2!E398pE398pE398pN҇!E398pE398pE398pNmH!E398pE398pE398pNJ#3!E398pE398pE398pNb!E39E39E39NBC(!E39E39E39Ncu!E39E39E39N=!E39E39E39N !E39E39E39N 8X*!E39E39E39N "!E3:iE3:iE3:iN !E3:iE3:iE3:iN ߅s!E3:iE3:iE3:iN :!E3:iE3:iE3:iN&5!E3;3E3;3E3;3NxFȱ!E3;3E3;3E3;3Nʞ!E3;3E3;3E3;3NlY!E3;3E3;3E3;3NEȼ!E3;3E3;3E3;3NWH")!E3;3E3;3E3;3NS{!E3;3E3;3E3;3N,T+!E3;3E3;3E3;3Nqxn!E3;3E3;3E3;3N !E3;3E3;3E3;3N !6;!E3;3E3;3E3;3N _мG!E3E3E3E%L!E3E3E3Eg!E3E3E3Eu!E3E3E3EA!E3E3E3x|!E3E3E3wᓲ!E3E3E3wB&!E3E3E3wYq5!E3E3E3w2!E3E3E3wxP!E3E3E3Cpn0=!E3E3E3 $ MBu!E3E3E3ׄ$ĪBu!E3E3E3$.WBu!E3E3E3t$kBu!E3E3E38$jBu!E3E3E3e$M5nBu!E3E3E3($Bu!E3E3E3 U$lVBu!E3E3E3V!E3E3E3!E31-E31-E31-;F !E31-E31-E31-2)iaE31-E31-E3 F!E31-E31-E3*R5aE31-E31-E3  A!E31-E31-E3*Uu5taE31-E31-E3 ~s!E31-E31-E3* aE31-E31-E3 V:!E31-E31-E3*raE3ÀE3ÀE3 i !E3ÀE3ÀE3*deaE3ÀE3ÀE3 o3!E3ÀE3ÀE3*!f!aE3ÀE3ÀE3 9!E3ÀE3ÀE3*T!aE3ÀE3ÀE3 EӾ!E3ÀE3ÀE3G*g*aE3ÀE3ÀE3G Gt!E3ÀE3ÀE3G*u#aE3ÀE3ÀE3G /g!E3bZE3bZE3G* aE3bZE3bZE3G !E3bZE3bZE3G* ǷaE3bZE3bZE3G Jx!E3bZE3bZE3G* !dEaE3bZE3bZE3G C/!E3bZE3bZE3G* aE3bZE3bZE3G +!E3bZE3bZE3G* -qaE3bZE3bZE3G Ȭ`!E3bZE3bZE3G*rPaE3E3E3G \B!E3E3E3G*"ZaE3E3E3G e_3!E3E3E3G*JaE3E3E3G 3!E3E3E3G*%L'8aE3E3E3G  !E3E3E3G*ӜaE3E3E3G w!E3E3E3G*aE3E3E3G jp"!E3E3E3G*#KaE3E3E3G ;<!E3E3E3G*LaE3E3E3G jj!E3E3E3G* E3>E3t*<NaE3ׄE3ׄE3k =fl!E3pE3pE3k *=WW]aE3E3E3k >~!E3E3E3k *>QaE3GE3GE3k ? ,!E39E39E3k *?K)aE3tE3tE3k u!E3k E3k E3k {[aE3E3E3k e?!E3E3E3k {)gDaE38E38E3k & !E34΀E34΀E3k {QaE3eE3eE3k ZR!E3eE3eE3k {( aE3E3E3k vI!E3(E3(E3k {?caE3(E3(E3k !E3 /E3 /E3k {uaE3 UE3 UE3k 08!E3!`E3!`E3k {Q aE3!E3!E3k 5k!E3"E3"E3k {aE3"E3"E3k s`!E3#*E3#*E3k {ğaE3#FE3#FE3k  s!E3$[܀E3$[܀E3k { ]UaE3$sE3$sE3k  u!E3% E3% E3k { Q%;aE3% E3% E3k  z!E3&%E3&%E3k { _0aE3&%E3&%E3k  0!E3&%E3&%E3k { PWaE3&6E3&6E3k  $)p!E3&6E3&6E3k { t{EaE3&6E3&6E3k V2!E3&6E3&6E3{{0aE3&6E3&6E3MI!E3&6E3&6E3{UraE3&6E3&6E3$C!E3&6E3&6E3{k4RaE3&6E3&6E35{!E3&6E3&6E3{ͦaE3&6E3&6E3 !E3'VE3'VE3{UTF'aE3'VE3'VE3G!E3'VE3'VE3{KaE3'VE3'VE3"!E3'VE3'VE3{֓OaE3'VE3'VE3!E3'VE3'VE3{乜aE3'VE3'VE3̵!E3'VE3'VE3{'K aE3'VE3'VE3C!E3'cE3'cE3{#f_aE3'cE3'cE3!E3'cE3'cE3{.ZOaE3'cE3'cE3ʂ!E3'cE3'cE3{;8?aE3'cE3'cE3ⱞ!E3'cE3'cE3{흿aE3'cE3'cE3T!E3'cE3'cE3{zbaE3'cE3'cE3{-i!E3'cE3'cE3{aaE3(E3(E39k!E3(E3(E3{)V%aE3(E3(E3~h!E3(E3(E3{5naE3(E3(E3eXо!E3(E3(E3{q{aE3(E3(E38 5!E3(E3(E38{ aE3(E3(E38!!E3(E3(E38{!xaE3) E3) E38"[]~!E3) E3) E38{"aE3) E3) E38# !E3) E3) E38{#FaE3) E3) E38$Ll!E3) E3) E38{$HaE3) E3) E38%+!E3) E3) E38{%aE3) E3) E38&H .!E3) E3) E38{&FsaE3) E3) E38'p!E3)'E3)'E38{'!ʪaE3)'E3)'E38(=>4!E3)'E3)'E38{(9aE3)'E3)'E38)׃!E3)'E3)'E38{)cAaE3)'E3)'E38*tS!E3)'E3)'E38{*KaE3)'E3)'E38+hҌp!E3)'E3)'E38{+ aE3*QE3*QE38,!E3*TE3*TE34΀{3פaE3*TE3*TE34΀4_[!E3*TE3*TE34΀{4d:aE3*TE3*TE34΀5Οp!E3*TE3*TE34΀{5 aE3+E3+E34΀6*B !E3+E3+E34΀{6rlaE3+E3+E34΀7gd!E3+E3+E34΀{7aE3+E3+E34΀8w!E3+E3+E34΀{8&aE3+E3+E34΀9^!E3+E3+E34΀{9=aE3+E3+E34΀:[)!E3+E3+E34΀{:$%aE3,E3,E34΀;3!E3,E3,E34΀{;PaE3,E3,E34΀<(KU!E3,E3,E34΀{<yaE3,E3,E34΀=Kb0!E3,E3,E34΀{=ɇaE3,E3,E34΀>O!E3,E3,E34΀{>PaE3,E3,E34΀?!E3,E3,E34΀{?`!E3,E3,E3,N!E3,E3,E3,7!E3,E3,E3!ɥ!E3,E3,E3#FYYY!E3,E3,E3,J!E3,E3,E3, 7v!E3,E3,E3,ҙ!E3,E3,E3,T !E3,E3,E3,l!E3,E3,E3$szgv!E3-LE3-LE3&%~-S!E3-LE3-LE3-LU!E3-LE3-LE3'V  !E3-LE3-LE3(FuaE3-LE3-LE34΀ .!E3-LE3-LE34΀aE3-LE3-LE34΀ ^J!E3-LE3-LE34΀UEaE3-LE3-LE34΀ AQ!E3-DE3-DE34΀$yaE3-DE3-DE3e Zt!E3-DE3-DE3ehhEaE3-DE3-DE3e ;-!E3-DE3-DE3e aE3-DE3-DE3e U)~!E3-DE3-DE3e7aE3-DE3-DE3e D!E3-DE3-DE3eaE3-DE3-DE3e hL!E3.}E3.}E3e^!E3.}E3.}E3.}Rl!E3.}E3.}E3.}#u^!E3.}E3.}E3.}c!E3.}E3.}E3.}--!E3.}E3.}E3.}X!E3.}E3.}E3.}ža!E3.}E3.}E3.}(!E3.}E3.}E3.}2!E3.}E3.}E3.}g!E3.}E3.}E3.} P!E3/qE3/qE3/q Ht!E3/qE3/qE3/q \+!E3/qE3/qE3/q &z!E3/qE3/qE3/q |{!E3/qE3/qE3/qU!E3/qE3/qE3/q!E3/qE3/qE3/qIDv!E3/qE3/qE3/qXG\9!E3/qE3/qE3/q#;!E3/qE3/qE3/qm&!E3/qE3/qE3/q,`!E3/E3/E3/*H:!E3/E3/E3/S p!E3/E3/E3/\!E3/E3/E3/mn!E3/E3/E3/l/r!E3/E3/E3/uL/!E3/E3/E3/Y& !E3/E3/E3/ K!E3/E3/E3/ꈂ!E3/E3/E3/e!E3/E3/E3/I !E30GE30GE30G B5A!E30GE30GE30G!!E30GE30GE30G"c!E30GE30GE30G#Q;!E30GE30GE30G$2WR!E30GE30GE30G%d!E32bE32bE32b?6[E32E32E32ss0UE33%E33%E33%ss1GxE3 E3IE3Iaudio0EO”E3vE3vE3vmixer0S1E3I E3I E3I sound0i H E3z9E3z9E3z9audioctl0+*mE!wEE3N`hpxj4Ym&WE!yEE3z9^Y0$KE3)'E3 ,E3 , (0lBE3 5E3 IE3 I",E3 z9E3 z9E3 z9/tmp/disktab.shadow E3 CE3 CE3 C/tmp/fstab.shadow)E3  E3  E3  /tmp/resolv.conf.shadow E3 ׄE3 ׄE3 ׄ/tmp/hosts|jnE3 tE3 tE3 tZE3 -DE3 2E3 6=`E3 :iE3 E3 G@nmE3 wE3 E3 jbRBr)QtyFvw0Lk;Њ<'R@;:5t8Y.*S7D3gc"ELj(f׊(M4|FBƞr*ؤ,W<[U3CBGqS?g [y( . .. catchmodchgrp cp4 ddD dfP ed\exprhostname+ ksh sh ln lsmkdirD mteject( mv pax tarcpio rmsttysyncElite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  . .. pppfirmwaregroupspwd.db protocols servicesdisktab.shadow disktab fstab resolv.conf4 hosts ... ... ... ... . .. bin dev etc mnt mnt2& sbin& tmp usrvarinstbin.profileupgradeinstall  install.sub bsd install.mdboot . ..chowndmesgfsckfsck_ffs+ifconfig+initmknodmount mount_cd9660ê mount_udf mount_ffs mount_nfsnewfs  mount_mfspingping6reboothaltroutertsolumount disklabeldhclient+Pdhclient-script ... . .. binmdec,sbin,share, . .. ftpgzipgunzipgzcat sedgrepegrepfgrepless`morep . ..bootbootxxbinstall installboot . .. installboot . ..misckeymaps . ..termcap ... . .. tmp db runempty . ..! tmp ... ... ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: dialer:*:117: nogroup:*:32766: nobody:*:32767: ELF`44 (UlUlUp!Up!Up@4@4@X\X\\d\d\ptptp z444OpenBSD㿠@ @D* @ +#@㿘""@ `'"  @, / &@ &J `  *"J` b&*"@_@~*`:` J " 㿘& h? h`     , `2 ?, h??@@??㿘& ``  `  㿘     && X`p"U@Ő!X㿘 `  "`㿘@ J 2@@6@@zI /  @  `"@ڐ 2     %UUax@ "@㿘 ?@?`Ŕ㿘 %UUa@ k" `  ` )U+U@ Z@  O4@ X!Ф@@ Saآ`@ @ K!@ 㿘@]㿈'&")&"  "` B%&@` $`Va@{ @F = 2,V`a @q  L `V`a8@g V'B `!@n  &Va @V   "VaX@L  €#   $!& `@"@ $  ` @V@8ǐ! `&Va@" ! &Va@ !C"C"#"@!C "C"&$ "aVa@ &!  Va@ C!&"a V  `2 Vb@  #@_?   $  #@O?    $  VbX @?㿘@@㿘@R&&"`"㿘@I&"a㿘@B& "a?"a㿘@7 "c(㿘& @+&"`& 㿘& @&"`& 㿘@l&:㿘@e&:㿘Vb@_ 㿐@8 ?2& Vb@7 2J& Vb@F `k`m`b". `w . . .  'J`x 4&``*2& @@/ "&`Vb@   Vb@ 㿐 @     & Vb@7c 2K& Vb@  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @! 'J`x 4!&`#`*2&  @ @@㯐 "&`Vb@  Vb@ 㿘&! &    "@    `*& & ``$   $ @$   $`$`&& 㿘V bȔj@M 㿘V bȔj@F 㿘V bȔh@? 㿘V bȔh@8 㿘@ Fc@ FcD@ F@ߐ &!? 3 @c(?`&c(@@6 㿘%&   V"$  $ @Δ $ V b@6r @ #(    )&Vb@ )&  #&V# $ $$ `'"& @! $ `"& @! $ `$  ` #&` V@65b#&@g`'& @2`ؒ ` @Ȑ? $Vc@6 $` !&!  @  $` !@@ $`Vc(@6 &  ```$"`$ ` " @b  $@@ x    @    @Ȕ "@&Vc8@_ !@@G  @"6p xV b@5 <     a@_     @W ?  @o   & 㿘&! &! ! ` %&@ @  &  @  '&&   @ '&  @O  z$ 63 $2VV b@5c " @t@        @ @ @t@&&" ! @  "#!   &$  @  $ " @ $  $  $ &a ` "`& ` !&  &" @d y$ @@& &a ` "` @&``&` "`]&㿘&!C!̀@C&"@C$ &"Ȁ@&*& !& `&@  " @  @ݒ  `"`& @ 㿘& ؀  ``   H# ` & 2 `` V"@4#h` "$` V@c'& @60 &V cP@ @n  V b@4p &   > B;  @2   # !&   " &   #    @ !"@    & - %X'@F+ &!@!@X" 'X\"@`'\А"@@'X'\XW `W?00 h\ DB F?0 ?0 `V d#\@ސ<8@='8 `$`V#V#Vؒ d@Ɛ- %@@&$ '& `  (V#V#`W d@- 8"@ <$ \@##\ `- @DW`` BXW d0 ¨ @;`8<@$@$@  W@ΐ X㿘@m^@m"㿘V@Ґ 㿘)&  2   @/    @, ?A?W`p@3y  6  @L  "  D?D? & c( ?"c(W`x@  $ `ـW@r p рW`p@3@ 㿐'&    @ؔ    @Ֆ ?vtW`p@3"  $ '7a@ cW`p@3    X$ T@ 4A`6W`p@2   7 'a@?W`p@2 ` D 4,$ (@4 W`p@2͐ ` D 4$ 0  D 4$؁㿘@5 X X X X X X X X X X X X X X X X X X X P X X X X X X X X X X X X X X X X X X  X ( X X 0 X X X X 8 %! ''|-G+)W|'W5 $7W 0* @€    c @Q @C@Dᰀ??* & @ @4@@r` |W`a@28 ? '' '| ''|'Ȗ@e @l[`-WWaД@ a@2 @ 㿘 %Wb@J"@ 㿐@  ' @1 @ `@Ő㿐 !W ~@p,"H "L@ " n L` o `@. = ", `"@ 2  .W @ @ @`WW"p"xWbP@7  2 &*@ &" b@  "&&@ @\ # W2&@@k`"2 &@Wb@ &@ 㿘@)%T%%%%%%%%%%%%%%%%%%%%%%%%% %%,%<%%H%%%%%%` /I#/!/%/9/-/;/+ )'W*7W $%* (@€ $aX$!P $` $!P$aX '!T %\ 'adaH Wb@ @#@X@B̔?Ӑ? $#`*@` & ad W@1b@A@ 8  2@Wc@0  @^@! ' @0Ւ @ R  @@  @m@ @@pH=`< @ @2 @@@@ 2-`%a@@ !!T  @W@@0P`@X D 2 aWcp@@0D` @@oՐH`@    @`  @ 4?a` $ ad @@@ `?㿐@   @6  @͐ ` T@! 㿘 !H  aH`?  #&@Ô    2aH@ 㿘 WN  nWc@  &N  o&& "aH "!H %   @[ , ` @*  $H @/ $@ , `$@  @D , 2*@, $@㿘/!T` !H` /!\` @  ., ' D!T @"!x /!\`@o! T@a!!㿐@C?WW#@m0#@m㿘 :  @(  : @      ; @;`㿐W  @m͐# /   " !XВG   @ @ ~@ .  @ v@  ` @ @ j@  @ b@ ` @ @ V@ S  @ N@  W#@my 'XB?@X  BX ?W #@m\ /a` )W  "' XB'XB X BX  W?#ؒ@m2W@m.#W#@m* T㿐/!X`X @'XX @@m//!P` X P$'@ڐ'@ WXX `@@l/!``"XX@l X@l ` !x/!P`X $X "XX Ж@@lИ`n T ` ``" 2'@  ?X'!0 ‰ F?@`X!` @6 `@ s@ #` ` `@ i@ ` ` @6 `@ ]@ Z #\`@ U@ #\`  @  @ H@ E` #` @ @@ w`#`#l#d#h@lfa!a㿘@H ?W@m<#H?@C @  @ 㿘 @z@" @g` 4 @g@d %X"a8@ 㿘  X %aH@"@T 㿘!& !P D?!P%\F!T@"&;? 4& 0& (&  8@  ̘ d & < (#  ; @#<  @ d$"@& @ ,?& Ȑ&& &$ X!T@; Z@7 ZXDa@㽔  㿘+. $aPy$ O?aP 8;#S@2H? L (&B? $*& 4 * &@  (   $@ 4 ?@ `@$&  & "@ &aP& & &&$ X!T@ Z@ݔ ZXDa@c  㿘@=8H8H7 8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H7(8H8H708H7@8H8H8H8H8H8H8H8H7h8H8H77778 8㻀 %!X''  ;X%- +X9/)X7XV 8QM* @€ 'J  /F"apb@r @6J@ 70/X@a /% /'"ath Xb@ @@Ic  c '!l@=#  # @ @W@>؀?? $ * &@ `   0h08䀠.`? @ⵒ  @⯒# X @⩒( @x  X @0 @*    @'  " @} X@O  Xc8@+  @G D "@!@ h "@@@k cX@cH@+ِ @ 6@ 'X@cX@W @X@A  @Y T X@c@B @W  Xc@+  D& `&@@& ) T@:  X@  XX@c@  @  "  @#  X @( " X@c@  /!t   2`X@@( X#@@ָ 2`@  @n@T(@D #XcY@k Y @lG耢 耢 @g. ? @ek`Y`@++ @Ӑ@Ր㿐  @: '%Y@Q@Ӭ`?@iV0  2@ܐ㿘 bl  bl@"   J@ " @  @ %!H'@j  X#HX" O X# X"@@zY`P@C  `5X .@i*(@H Y`X@* @< Z @5  /!l`YY h`@h  @0!  Xc@* 'DD <@T&D/* &   p* &*& 'DY@hӐ D  6 Y!Y.  @hȐ D . Y@h @+@)u @ p`  02Y@i @@c H##Y;Y@`$@ &@g@dj``Ȓ@iy`@ 2@@d\`Y @ik@Ȑ @@@@hq @Y@i[!+  `2  a0# ` /@[ Y!@* /!l`H@S Y X@i5 a@  a Y@!` %!'Y  T !@h2 D/>al *    YYX!0a8 @h  "l` D#3X"l `/Y-Y+Y@`  2 08a@@h ,@`  뀌@`!lYY!8!@@Y!`X"Y!H@g!l   4'̒@Y!h@g/c@ ?Y!Y!8Y!@ ""YY!x!Y@g!0  @  YY!8!@@g!0 YY!8!@ YY!!@g!0  "!lYY!8!@Y@g!0  " YY!8!@Y@gq!0  @" YY!8!@Y@ga!0  !lYY!8!@Y!0@gQ!l 2 @!lYY!8!@YY !@g:!l 2 $@!lYY!8!@YY $!@g#!l 2 (@!lYY!8!@YY (!@g !l 2 , !lYY!8!@YY ,!@f!l 2 0 !lYY!8!@YY 0!@f!l 2 4 !lYY!8!@YY 4!@fʔ!l 2 8 !lYY!8!@YY 8!@f!l hYY!8!@ HYY@f!!Y LYb(@f"  PYb8@f" Y T" @fbHHbX@ޥ Y@ْĤY!8Y!@@!xYY"`p@fs)bx@ކ 7Y!l  ! l 2 p !lYY!8!@YYY l" p@fN"!l 2 t!YY!8!@YY t"@f8b@K Y!l  ! l 2 p !lYY!8!@YYY l" p@f"!l 2 t!" xYY!8!@YY t"@e x " xYY!8!@YY!0@e x " xYY!8!@YY!0@e۔ x " xYY!8!@YY!0@eʔ x " xYY!8!@YY!0@e x mYY!8!@YY!0@e^b@ݻ 8Y! l  YY!8!@YY!0@e l " lYY!8!@YY!0@e} l 1YY!8!@YY!0@el"@c !l !Y!@e\#  YY!8!@YY!0@eK Y#(Y @eB Y@#0㿐@  @6  @A  @: T `@! 㿘 "h  ah`?  #/@1    2ah@ 㿘 YN  nYc8@   /N  o// "ah "!h %   @ɒ , ` @ *  $h @&c $@ , `$@  @ܲ , 2*@, $@㿘 L@ @~@{ @ Y @&: H@0@J@㿐Y'@#P1Y  -, , & @t =   , *& , & & @dM 0 2J&@㿘 %YYYYYcX#Кc@2"@ 㿘 X@lc耢  X@c 26 @6 "0 @[  *Z @U` 2 Xb@N 2 Z@%  Y@BbX 2  Xb@; "   Z X@%ٖ  㿘@㿘@` 㿘@㿘@@㿀Z'T`'  @%@ 2Za@ @ 2] `&` 2 NZ"@@%@UN u2 NZbh@ "  N <2  Zbp@ِ  `( 4*@  @  `Z"x @%j@*J`Z"@%`@  `(* N ^N `(`? `-   * `(*  &`  㿘 ZZb@ b@ 㿘 Z# @cp Z` `%Z  8 @ @cc  2 @`@Z#@@cU㿐'H@A : 'HȐ H+Z 'H/Z-Z@3 = 2,@,@``@:aN@ c Zch@E 2N@s&  i2 N@Zcp@8 2N@f& i2N@Zcx@+ 2 N@c@:8U& $ l2 N@Zc@ 2N@H& o2 N@Zc@  2N@;&  oZZc@  Zc@: *& ( `  'Z N@J@2  @ 2  ? @9  , 2 H5H  H@bX N@ i㿘@ڻ@㿈@L@ -2&` &`` V` ' @Ė 2 # 2  ` [ `@$>@  "  & &`[ x@$-@ @ 㿘   D@z 㿘  " $@0 " `  & & & & $㿘@  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@< 㿐    ``'@X   '``@P & 㿘 @ @_ &  @$**@"" "$@$   """$ "     " "  " 㿘 @s @_2 & 㿘  @0 @$  ?` # & & 㿘@U  & 6 D   $g`  ˒  " " " " $" 㿘[ F @a D㿘@6 [@a 㿐 `'@翔 [`@# 㿘@粒`n [`@# 㿘@祒`o [`@" 㿘[` ` @g 2    ` *@&`   &` U&`  2[#L`#L @M 2    `*@&`  &` ;&` 2\"`" @3 2    `$*@&`$  &` !&`$ 2]"x`"x @ 2    `*@&`  &` &` 2 _```(`< %!') ` *`W# €^@`Ԑ ^@`ϐ (^@`ʐ 8^@`Ő H ^@` X^ h@`@^;@` ^ x@`^ @`^`@@` " ^@`  ^@ Ȁ! 4 ^ В `@@  4 ^ ؒ `@@$ 4 ^ `@@  4 ^ `@@  4 ^ `@@  4 ^ `@~@ ^! @t@  4 ^! `@i@ @ 4 ^! `@^@  4 ^! `@S@" 4 ^!0 `@H@ ^!@4 @>@4 ^!H `@2@4  ^!P `@&@4 ^!X `@@4 ^!` `@@( 4 ^!p `@@4 @"^! `@@^@!  4 ^! `@@! 4 ^! `@ݐ@ @ 4 ^! `@Ґ@  4 ^! `@ǐ@4 ^! `@@" 4 ^! `@@$ 4 ^! `@@( 4 ^!Ȓ `@@4  4 ^!В `@@ ^! @@  4 ^! `@x@  4 ^! `@m@  4 ^! `@b@ "  4 ^" `@W@ ^@F" ^" @I@  4 ^" `@>@  4 ^" `@3@ @ 4 ^"( `@(@  4 ^"0 `@@  4 ^"8 `@@  4 ^"@ `@@ "  4 ^"H `@@ ^@"P(2 #4 ^"X `@@ #!"^"  4 ^#4 ^^@ِ"`4 @Ր"h 4 ^@А"p4 ^@ː"x4 ^" `@Ő@4 ^" `@@4  4 ^" `@@4  ^" `@@$ 4 ^" `@@4 @^" `@@4 ^" `@}@" ^@j"Z ` %^` @@ d@@c` @ 2`@O D@K Z  `2 ^^"بb d,`` " ` @%@}`  @^@r 2 ` @] @]` @ ؀!^@]""@]  ^@"㿘!/! ^@]ې $!/"!㿘!/!  /!^@]ː"$!@!@`H ^^@]"^#@] $!@]#!@$!㿘 ?  1/^!x@ &!x/1^ # !x M.!x -*  ^* ? *4* ^*@**!x@ %! $'H'" '% $'H(@0̐?2 e"  f a + g% !#@>  '^#c0@  @H*` ^@Zc H*`@  ^H* @'H ^c8@M `@e ^cH@ `h@Z `^@]#X` `H H` HHH''@ OH +^L =H 7H 1HJ@? &`T   `  H@q@@Z/@ZQ'Hch@  He`'^@o#p@/H 'H   @  ^c@2    `g@Ӕ ^@]s# ^@D# 㿘  ^ %c@P"@ 㿘@2rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr(+\)/'/%/!/#_/ $5/9W7 -* a@€  %!  $ሐ $ $!@@/`??!* @ &", "  . " `. @_@`@, @> @'@@9?@ui _`@~ <  "@@  @@  `@@@ /! %a '/@u> _d /!`/<  2 /@W "_P !`i!Ҕ!0€ '/<   /@ _0 #_$`@#( @WN  ?"`@\^"/!`/@\А  /@W:`2 _/!€ _ @\@   _@ 㿘  _ % `@"@ 㿘@Ozz{${|D||yyyyyyxyyyyyyyywyyyxyyyyx<yyyyyyyyyyyxhxxxxyyyyyyyydyy yxyxyytxhhhXhhh8hH㿈 '/! -8+8#'@589_/@)87_q;8 8l]* |@€ L  @  $ L_' L  @  V$ L L  @   'K$ L G%c C%c L  @  :$ L L  @  1$ Lc.' *$ܐ && L  @  $ Lc#0@yJ cJ `" @ c  / %"D %"D@ }@-Δ?? $# L*@`&  $ L  c    L "8@ X L8 @` "@  `@# 6 L@#_c8@ΐ ?`]d*` € @ 5@ @g @p @ %@o @@W @ Zx @ @\ @D   %"@@0  %* b@:  @ @ W? 8@ 8bH@_`@#@ _`c8@i @ 8@R @0/ , `m@ %_cH@L ?  @   ``@bH8bH@bH@!@  8#@@ؐ㿘@N _c`@ @ޔ!&&& `&$@} 㿐8"@ ` _@,#x!8#_@'##_@##`@  (  !W&&6@ @ct6@c   e`f@ߋ 8@U` 8@U``h X8"D`   aD + 3` @;   aD + 3` @ ; `  p@Y 2H'  @S 6 ` ' `m@F 6_@ِ#H@? ` @ΰ 0% !' `m@+  _@ξ#H @#`2  e`g@  ` @ 0 㿘@T "`   `_ "` _ !!``!@m0#8@Y㿘@#`s8"D`  * 2`   :  @@` !Д @X  @˖  8 c@qc 9@#_c8@ `0 !W`0 ` 8@ ɐ*  b8@`@"8@@"\``"@ "8 !W !`2  2   "@ *  8" (_@#82 8#` `s@k 8`bX@ 8#䀢`8"He`r@Y `bp@ "He`e@M  `b@ `"H@& 㿘`( 2 @"&`&`( @!@먒 !Ԁ@ `J b@  *J㿘N```"`bؐ @뫖`N` `bؐ @뢖``"@ђ`8 ` #8* `c@뒐`(c@덐`(`@눒c `,`@냒c(`0`@~c0`4`c8@y`8`c@@t``<cH@o`H`cP@g_c`J`c`@]_c`L`cp@S_c`N`c@I_c`P`c@?_c`T`c@5 `\`'`,@),` L  #x)@9`7`5`/`-`+`@ 7`@С= @#@ `@ ` a *@@ ` @ `  2` ` ,`@< @`@ޒc`@ ¢` @T@&#dd `B(#dd`B(8 +D]`(&$'#dd`B8#dd`B ` @a@a@a#x. / ? @@? @ a   B@a `@ka0@ a #`#d#h#l`0#\@\a  a  cx* @a`P@O0 `X@J  a_  @la_ `` #  @a a `x@,`@& .ja`@f `8`"b  @a`@ @R`8  ?`&  @& * *@w0?`&  @&  * &@f `8  @??a`@ސ `8@Q  ?`&  @ * *@E ?`&  @  * &@3 ?`&  * &@% 㿐.>` % <*`@ R`   @#a`@锐 `@#a`@錐`  #8* a`@遐aa`@{a``@u aa @o` 2*`(aa@h`X`aa@a`X aa(@Z`X aa0@S ?`&  * & @`(a@@a@`,a@;aX`0a@6ap`8aa@1`4aa@,. :``<Wa( 9 ?a`<a@ BaaȔ@ @  <`8a( 9 ?aa@aBaa@ @a`Hb@ %a'a)aB+a`Ja@ޒb `La@ْb8`Na@ԒbH`Pab`@ϐ`Tab@ʐab@Ɛ`\`   ? / `"? &   a!a.@"@諐.ab@裐`@蟐#c @蚐`  <`` @ݐ %! '@豐 0?a@bc0 ?_@_#8@U}0 b@ !@ѐ@Ux     ac8@WacH@S@Ͻ-_/_+8Q)b !@(@& @O Ԓ@罔!c @Ϝ@TW! %@"@ %` ? "`@   " ? %!`? $`@Ӑ  $耢` 2` n N@  0@ے@ 2X8@T@Ux0  b@͐!0㿀bba8@b'''!H'@R' b!Pb a`0@䀢?b@TӐ!hV  '@  @  @ 0 @O`#b@u @  b!@R@۠ @T!@2$ @.  ` `2`@VS  @S ?@O~`@Ox`  ' @ڭ  @ڪ  @ڧ  `?㿘b@PגaL  㿘1b@O@!L  !, @PL   㿘 & TL  ?   ` "     @,, 㻈 %!'&`  &`0a@ ,@ "%@" : b!@`,ba@7 :bb_ " a@Ő  _! #8 <? " @ 8 *? 쀢`'耢 b!Ȕ@6`a@ :b'耤3L /-b)b'b!bN@  '@ܒ"  '@Ӓ  '"@p`L@ &`Xb0@ʻ )b L `\)b ?'쀢`'"@@H, $ t L@ p  mb`@)耢 ? b"p@) Y6`W6`b_#b@u b `b@l b`@Q ?b@` b ?֖쀢 '耊a"+&`(b"@#`b@E b ?쀢  'b"@ْ ` &`,b@+ b ?쀢  'b"@`&`8b@ b ?쀢  'b"@ת`&`0c@ b ?m쀢  'b"@`&`4c@ݐ b ?S쀢  'b"@q`&`<c @Ð b? 8쀢` 'b"@W`6`Hc(@ɨ b? 쀢` 'b"@<n`k6`Jc8@ɍ b? 쀢` 'b"@!S`P6`LcH@r b? 쀢` 'b"@8`56`NcX@W b ?͖쀢  'b"@`&`Pch@= 2 @ ?쀢  'b"@ђ`&`T cL` c*`: ` b#6`* @m ?쀢  'b#@`&@U ?h쀢  'b#ؔ@`$A, ; cx  X   " @b x *L@? &`T   `    -'$:  '쀢 c耢 c @C',  (n#i ?쀢 ^$b#@#U`ݐ? @'H, b#@ ?`ǐ ?ږ쀢 4$b#@+`? Ɛ@'耤, b#@`?  4$: 6` 0@ϒ`#@Д b@@ᴰ`?  c@ Pb#@`㿘 (  c ` , 2 0c p 2 4c @   2 Hc @   H 2 8c @  8 2 < ,@ 0& 8 < 2  8@ 4& < c @r  @K ( c@i  c! @a  @K| ( c@X!8 `c!h@Q   \)@ /c-c+c  a @== @KY 8 ,`:`@4 @KP 8 ,`:`@+b2  "    c@"@  <@,`c"@:`  < c,`"@:` 2    ,`c"@:` @  4, #ca  " @c `% %X'!@m!@h'XDP'H'L7'@֝! c@#@p %!'%_c cP@C@ⶐ! %,@ccp@ⷐ"ccx@Ⳑ"cc@⯐"d`@⫐"d`8@⧐"d`@⣐"d`@⟐"d`@⚐"da(@═"dah@␐"da c@⋐"dda@⅐"db(@⁐"db`@}"dd"b@w@  (   @*`2 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx$|Dx4hxxxx0xxxLxDl<<<<<<<<<<<<<<<<<< <<<<<<<<<L\|,<ތ<<<<<ޜެ< ޼<<<,T,TTTTTTTTTTTTTTTTxTTTTTTTTTTTTT,TTTTTTTTTTTTTTTTx㶸 %!('@!  `  @  e @   e @  ee``@ e`p@ Đ$@  @ @ @`  "e`@ e"e"@ @! ܀ 2ee@Ր `8$  7$ d'$ , 4 , e@Ő!`' r'r 2e 7re@!X@!(1 %e"@@2$@? e  ?`$ "@* &"@@f  q/(/)e!@خ e@ب *`:` pK* j @€`e X@ e!@E@A! @ $@ !@8@s!  @)! eِ!@!@@ @W! 2eߐ!@ !@@'@@! 2ueȐ!@!@e`r@Д e@ \e@Ml!!@א@Ӕ! @ @ @@!  @߻! 3ek!@߱!@߭@ؐ@! 2eq!@ߛ!@ߗ$ @@Д! 2eX!@߂@~! @ a@ ^@ے@Ӱ!  @f! e  e %" @be@ =@ :@n@ X "e@ -e` L@"@ e @ e"X@)' eL@ ee"`ebp@a?e@IWb  x  q!@n@I͐0e"@L@@Һ e@#`4 @ )@8! *)e%e!e` @ %#8*`@ R``y*: `  %#8*`@ R` n `"@# 2L@`ǰ L@`  %#8*`@ R` y 8c e@ #( @ Ւe@ѐ#@)e`eee#`cp@ eL@ eeb@ e#@L  e   b @qe@Ɣ!   @  e@#e!@o!@k!@g@  @ Ge@}#e@#`e@t"e @ z@҉! 8e@a"ecj e@ #(e@/!e0"8 `?""8e#e#e@JÐ#e@!@!@ efL@J e %! f@f (㻐 %!'  f % 0@䟒b$ * :?    ,  %f"``@X pᴐ `G  `C %f"`@H:ᴠ -f` +f   , @`2  "    a//% %)f'f(@& p@`ඒ N,  ` @ @!   6 , `&  &&& & @8 &.  . ($&  . 6@ % " {&$&@.   +  ". +      "  +  2  `+ . @ @  2N& ϐ@ f!X@IВ a&&@ @ 28&@  21&0"8`" 2@  2"&@  2&@  2&0" &4 @}? @ f@~J!㿘ff!a@ 2Jf %!@〒b07*   &  %f"a(@<`0&    ` %f"b@.a0 `   *  a *@  %f"@b 0@ 㿈ff"Pbh@r 2Jf %!@6b0.    ' ' '' &   %f"a(@`0     %f"b@ڔa0@ v w    `  " ` `       %fb"@ܭ , &" &@ D@ % 2T$ N$@ f@0"$ $@ k #0"8`"'   2! @ g @    2 @ א  $$ $ $  0b4 @\? @~㿘ff#c(@ 2Jf %G!耢 *!?  h" `  " "``""` &"`"`"`"` `0M   * %f"a(@`0A `  `  %f"b@a0/ f %#`@!b0' 0b40"0      ` &" " " ` " *@ @]&@㿐@Ւ 0b"00b00"4 `@@   * @  8? @ ?   + @@  @  #@    "&@+  "@ @    +  +   `+ &@@㿐gg `0@ 2Jf %j!贆   . %f"a(@<`0o `   %f"b@0a0cg@a@GQ h@@ ` ` #\  #`@ggฐ@̒??f %/!2@g %)! 9 `   # @  %g"@a0'" &@"@ @ &@ ` < g %!@@b0`0b4  $@@? @㿐@ܒ  @00"0b4  @ # `@@>@ @ ?㿘/ g!p*a' %e X@Fa$@t 2a ` ,a X ?4  " X* $ X @  ! a@b ?L ", L`?@ La`2La@w$La ?ax % 8\ ! `'@BD-g %a ?/@FZ$@  ` /X ?4  "X* $X @  ?@  ?L@ O ,@O ?O@O ? *`O ` `b?L@`  %#8*`@ R` c" 8 k &"B b %-OJOF" ( m gO=O95,@ (,@1 d 4 @^$ ( (@U @o,@gaȁ g$?@z3 <O @o,@g!ȁ g$@z$?O + - @A~'"@o~@Ax?`";?J`@Al? 2"g'B!؁F '@Đ 'g!؁F 7ā@' B'-:  + -"'`@?> 'g!؍B 8' g!؉BgagB!Ё7ƅB' B' @="8@6" @0"g!@E& %! g@yސ!㻈 %!'@  0@v @`@ u %"@ g/g)g-g-`,`@@   _l?l""@2 2``a`a@D"HP@Dܐ $   æ/g - %`'%"$* @DX/$@| O X` ?"` X* $ X@ # O` ڐ?*  *  @ @ @&y`@ -`(2 @@ ! g@y<" %!!X'@ˬ@g@Dk"  ;g9g7g5g/ % g *` bТ "If@#(    `̀  , @ 2  )@DC0P@J@ # %)g`%g, @D7#h p@<b@  , b@` ?"`b@* $b@@s   gg6 #xcT 2 f %!@b %" &@f %b@ !@Z! %@ )g'g%g# % ,#\#` #Ж{ ?〤?@b ,& ,)h'h%g# % 0#\#`  c ?ˀ?@גb 0& 0)h'h%g# % 8#\#`  8PK ??@ݿb 8& 8)h'h%g# % 4#\#`  3 ??@ݧb 4& 4)h'h >b4 <"@  %h"@`a` <  4 @  4@ #\#` ?j?2  <g %!@sb <#0Δb4ˀ @$ @h&@@Ԑ!(b48$b4& <)h'h%g# % H#\#` !Ԛ ?p. `@ 2` ?* 2  r@h@#8h@B#P `̲ )g% %;h9h7g!g.`@@B#h` #p@܋@``.`@`? "`@ * $@ E6 @ ' /g-gcX#h "cX@(  ̑.`@  ",6 ``(.`@BN0P@U@ !g.`@@BD#h` #p@I@``.`@` ?"`@* $@@ ŐcX㿐)h'h%0!f# %#\ <#0#` Ȕ2 <!@b0' -h+i#0'f) %b4"@0" #\#` `2 <@"0 "@b4 $b4$0@i㿐Ғ 20"0040a"a" " L"   ` 100"0!&!  " 64!0b40!(@ *2 @ *@``  #``#  *@` ##  *2 &ّ*!( "@& @ <00 4""0000 4 "@ @    "  "4  b0* @ "@ `@ 㿘?* : `6S*`j" €i@Ȑ `0i@Đ!0i@"0i@뼐#0j@븐 0{j@봐#0wk@밐"80sk@묐"0ol@먐 0kl@뤐!0gl@렐"0cl@뜐#0_m@또 0[m@딐!00Wm@됐"@0Sm@댐"0Om@눐#P0Kn@널 0Gn@뀐 h0Cn@| n@y!n@v!@n@s!`n@p!n@m!n@j!n@g"n@d"(n@a"`n@^"n@["n@X#n@U# n@R#Hn@O#pn@L#n@I#n@F#o@C o@@ 8o@= `㿘'e   "@ԅ @? 2$`@ѐ @   " @ $ <㿘   `" `2 @ ` ``   %!p' @$ t   , @ " "@ "    `d#oa@  N r oa@t$@B / "`N@`r2G o.@$@t`.@@?,z l@%x e@b  )  "o "aht   @*  ` a*@ @#\#\@ؔ  `@ 2@@:  o@t"㿐.` gobP" ! %-f+g)o'o%o ` #\`   #`^ @Ӓ"% 20a@̒" ` "0 "@ӑ"H ` 0"4 "@ӈ ` `"@ ` $` 㿐.` %g%#o``2   < g %7!@  "N$ " @&E$ %p"@O` H c#\``  #`? ?f %!@hb&  g %!@_b "  %o"@ c  0b4  %p"@` $ 㿐.` -p+p)f% %'g`#\#`a ??!@' @!` 2$`p@鋐!8$` 㿐.` ` 7p, J f %!@bC 5p) %/g-p+p @@#\#`hpx??@V: @Q"@Ҩ @: a@C p"0@ɒ" @8,  㿐.` ppbp"x)f# %%g   #\#`, ??!@آb  24 @؛b  㿐.`  ` `( ! *` pp"b   , @@$ 2 ,` 'p@>h" !,` f %!@jb +p)p'g% % ` #\#`c0#Hߚ ?ꀤ?@S ` ,`  㿘. `E A ? = ;.#p!p /p@ @Γ@א *&@e``@D  %#@$b@c#p#O  pf %!@b c@ 2N@  @g&@ 㿘 2 @@ 2  2@ `?@(@? q`@m @'! #ee``@ `r@  6 &@`e@ 6&@q` @R &㿘  qqq 8`` 2 f %g!?* : `3dj#*` €2(q %U!& (,& ,0& 04& 48& 8<Q& <`2`(q %B!& (`,& ,`0& 0`4& 4`8& 8`<>& <2(q %/!`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ q %!0@Hb0q %!h@Bb㿘 " " " "   <& 㿘@2|44,4㿀 !Ȁ?" @_  h  ?AAA $!" "# " ܀u#a{"( € x @"`$!Ȓ @є!  $!@8xH@AB !ȀT ܀`P @ M!Ȁ  x h "`$!Ȓ&@ƭ!  $!@8xx@A !Ȑ $!Ȁ, ܀`( @n %!Ȁ  x h "`$!Ȓ @ƅ! $!@8ex@@  !x   ""!Ȁ ?1 Ԁ A@  A@8Ex Ԕ@@֐ Ѱ? !@m` 6 `@84 x@@Đ ! <  x`@@ !@ڝ??$!$܀2 !a@   !Ȑ $̒  @q ?2 $̀2 $@7`2$ ̀`2$ h  `!   ""as# i{"Г*` €c? h  `! "!Z"`` H>c? !" "` h !̀    >"!?;"a h !!  : `@ 8@%!?" % 1 >$  耢  : `@ 8@ 耢  h $  h ?  &!&!" "a"%  $԰ 㿀 aȀ   AA" "`"a #  !̀`# !H`' |?`" * " @ !x|@@a(@|# a܀ !A@e    <    <8  @<`$a  h` ! !L`! @8̒ @َ! @;, !  !̀`2 A!  |x@1!X |@N"aHA ?$A   l"`" aА "a! b" !H`' |?`" * " @D $!Hl !!axa a`@κ|@ |;"`x!@! x  |@r  x@Κa#!@֐! #  a#\l#`#d#hx!a?`@|@|$`?c % !̦ ᴀ`' aԀ   ?#! !Ȓ@T? 4!$ x@o@!㿘 ! "a؀ 1 !Ȕ  @    !@   @65?x@>ǐ 㿘 !̀`Axb@> ? `  x!bP@> ? 㿘 !Ԁ 4 !̀  a@S A  #" ! "A" a@S A "` $!@5 x!Д@>u 0 !xb@>D 㿘 !Ԁ  aȢ @:   A"`"6$!$! !̀ W 1 Q !aȔ  @ E  > b a@O ; 7$!Ԁ 6@5`".$!@5`"($!@5 `E# @5` xb@= $!P @5s`"$!@5m`" $!@5g` $!԰   "A "`؀  xc@= 0(  !xb@= 0  @5A x!ДH@=ѐ 0 l``"x@R xxcp@= 0c@= 㿐A `g? aԀ b  `h? xWcA A "` !̀ 4=# 9A X # 2$ a7  a'@_ 6&$%Ԁ # à % "% Ȓ  @M  > @?@ dȒ@?   $# Ԁ y`@@=.  y`@=( ?㿘  >2@ `(=  !Ԁ 4 5!ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . .."MAKEDEV# fd$presto0ap` % rpresto0a` &presto0b` ' rpresto0b` (presto0c` ) rpresto0c` *presto0d` + rpresto0d` ,presto0e` - rpresto0e` .presto0f` / rpresto0f` 0presto0g` 1 rpresto0g` 2presto0h` 3 rpresto0h` 4presto0i` 5 rpresto0i` 6presto0j` 7 rpresto0j` 8presto0k` 9 rpresto0k` :presto0l` ; rpresto0l` <presto0m` = rpresto0m` >presto0n` ? rpresto0n` @presto0o` A rpresto0o` Bpresto0p` C rpresto0p` Dbpp0to0Eccd0ao0Frccd0a0Gccd0b0Hrccd0b0Iccd0c0Jrccd0c0Kccd0d0Lrccd0d0Mccd0e0Nrccd0e0Occd0f0Prccd0f0Qccd0g0Rrccd0g,Sccd0h,Trccd0h,Uccd0i,Vrccd0i,Wccd0j,Xrccd0j,Yccd0k,Zrccd0k,[ccd0l,\rccd0l,]ccd0m,^rccd0m,_ccd0n,`rccd0n,accd0o,brccd0o,cccd0p,drccd0p,eccd1a,frccd1a,gccd1b,hrccd1b,iccd1c,jrccd1c,kccd1d,lrccd1d,mccd1e,nrccd1e,occd1f,prccd1fqccd1grrccd1gsccd1htrccd1huccd1ivrccd1iwccd1jxrccd1jyccd1kzrccd1k{ccd1l|rccd1l}ccd1m~rccd1mccd1nrccd1nccd1orccd1occd1prccd1pccd2arccd2accd2brccd2bccd2crccd2cccd2drccd2dccd2erccd2eccd2frccd2fccd2grccd2gccd2hrccd2hccd2irccd2iccd2jrccd2jccd2krccd2kccd2lrccd2lccd2mrccd2mccd2nrccd2nccd2orccd2occd2p,rccd2p,ccd3a,rccd3a,ccd3b,rccd3b,ccd3c,rccd3c,ccd3d,rccd3d,ccd3e,rccd3e,ccd3f,rccd3f,ccd3g,rccd3g,ccd3h,rccd3h,ccd3i,rccd3i,ccd3j,rccd3j,ccd3k,rccd3k,ccd3l,rccd3l,ccd3m,rccd3m,ccd3n,rccd3n,ccd3o,rccd3o,ccd3p,rccd3p,vnd0a,rvnd0a,vnd0b,rvnd0b,vnd0c,rvnd0c,vnd0d,rvnd0d,vnd0e,rvnd0e,vnd0f,rvnd0f,vnd0g,rvnd0g,vnd0h,rvnd0h,vnd0i,rvnd0i,vnd0j,#!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up # . .. 0rs 1rs 2rs 3rs 4rs 5rs 6rs 7rs 8rs 9rs 10s 11s 12s 13s 14s 15s 16s 17s 18s 19s 20s 21s 22s 23s 24s 25s 26s 27s 28s 29s 30s 31s 32s 33s 34s 35s 36s 37s 38s39s 40s 41s 42s 43s 44s 45s 46s 47s 48s 49s 50s 51s 52s 53s 54s 55s 56s 57s 58s 59s 60s 61s 62s63s MDTERM=sun MDDKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' ARCH=sparc md_installboot() { local _rawdev=/dev/r${1}c _prefix if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_checkfordisklabel() { local rval=0 disklabel $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std random bpf0 R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; uk*) M uk$U c 120 $U 640 operator ;; tun*) M tun$U c 111 $U 600 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; pf*) M pf c 59 0 600 ;; openprom) M openprom c 70 0 ;; lkm) M lkm c 112 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; bpf*) M bpf$U c 105 $U 600 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 30 0 644 M apmctl c 30 8 644 ;; wsmouse*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd*) M wskbd$U c 79 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 78 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyIcfg ttyI0 ttyI1 ttyI2 ttyI3 ttyI4 ttyI5 R ttyI6 ttyI7 ttyI8 ttyI9 ttyIa ttyIb ttyHcfg ttyH0 ttyH1 R ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 ttyH8 ttyH9 ttyHa ttyHb R ttyGcfg ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 R ttyG8 ttyG9 ttyGa ttyGb ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 R ttyF4 ttyF5 ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg R ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 R ttyEa ttyEb ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 R ttyD6 ttyD7 ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 R ttyC2 ttyC3 ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; bpp*) M bpp$U c 104 $U 600 ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 125 0 666 ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 36 $o 660 dialer uucp M cua$U c 36 $(($o+128)) 660 dialer uucp ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 19 $U 660 operator ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 2048 ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 R sd1 sd2 sd3 sd4 cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 R tun3 bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R fd1 fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D R fd0E fd0F fd0G fd0H xfs0 ss0 ss1 ch0 cuaa cuab cuac cuad R ttya ttyb ttyc ttyd ptm local wscons audio0 uk0 random lkm R tty00 tty01 tty02 tty03 apm pf systrace xd0 xd1 xd2 xd3 R raid0 raid1 raid2 raid3 std st0 st1 fd ;; presto*|xd*|xy*|sd*|raid*|ccd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi  . .."MAKEDEV# fd$presto0ap` % rpresto0a` &presto0b` ' rpresto0b` (presto0c` ) rpresto0c` *presto0d` + rpresto0d` ,presto0e` - rpresto0e` .presto0f` / rpresto0f` 0presto0g` 1 rpresto0g` 2presto0h` 3 rpresto0h` 4presto0i` 5 rpresto0i` 6presto0j` 7 rpresto0j` 8presto0k` 9 rpresto0k` :presto0l` ; rpresto0l` <presto0m` = rpresto0m` >presto0n` ? rpresto0n` @presto0o` A rpresto0o` Bpresto0p` C rpresto0p` Dbpp0to0Eccd0ao0Frccd0a0Gccd0b0Hrccd0b0Iccd0c0Jrccd0c0Kccd0d0Lrccd0d0Mccd0e0Nrccd0e0Occd0f0Prccd0f0Qccd0g0Rrccd0g,Sccd0h,Trccd0h,Uccd0i,Vrccd0i,Wccd0j, ss0Xrccd0j,Yccd0k,Zrccd0k,[ccd0l,\rccd0l,]ccd0m,^rccd0m,_ccd0n,`rccd0n,accd0o,brccd0o,cccd0p,drccd0p,eccd1a,frccd1a,gccd1b,hrccd1b,iccd1c,jrccd1c,kccd1d,lrccd1d,mccd1e,nrccd1e,occd1f,prccd1fqccd1grrccd1gsccd1htrccd1huccd1ivrccd1iwccd1jxrccd1jyccd1kzrccd1k{ccd1l|rccd1l}ccd1m~rccd1mccd1nrccd1nccd1orccd1occd1prccd1pccd2arccd2accd2brccd2bccd2crccd2cccd2drccd2dccd2erccd2eccd2frccd2fccd2grccd2gccd2hrccd2hccd2irccd2iccd2jrccd2jccd2krccd2kccd2lrccd2lccd2mrccd2mccd2nrccd2nccd2orccd2occd2p,rccd2p,ccd3a,rccd3a,ccd3b,rccd3b,ccd3c,rccd3c,ccd3d,rccd3d,ccd3e,rccd3e,ccd3f,rccd3f,ccd3g,rccd3g,ccd3h,rccd3h,ccd3i,rccd3i,ccd3j,rccd3j,ccd3k,rccd3k,ccd3l,rccd3l,ccd3m,rccd3m,ccd3n,rccd3n,ccd3o,rccd3o,ccd3p,rccd3p,vnd0a,rvnd0a,vnd0b,rvnd0b,vnd0c,rvnd0c,vnd0d,rvnd0d,vnd0e,rvnd0e,vnd0f,rvnd0f,vnd0g,rvnd0g,vnd0h,rvnd0h,vnd0i,rvnd0i,vnd0j,rvnd0j,vnd0k,rvnd0k,vnd0l,rvnd0l,vnd0m,rvnd0m,vnd0n,rvnd0n,vnd0o,rvnd0o,vnd0p,rvnd0p,svnd0a,rsvnd0asvnd0brsvnd0bsvnd0crsvnd0csvnd0drsvnd0dsvnd0ersvnd0esvnd0frsvnd0fsvnd0grsvnd0gsvnd0hrsvnd0hsvnd0irsvnd0isvnd0jrsvnd0jsvnd0krsvnd0ksvnd0lrsvnd0lsvnd0mrsvnd0msvnd0nrsvnd0nsvnd0orsvnd0osvnd0prsvnd0pvnd1aprvnd1avnd1brvnd1b vnd1c rvnd1c vnd1d rvnd1d vnd1ervnd1evnd1frvnd1fvnd1grvnd1gvnd1hrvnd1hvnd1irvnd1ivnd1jrvnd1jvnd1krvnd1kvnd1lrvnd1lvnd1mrvnd1mvnd1n rvnd1n!vnd1o"rvnd1o#vnd1p$rvnd1p%svnd1a&rsvnd1a'svnd1b(rsvnd1b)svnd1c*rsvnd1c+svnd1d,rsvnd1d-svnd1e.rsvnd1e/svnd1f0rsvnd1f1svnd1g2rsvnd1g3svnd1h4rsvnd1h5svnd1i6rsvnd1i7svnd1j8rsvnd1j9svnd1k:rsvnd1k;svnd1l<rsvnd1l=svnd1m>rsvnd1m?svnd1n@rsvnd1nAsvnd1oBrsvnd1oCsvnd1pDrsvnd1pEvnd2apFrvnd2aGvnd2bHrvnd2bIvnd2c,Jrvnd2c,Kvnd2d,Lrvnd2d,Mvnd2e,Nrvnd2e,Ovnd2f,Prvnd2f,Qvnd2g,Rrvnd2g,Svnd2h,Trvnd2h,Uvnd2i,Vrvnd2i,Wvnd2j,Xrvnd2j,Yvnd2k,Zrvnd2k,[vnd2l,\rvnd2l,]vnd2m,^rvnd2m,_vnd2n,`rvnd2n,avnd2o,brvnd2o,cvnd2p,drvnd2p,esvnd2a,frsvnd2agsvnd2bhrsvnd2bisvnd2cjrsvnd2cksvnd2dlrsvnd2dmsvnd2enrsvnd2eosvnd2fprsvnd2fqsvnd2grrsvnd2gssvnd2htrsvnd2husvnd2ivrsvnd2iwsvnd2jxrsvnd2jysvnd2kzrsvnd2k{svnd2l|rsvnd2l}svnd2m~rsvnd2msvnd2nrsvnd2nsvnd2orsvnd2osvnd2prsvnd2pvnd3aprvnd3avnd3brvnd3bvnd3crvnd3cvnd3drvnd3dvnd3ervnd3evnd3frvnd3fvnd3grvnd3gvnd3hrvnd3hvnd3irvnd3ivnd3jrvnd3jvnd3krvnd3kvnd3lrvnd3lvnd3mrvnd3mvnd3nrvnd3nvnd3orvnd3ovnd3prvnd3psvnd3arsvnd3asvnd3brsvnd3bsvnd3crsvnd3csvnd3drsvnd3dsvnd3ersvnd3esvnd3frsvnd3fsvnd3grsvnd3gsvnd3hrsvnd3hsvnd3irsvnd3isvnd3jrsvnd3jsvnd3krsvnd3ksvnd3lrsvnd3lsvnd3mrsvnd3msvnd3nrsvnd3nsvnd3orsvnd3osvnd3prsvnd3psd0a3prsd0apsd0bprsd0bpsd0cprsd0cpsd0dprsd0dpsd0eprsd0epsd0fprsd0fpsd0gprsd0gpsd0hprsd0hpsd0iprsd0ipsd0jprsd0jpsd0krsd0ksd0lrsd0lsd0mrsd0msd0nrsd0nsd0orsd0osd0prsd0psd1arsd1asd1brsd1bsd1crsd1csd1drsd1dsd1ersd1esd1frsd1fsd1grsd1gsd1hrsd1hsd1irsd1isd1jrsd1jsd1krsd1ksd1lrsd1lsd1mrsd1msd1nrsd1nsd1orsd1osd1prsd1psd2arsd2asd2brsd2b sd2c rsd2c sd2d rsd2d sd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2j (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxrsd2jsd2krsd2ksd2lrsd2lsd2mrsd2msd2n rsd2n!sd2o"rsd2o#sd2p$rsd2p%sd3a&rsd3a'sd3b(rsd3b)sd3c*rsd3c+sd3d,rsd3d-sd3e.rsd3e/sd3f0rsd3f1sd3g2rsd3g3sd3h4rsd3h5sd3i6rsd3i7sd3j8rsd3j9sd3k:rsd3k;sd3l<rsd3l=sd3m>rsd3m?sd3n@rsd3nAsd3oBrsd3oCsd3pDrsd3pEsd4aFrsd4aGsd4bHrsd4bIsd4cJrsd4cKsd4dLrsd4dMsd4eNrsd4eOsd4fPrsd4fQsd4gRrsd4gSsd4hTrsd4hUsd4iVrsd4iWsd4jXrsd4jYsd4kZrsd4k[sd4l\rsd4l]sd4m^rsd4m_sd4n`rsd4nasd4obrsd4ocsd4pdrsd4pecd0afrcd0agcd0chrcd0cicd1ajrcd1akcd1clrcd1cmrd0anrrd0aord0cprrd0cqxy0arrxy0asxy0btrxy0buxy0cvrxy0cwxy0dxrxy0dyxy0ezrxy0e{xy0f|rxy0f}xy0g~rxy0gxy0hrxy0hxy0irxy0ixy0jrxy0jxy0k ,rxy0k,xy0l,rxy0l,xy0m,rxy0m,xy0n,rxy0n,xy0o,rxy0o,xy0p,rxy0p,xy1a,rxy1a,xy1b,rxy1b,xy1c,rxy1c,xy1d,rxy1d,xy1e,rxy1e,xy1f,rxy1f,xy1g,rxy1g,xy1h,rxy1h,xy1i,rxy1i,xy1j,rxy1j,xy1k,rxy1k,xy1l,rxy1l,xy1m,rxy1m,xy1n,rxy1n,xy1o,rxy1o,xy1p,rxy1p,xy2a,rxy2a,xy2b,rxy2b,xy2c,rxy2c,xy2d,rxy2d,xy2e,rxy2e,xy2f,rxy2f,xy2g,rxy2g,xy2h,rxy2h,xy2i,rxy2ixy2jrxy2jxy2k/J4rxy2kJ4xy2lJ4rxy2lJ4xy2mJ4rxy2mJ4xy2nJ4rxy2nJ4xy2oJ4rxy2oJ4xy2pJ4rxy2pJ4xy3aJ4rxy3aJ4xy3bJ4rxy3bJ4xy3cJ4rxy3cJ4xy3dJ4rxy3dJ4xy3eJ4rxy3eJ4xy3fJ4rxy3fJ4xy3gJ4rxy3gJ4xy3hJ4rxy3hJ4xy3iJ4rxy3iJ4xy3jJ4rxy3jJ4xy3kJ4rxy3kJ4xy3lJ4rxy3lJ4xy3mJ4rxy3mJ4xy3nJ4rxy3nJ4xy3oJ4rxy3oJ4xy3pJ4rxy3pJ4tun0J4tun1J4tun2J4tun3J4bpf0J4bpf1J4bpf2J4bpf3J4bpf4J4bpf5J4bpf6J4bpf7J4bpf8J4bpf9J4ttyp0J4ptyp0J4ttyp1J4ptyp1J4ttyp2J4ptyp2J4ttyp3J4ptyp3J4ttyp4J4ptyp4J4 ttyp5J4 ptyp5J4 ttyp6J4 ptyp6J4 ttyp7J4ptyp7J4ttyp8J4ptyp8J4ttyp9J4ptyp9J4ttypaJ4ptypaJ4ttypbJ4ptypbJ4ttypcJ4ptypcJ4ttypdJ4ptypdJ4ttypeJ4ptypeJ4ttypfJ4ptypfJ4ttypgJ4 ptypgJ4!ttyphJ4"ptyphJ4#ttypiJ4$ptypiJ4%ttypjJ4&ptypjJ4'ttypkJ4(ptypkJ4)ttyplJ4*ptyplJ4+ttypmJ4,ptypmJ4-ttypnJ4.ptypnJ4/ttypoJ40ptypoJ41ttyppJ42ptyppJ43ttypqJ44ptypqJ45ttyprJ46ptyprJ47ttypsJ48ptypsJ49ttyptJ4:ptyptJ4;ttypuJ4<ptypuJ4=ttypvJ4>ptypvJ4?ttypwJ4@ptypwJ4AttypxJ4BptypxJ4CttypyJ4DptypyJ4EttypzJ4FptypzJ4GttypAJ4HptypAJ4IttypBJ4JptypBJ4KttypCJ4LptypCJ4MttypDJ4NptypDJ4OttypEJ4PptypEJ4QttypFJ4RptypFJ4SttypGJ4TptypGJ4UttypHJ4VptypHJ4WttypIJ4XptypIJ4YttypJJ4ZptypJJ4[ttypKJ4\ptypKJ4]ttypLJ4^ptypLJ4_ttypMJ4`ptypMJ4attypNJ4bptypNJ4cttypOJ4dptypOJ4ettypPJ4fptypPJ4gttypQJ4hptypQJ4ittypRJ4jptypRJ4kttypSJ4lptypSJ4mttypTJ4nptypTJ4ottypUJ4pptypUJ4qttypVJ4rptypVJ4sttypWJ4tptypWJ4uttypXJ4vptypXJ4wttypYJ4xptypYJ4yttypZJ4zptypZJ4{fd1aJ4|fd1bJ4}fd1cJ4~rfd1aJ4rfd1bJ4rfd1cJ4fd1BaJ4fd1BbJ4fd1BcJ4rfd1Ba4rfd1Bb4rfd1Bc4fd1Ca4fd1Cb4fd1Cc4rfd1Ca4rfd1Cb4rfd1Cc4fd1Da4fd1Db4fd1Dc4rfd1Da4rfd1Db4rfd1Dc4fd1Ea4fd1Eb4fd1Ec4rfd1Ea4rfd1Eb4rfd1Ec4fd1Fa4fd1Fb4fd1Fc4rfd1Fa4rfd1Fb4rfd1Fc4fd1Ga4fd1Gb4fd1Gc4rfd1Ga4rfd1Gb4rfd1Gc4fd1Ha4fd1Hb4fd1Hc4rfd1Ha4rfd1Hb4rfd1Hc4fd0ac4fd0bc4fd0cc4rfd0a4rfd0b4rfd0c4fd0Ba4fd0Bb4fd0Bc4rfd0Ba4rfd0Bb4rfd0Bc4fd0Ca4fd0Cb4fd0Cc4rfd0Ca4rfd0Cb4rfd0Cc4fd0Da4fd0Db4fd0Dc4rfd0Da4rfd0Db4rfd0Dc4fd0Ea4fd0Eb4fd0Ec4rfd0Ea4rfd0Eb4rfd0Ec4fd0Fa4fd0Fb4fd0Fc4rfd0Fa4rfd0Fb4rfd0Fc4fd0Ga4fd0Gb4fd0Gc4rfd0Ga4rfd0Gb4rfd0Gc4fd0Ha4fd0Hb4fd0Hc4rfd0Ha4rfd0Hb4rfd0Hc4xfs0c4nss0c4enss04 ss1nss14enss14 ch0cuaa4cuab4cuac4cuad4ttya4ttyb4ttyc4ttyd4 ptmwsmouse0wsmouse1wsmouse2wsmouse3wskbd03wskbd13wskbd23wskbd33wsmousewskbdettyIcfgttyI0gU uk0ttyI1gttyI2gttyI3gttyI4gttyI5gttyI6gttyI7gttyI8gttyI9gttyIagttyIbgttyHcfgttyH0gttyH1gttyH2gttyH3ttyH4 ttyH5 ttyH6 ttyH7 ttyH8 ttyH9ttyHattyHbttyGcfgttyG0gttyG1gttyG2gttyG3gttyG4gttyG5gttyG6g`21 ! !Ȓ  @    A @ 8C 4 2 > <(>8@ b >8  !@   @4y?y @= x?$aԁ㿐 !Ԁ 6 !̀ M  y~ `(|$Ԑ @<’`s? ! q `(o$!Ȕ  @   @4Ay @<ӔZ?b  !Ѐ`y @<aK?    !@ D @4y @<08?@= 2 " 1 `(/$Ԣ :`@n@ y@`h `x@8`@  !̀ | z   !`y@;$#y@;!#0  !`y@;#Xy@;# `h? yy@;#9y ? "z%`a@;. ?a@:#9y5z3z-z7 1z)z/z'z@:#@:@:`0@:X@:, @  O ?%`M&Ԁ` O逢 2 `Y `s`S 0 `y `؀ i`@:z@: 'z @: !z@:!'z1z!@:@: @:!H@:, z`@ O  ?z %`#!@:?"!H 2zz@:!Xax@ z@:y!@1,z@:p!F z1 !䀢 @ƺ`&!@ R$`ؐ &! a z@j"㿐@g zb@ː @ `"!zb @ @ J0@ F@o@m0" @ < @ 9 z b0@ 4 @ 1 zb8@X@V@4 zb@@  %!#?cP'@> t  l`D ll`  f!` @  ^!@  Y!@    cH+ %@ >l ` l?? <  @B0@( #l@,U @' l@( l2@b@ @B l`(a  @ȁ @'D! z@j."x %!?cP '@   l`D  l`  @2 !X`@0 @ z-'?` l ???<"ؐ f @' c l@+Ӑ @#aP !?!8`6" @垐 /aP a8 #@  "#H @fa8  ?`H  `V?`@ M`@&  l@'  l @.א  <@a(  !`9!?" @L 1a( !``@#  "#`H  a( ?`H?`@  `@` @ @B0!    |@   |@ "aH  "  "@ " @00z @8   6 4? @@a  @ @ @B`@.D p!H`l  | `?"`@* "@@r [$!H@  l  @ @ @nB@.0H? <ؔ @ `!H`  | `?"`@* "@@; $!H`2 ?"  @ @:B    @aT  @/z@8- @  l`(  @ @1N@% z@hk"؁㿈  l?` '@- @ l`0@@-耦`@䀦``, lX` 0@.  @+``% '7z@ "@, `   ` @A  '@/!@7 0@&h  !t` @Ȑ  @@-A0y!  |@|@  $H`ƀ"ࠒ  a H #| `?"`@* "@@S $aH@q0Bl`@@fa  H #| `?"`@* "@@. $aH 3耢  `쀢 ( @耢 %`    `@ `@ِ `@)j !P?B'@-] ;`l`4@ua  @š !$`@0*@5 %! ?#P`l '@    l  zc@6 y l`D q l`  kaP  @, c l @./ Xa    `|z@c0 "aH  aP  @, " l@.  @  l@(ؐ  @xB  l`(@,Z @y   !!H   |z@#`$!HS  z@f#h %!P ᴀ`'@,L !@    l`D ?#P) ! z@f#p?bp?H? %#PaԐ? ' d '@,z2 !?L+ /!?ad)cx#H@M / /-@`-@,""ad@K   "@-^zad@5 Qa< @ @zadc@5 Da@* ?a@ :a@. 4!X`@, ,a@10#??b'@(  'P 2L!8`;L /d?@>zc@5z 0cHbؐ@̒ #-@P a8   @c   H ca8 ?`H?`@  @@* ͒! @$) Ȓ! !?#H @% a(  !`+"ؒ @ᅐ $a( !`  @#   H #a( ?`H?`@  a     |@< "aH!@`"@< @J ! g!H`c  | `?S"`0V   ? @ @ !@*!  @l ?bԦ  '@,Iz @4ڔ0 @M 6@ݒ@*t0"@ؐ@w@ђ! !H`  | `?"`@* "@@ $!H@c !  @D @-@a {@d 㿐  lA` ? ' 5{- 3{ "g?  @ `T h E @4B`h `@䀥 l` $€ %l` ``8 ( `  h !{`@4    @C ѐ` `8   0{`@ ?{`@3 ?`  "`㿘  8"`  "*` * & 6@ Ap?@ * @*`@"l@ܒd ` " 9 7{ U{@y O"   h L? @3 @v 4  `8@  " `8A @*` *  . `@  2  h ? @3w  A` @Š""@Š" {a@3b ?㿘a B  "`  l`&!!? {a  !{a   "" {a  @35?0` ""`耢      ?!  @8"`#  㿘  hB`" !? {b@ {bp "@2?0`؀  I ?`   # :#` B?  " "a㿘!D`{b     " "a "!  s   " a  @ :; F@ @  @a :@ D E@d ( `% a@$@ % 蔒 -  $"  : a $% a$@ % a@ab  %;a8    "`h {bؐ @2B?㿘 !`L   h`{c@20 C? ! 7? ;   B@ " 8"`(   :!#   :  a蘒 쀢   {cH@1 0f  J ?㿘`" "`@㿐  p?` " :   2 @    @fU%   :`@ @@  :?@ f @ B D (8.  "@:`   ` @h:   2@    d% `  㿘#`` !  "@Ւ   a@e$`㿘`$" '#% `"@  @@T蠒 @?`@V`&@@$`` 㿘`$'#`"@  @ &@ `@,`&@$` 㿘'  "   @a蠒 &!?< 2 @ @_ @ < f $ ` ( P@'  "   @a耢 &I>: 2 @  @E  @ :d $ 4`8 @(0` {p  {c@0 ">@P @(` {@0 >?@ {c@0m >  P@  '"` ,@  Ѐ 2  P>@'{ @0p  >'/0- :2 @   #\@Ú !t` :   #  : $  @ d ` "@%@ Ē   P`4   `@ 4 ` !t ?!t`2   @|`  @/ΐ  PX  * 2`  *` '     "2  @   @q Ѐ 2  '@'3{ @/Ė'#' `@ #\@ <@ E`@D蠒 怦!@' | P @/ 1 P    @   |`x @/Z @   @@& | @/s   |` @/<   P`  `@9㿘 a  )  $% # ! n   :`!谒  "aD? `> B@" 8"`㿘   ` 4+  1%      '% @3' |`@.Ӑ *      =`i"D!    "`@=`] && %'    =` M "`&& c@ `` <`B=`  @ &"`$  " `@ <`C &!=`@$  `l @$ @Cǒ  "aD?㿘! !  1 " 2?!=@e  $!  " | &" aP@.C ?㿘! "  1 " 2? @H  $"  "| &"a@.& ?㿘! "  1 " 2?!=@+  $"  "| &"a@.  ?㿘! "  1 " 2?!=@  $"  "| &"a@- ?㿘 !` E1|!=@%y* @ ! `! $2 !`2? `2.1|: !  @ !`$!  @ (!=@%Q* "@@䴐   & |8& $@]˒ `21|"02& $  @L  &㿘 "`C E1| @%* @ ! `! $2 !`2? `2.1|: !  @Z !`$!  @U ( @$* "@@   & |8& $@]l `21|"02& $  @  &㿘@ "[?N V b   &N?@&!=* @ #   @  #  7?! $a  @W a`$a  @&}!=@ (, "@  @☐ ?` &@ @ @⌐  $` $ $&@ $?㿘@X "[?N V b   &N?@&A * @ #   @  #  7?! $a  @ԓ a`$a  @& @ (, "@  @ސ ?` &@ @6 @Ґ  $` $ $&@ $?㿘@!㿘|b@7   ? P`@  ?㿘 <    < & +& "*0.P(P$#"P(0  #&  &  &  &  &  & P   o @& &  <@!K ? % %!?#P' @Z '  '|b,'t@` `l0@ |@\K"㿘l|b@+ ? 2 |L 2|N   |b@+ ?㿘 P   @   4!  P P@ |@+b? P,  W @"&,| c ,@ N,  |c@@+t ?㿘`K |c`@Y   ?㿘 L h!    :` @  & `  @  & ` @  &` @  (& ` @  ,& `$ @  $& `* @  0& `0 @  H&  P @&  8& `A@ : `;@p ` &L < (  @ &,., Y ?  W㿘@"@ %!c'@"Ԕ ư?``   :`0& ",    A4  #`P  A @՘  `|ch A @A  !ǒ @8  ~#`   @.  t`   @%  k`    @  b`(   @  Y`,   @   P`$   $@  G`0   *@   >`@   0@   5 ; @   - L  `  ``|c     2 ,֐, 6 `|c@*!  ? |c@*  ! }@Z 㿘`m }`@   ?㿘`m }` @   ?㿘 @."at㿘!t` n Ӓ n #`  :` @ + `& ` @ % ` &` @  `(& ` @  `,& `. @  `H& `@& `8& `6 @ u `P:`& @  `$& `> @  `F @  !?# @ `*  * `& `N @  `V @   @ `*  , `0& `f @ Ԕ `&`^ @ Δ  ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b Y ` ?  |㿘 @ "at  %!'?@!? #?` ``0&!t`!’ @   `   ! @     @   ` "(`  (% ##`P   `  b ` ;@ 6 @   `}Ò`(,   ;   ;@ 6 @ H  %   @ >      @ 5  (   @ ,  ,   @ #  @   .@   $   &@   v `  >@   l'? @ `2 @ F @   _0 `  N@   U V  2  @   I ^ @ ܖ  A n     n  $ )  }"`P    # 2! ,, & , $   6 }`x@(  ? }`@'   }@Xs ؁` (:`((!Dž0: 2`(0 ?   ?㿘ڒ   !    S;` `*  & ` `*`@& ` `*  & `  (`*`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `*  & ` (` *`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  ;`*`+ 2 *  @ :``, 3`@`H`8& B&?&E :  $ 3` < @ (@ `P   &,.,   `  b` ;;   @  b  ` ?}  &p %!?c'@ !B?  ?  0& Ѐ J  `] [  P * 2` * 2` `@  c * 2`   ` `+=  `-5@ *   - @ (`(`(`(``-) }`, ; ;  , ;  `***   : .`.`.`.` )   =(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  2 *   (`(` ( 2 *   (`(`  , 2 *   (` {(`  $ 2 *   (` n(`  0 : *   (`a(` @ ::: *`@ `**`@ (`(`(`J(`<  *` @ (` ?(`d  ^       }"a    $ 2" ,?,   , "   6  }a8@%  ? }a`@%w   }@U!d8dee\eHe<e(e\e\e\㿘#`   c.@ 6,`@\ #?@!` } , ( @}  }@%^  ?&@ݔ 㿘`D !x`  , (  @:a  `  3&   @   p`  t`  8 @   @@  @|} @%  (, @3  @i}  @$ ?<   @B }b@@$ ?㿘`    @+  ( @ !,`  2    }bp@$   (@ג O#!,`2Q @@`@ }b@$h @?<  @ .#0 @!| (#, @?}Ȗ@$t 0"@$m ?@a  `@v` }  @     %a  '   ` ["*` €@} @$/ *?!}@א# !p` @#?,@@ < ( @ 2' &`0 `0 @f@"} c8, @8 }cp@# ?"%@A! @ ``!` } ( , @ؐ ~}@# ?!x`` (, @ʐ , @o `oa  !  3& !  @ѐ%`F) !}@*# >@,  (!@Ϟ @} @#e @ c@a!  &` @N )    p `  t`` @;  p   t`"  8@ @   }@S{#؁(@K #!,`2*?<  @$ 6 ` @l}@   @^~@" ?(L /?  / )  @@Î  6,@ 2 , c@a@Ŕ , @K / ,@ @Œ! !x,?( " "" '$ 3 `p   t`b @Ȓ `p  $b   t`b  $ @~  @"b @j  @~@@"s ( "0""0 &$ 5 p   t`@ p  $b0  t` $ @~  @"E@b0  @~@@"7 㿘@ 6" !~@א p @` !`@b 2 ?@}~x@" ?㿘@ 6" !~@ p @b` !`@8 2 ?@S~x@! ?㿘@J 6" !~@ p @8` !`@ 2 ?@)~x@! ?㿘o@  @~@! 㿘@&  @~@! 㿘\s)~ 2 '&@"&`(& N    L "  2'<`  @:  >@4 7 !!  ~`@r @` $~a@! ?@&*@@  @~@!# ?2&㿘!??@    @w~0@! 0b@@ߔ   @g~@  㿘@ @?&@!$`  8   @ 4 ?c  %!'  `  &c  ` 8?# :D @ 6  `@ @@5  ! P      ~aH%? @7  @  ~` @   ~ax@ Z ?  @W  @  ~@ q ? &  ~@P!yxyxyxLxyyxxyy㿘!p  "`  "!|` "!l` @" "L`@, "`~b@  ?@  ?!$` @k? 6 㿘 ~N b0@  ~bP@ܐ ?@i?`$ N /".  bL$$  $ $  bP " "bP ""P"bL 㿘 "T` "`!L` "`!4` `  "X bH @M 㿘!$` @ "L )~' %%~  4   2 `2 @}"x @ 2 㿘 "H + @$bH!%)~'~bL`   @0, 28?"T "&"T &"T-?"T` "@@1aT  "T@Ӱ?"@f 0@e@ bL@"T?@W 0 $ @ $bH 㿐` % "`  % # @H  $bX ٰ? :?` 5#d*` €!$`bX @ @ bX `i0bX~ b@ 0bX~  bX~ 0@ 0bX~ P ., bX   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X;`X `;`` h ;`h< "9"20QRbXbXM (-  PAbX08;bX!$ 3&  @ 8@ )bX% # @ & : & , @, 6 ,@bX~h @r 04&,  & bX @,,&,&bX `&  㿘!<`)"% %'~`? $`@z  $耢 *`@@ = :, *`,? ! %@l!耢 *@ 2%, `  2,0  %!`? &`@@  $耢@2`~c@Ґ  (a< %!'  !`" @@?`&@ * &@ܷ@a `@C !\2  `(;!@@  @~o`(@uȒ @ /` ` #h`   #`#d`0#\ @ ` ? ?` 2   ``H@`8`X@@`&@  * &@P @u ?` @ `, @h  2 @ h, @\?`&@ * &@!@a @M p8a\ %!'  @;a @ 4  %@@}̐@u% @ "/  @Ȁ x@  @MJ 㿐@V` N N N @ϐ@ N 2N0@w   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0(2   0(2    0( :( ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ?    *    J ** 㿘  "c`4`I?"J@ - $ ` *` "cJ `@ꎔ3 . :  "ଐ"'?@   :2J @ %"`Ѐ :2.  $  %@"`@ؖ  ?*@$". > 00\h@XXXXXXXXXXXXXXXXX8XXDdXXX|XXXXXXX(XXXXXX$,pXXXXX X4LdpX$(ll4@lLXllllllllltXlllll|lllllllllllllllllll,l8Dllllll (8lL$8888888888DP`8x8L8888888@888888888888t@8888@88@ (8888㿘@@x /`"!`@$!!@!P @0!@!h @H0!x$!@P  5Y- `JT#ē*` €O#c@!$!`Gca@ @? "a09 "a44#"`. "aX)  "a,$@ "a@ "aLc@t 0#-* : `#*` € " p   " t"x"# p " t  "ax  "aLa@ @) L  ݤۤ@Ec Ӥ "!$ͤ  "!PǤ   "! @!## 'b"8 @a H  "`l#a@^  % !@#bb '+@"@  `H"@b 0P"("`!@6#: #  `b0@/ @` a bH @#"@g "!8a !# @"p  ?T"a@dp#  N"abx@ 0@ c A "!|;   "!p5  1"`@"!p, @ ^c $@ rc  "!l  "!(  "!   "!< @G@ٔ??B   %sې"@ "`| !%hqȐ   @@  !  @  ! " %h @@ؐ@  hh ` # "`lh`A#p*` €! $! $#7# *@@ #@# $#0& $#@b@L @?. @"ad# # *P@ #@# $# "!㿐  " x'    ) 7; `J *` €#c@ !` $!ca@  @!* $! % h "! cJ@ -2 J` " ؐ ~'" z' w" tu s  "axm" i"aL f% h@c a@f]Z% ha U"a Q"aX  " tL% h0"(#D"` @"a|@-`   @b@G cԑ,"?'"? #"ap!' x "al# "`#0 #@ #P#`#p#"`@ Ȁ?O? $#& *` @ h 2 % %" %"@'`| h?   h @GW  h   y -;97U5` 7@# ) %!@g㠢 ! @)@ !@  @@ #@  @ #cД@  @@@ےc耢 2 @`@ (`% `@X` 6 @@ "@@c  `@ 2Ԁ`"   # # "`l@j# @T Ԁ p+ ˒  k+ @Hh` D   !@8!@w#  %!c@g !c @@  ! @@ #@S  @y (cД@m @!@@>c耢 2@`@ ".%a`n  @  d` @@ @@c  `@ %a ! ؀ "J @9 $ J #0$ ؁( %+<@@ L `?,@+> @ `@/! @ ?   @  ?` /,`ΐ P !  ?#x$! 4"h"a#a,"t# ض     /9 $`D"0*` € "a$ "&! "a0 %`h "a@ &t #`  "`l%`h %`h "aX %"@ "`|%`h&, "aw"( ~%`hz"a@`ct"a!#@ec  %#c@f @%@Ē @Ő @]`V#c@Q @OcJ - J #B%#?%!## 'b"8 @* H  0"`l#`@@*  %  X@bb %)@@  `H@" @ "ap#  "` " "`l@@!?@?#`h* `G@"*` €@ ? @K` 6@@@ 2@01@  b@Ր @q@"ad `@h@  @b "!%! %ђ @"!耢   `x@ @M@K㿘!! %`@;"   "`J 6 `@0"@ 2@ "`?"`" * $"@ә 㿘@X@      㿘 "``@k ! %1"@  2@ 㿘 N  a@h b@H :?ab@@ @k0?L , ' @ , 2,@@ = @' 䀤`."@ "`"` `  ""  $L ې 㿐 @h  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @ @  㿐@c  2  J?` '@  @@* "`  㿘 %b@9!0@Ct 㿘 %b@1#@Cl 㿘! %"@) "@% "@!!("@!p!@"@CT 㻐 %!' "N  b8 `L@` @`\*`: @2`hbX@"  bx@ u?,@@ޔ @+$b@  @4_?`,@ J \2N2 2 *@͐ @*bX$ $J + !*:  P" g G" 0  p"0 $ $@ݥ @,@"@ ?J   `` $ " d"``  `d " "`d! @C"#㿘 N  c@  c(@ ?$@$  X$ $ `$ $  `\ " "`\ " \"X 㿘  X  )' %%  2 `2 @_#X @  2 㿘  X`  !L`   \$  W !4`22 X 2 *`2) X2*@f   $c@"  ` /*@6$  ` /*@$ @?$ J / * $ $ &  X       2    @" &c@ ?㿘 `X  &!L`/!0`4?2   #@.         J@ /2 @w 2  a0a0`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ !4`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  㿘  x` )/ N  /&`x .  'N   . @ @6&`x  $`x @`x `xN  /"N `x 7`N, /3`` ? ,`  .,  'N,  ., @f, @,&,`x  $`x @ƒ`x  `N, /`? (N, `  ,@ؖ  *     , ,,@ǖ !X`@     ,, @,㳈 %a !'@O -+)'%!r@DH@B`x@@ @O, :@<ఀ @30@,O@+ 0〢  .@$!#  O逢 @! !8@ @`@,,&,& ? @@!h㿘 @ ? ` ,, @ ? 㿘N@`/ "@l$&@ax@ ?  ?*@  * . ?*@ .   %! %?``''L@, F D@3  @ 2  ,@` @* @#@p  %?Wa@ Z L@ @"@  L    ʐ    2ª  ?@0,@` @@L  @,@L  $a@d % O  O耢   %"a@ O"a@O耢  @L"@  %! @?"㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @ͻ:&* &|,<l㿘 @"  "aT@m @e!D@"袒 L@ "@V ' %J?`/"?@  $`b@ AD `@Ĕ`"h /* "h_@N &+D@B %  h` *` €DXD ܀`c(@a ׯ DrD>D㿘 "a "HcH@a 0cp@\ ΃@!$`@@>W h @V   ?@Ӓ @K   ?@Ȓ @@   ?@ @5 2?@ @4#   "\@   ?؄ؔ"!   '''@Ӑ   Ȁ    @Ȕ Y @  Ȁ    @ G @  Ȁ    @ 5 @  Ȁ    @ # @  Ȁ    @  'ؐ @w @q    @/?@  ȸ|<DŽ㿘  ` @s 2   ` @ې 2    `" @   㿘 "S?N # `   !=@o  $`8`N # \N  #" @ 2 `P@ ? ,?  @ؔ @Ŭ!=@Ґ`, @ " 2@   ``p@  ?, "  "" 㿘 (!=@ `* `"  @ 2` `2@ 㿘 "S?N # `   !=@  $`8`N # \N  #" @0 2 `@ ͐ ,?  @f @!=@``, @ " 2@  ``@  ?, "  "" 㿘 ,!=@7 `* `"  @ 2` `2@ 㿘  N a @  / "N,@`N & ?А , *: * :  .2a8 2a8 @ P J 2 @E  `a` L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ a@  S`L@  @@r N$`$ @ 6  a $ ( L $@~  6   aؔ@ @$  $  @ a@ ؐ @? ` $  " "`   ` " "`b @  ? `AH@` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@N`   & TJ?   ` 2 .2? 2? J 뀢?@l9  @ې 2?L?Г* @L *`В@ `=r$@$@` k!*` €N Б* N * ?Д * *  * 8$` "NNБ*` N * `?А @$` ?Г* @N *`А@$` D  d$`N?Г* @N *`А@$` ,  )?$`N?Г* @N *`В@$` ` `""?N?Г* @N *`В@`$`  N?Г* @N *`В@ `;$` ?@p$&@?? 㿘1  2 )@Β  &  b@  ?㿘  `r%`$`g )@5`-  :      @ 2  @ 2   , @~/,l&,,&  `  &  ? $  $@@$ @S  @^Ð  $``$  `$$  - ` $ @ $  "@ @gb@ 6 ?㿘!  8#`$`3` / - +`@) *  "  2  `   @ 2  @ 2   #@&@$㿘 `   *@  "@`@@ `2㿘1  1B !G@  & b@ Ő 6?!h# # 1* * * * * * * * * * * * * * @k!`  "`!`@ 0 @)!`0@  ?㳈 %! ` ' 2  1@G- @`<+@2(``!    @l ` `   @cX@  ^?@G@o= ```2@`  @`  B$`@ @5  1!    @3  <` @.  @-  $`$@ $`!" @@@ 7  `@pc@  `?@)? @9u#㿘1  2 "@  &  `@ߐ ?㿘  ``8@Ґ I @Z"`, @`0` `@@| 2```@| + @`@]! &``h@ @] &@@]  &``,   &` " @@@`@ ?㿘!  @@ " * @ @|N 2   @|+ &@&@ 2㿘1  2 !=@q  &  `@R ?㿘` @  ? 㿘  `-!=@ِ`, @` `2` " @  `, ""  "" `@  㿘   ` }  @ 2  " *     +2$`& `W& `R   B`25 "5 @̐ 9"" "$ 5   &z   @!q  a  &` @  `"" "$  &   &a @ a@@  㿘1  2 !=@  &  ax@x ?㿘 `   *@       2<㿘  `6!=@,`@     2  2  @5  @[  $,`$ $ $ $  $ " @Pa@ 㿘!  &!=@ *      "  2  2     "@ & &@#@!0?㿘1  2  @" @$ &  a@ܐ ?㿘  ,  !` @2  @*`  $ऑ* $ @[0, $@ @b@ 0 ` 4` `($``  4`$`$㿘 ` -    $+) ' ,`a     p   p 2t    @@$%㿐`@  @6` `   *  `'  * @4Ld|@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ppxX@@@@@@@@@@@@@@@@@@@@㿘 ے$ $ J@" ?   " @   (  ((( ( 0(2    0( :( ?   @    *  *** * + 3` ` 03 *   0*:* ?  !    㿘a$?N b!@k*    茔 Ւ"? "` ?㿘-)'+/$%@x ! @x⨀    b@   "`h?  @  ? %~ ۢ" 㿘" !ΰ? @^   & $ &`?  ,@j d&, ,`@b d&,`d   / &`l   (& `t   ,&  `|x  P 8  ` H&     ; @& 8&  :N` `2 `5`0"D., 4@., "5;`L4:., `K&7., N`(@  & X& @  &  &O& K  P@" a  b& 8 6: @&  &.&., &,K /`  `$` &  & & `P@`  a"@   b  `` & `& a : :K /2 +?& 㾈  % ` '-#4*` € ̀`$%İ  c8 ch c c, d, c%   d c !@K d ,.  :?, /,  2  1,,  d, d   c!P ,d  V`" @  b a:!   `dƖ < (  `l 3 ,  `t * @  `  !! `   !  R  ?       `0@C  a @3 X㿘 ?,  ?㿘 ?  ?㿘a$?N!Y N "?b!@h  2?  ] "? 㿘ݒ"  ?# `@e `$ & `& NaY    ,>aY /, `?  ,"@@a d&, ,`@X d&,`d   / & `| y  P 8  ` H&  @&  8&  ,.aHa)ے 6 (`t  & (.a(a m ``l  &``  ;@ 8`0& N``L#\*` €  @K     $  &&  & L /2} &y,N` 4 `  ` `  ` & & aI 埔  aQ嚔 ?c , *`  0P&N` 2   (@ & B& `   `$ & ` & 6& N` K  P@" a  b8 & :`P@`  a"@   b  &` `& ` a: : 㽘 % !`'`B````   , d, 5` @> `* !@0'    :, Q , /, ?","  d ?` F*`  € 54, ` 4 3, 0 ` I  ? @ `2 @Q     6, ` 1 2,,  d,徐 |   % `  0 7,! P @" a  b   ;@|    `b @` @`(l `  !   ?} "`@    D  k ,t 9  ! Ā  ' ?VȀ "Ȓa8@  Ē   D!   d  : @     21 ( ܒ  @  , 3  @|)!Y   V!  ϡ  ?       ax@  a @1 !`da ?J/2 J"`4 ` 㿘` @t :@&乒㿘!@  @y͒b!   $ b@yŐ   "`@wA @P!X` ba@0 ?㿘!  'H'L'P'T'X H@@x  㿘`   @N 2. ?@s 2* 㿘'P'L'T'X L "aD!` 5 %1!H  @w`|@ &!H!b0@y@@ 㿘'T'P'X P "aD!` 7 %1!H  @w`|@א &!H!b0@P☒@☀` @ib8@B☒@ 㿘@[\\\\\\@\\\\\l\\\\\\\\\\\\\\8\\\p,\T\\$\ ,<Lx,,0@,, 0@ %!  '//'  @2  '|'x"cb@ @~@є? b@}  ȶ `#%+ /'l; 't'p'h'`'d 3* @€c   #@S~"cc @ؐ t $'|$tt @$t@6  t!#H@h @  %`$tb@@Lz c@J t@c 2 ccP@  / , , ,t"$tc@$I "H =`bP ccp@ X `@  `@h c@w `)=`t $tt $t/ %@ " c@hx cH@W    #@Ro cc@G t f$ttc@u$t_t Z$tt V$tt R$tc? #  @RÚ E# cc@ t $tc   @R2'xcc@  t $tc   @R/cc@ t!$tc   @R#  #`c`@ @@?? $#* & @ @`Dbh"bܐb܅" "     HD" @##+#. & & & @I #cp@ 2 `(@ .  @ @qm!"#pt   `@@ Ā` "㬒` @' t`h@     Ē @ -Ē`@  @?ct ##b < 8 㰐 %㰔#"# +c *" "" @  t`p@ t @?c @ t ?c @ t@?c$@ t <  8 㰐 %$tt d $ d`x@  +  @Ș "<* @ *@@ x"bؠb, |4 4 4 t , , $ $  $ t &<  8 2 `@Ґ  ?   '/?//??? l @ ( 6@no @,ِ 㰀   @s  a@ 㰀   @c  a0@  㰀   @S   aP@  '!?##`@t ap@ @'?#`@1  '?a@ِ ! #a< 'aa@ΐ  a@  a?@4 !@   t@A' cp@   cp@ Œ"d@ a@ !@ @2t 2@b  4`*`@)  `h@~ #'t  @ ''@ 2 * +  & p  @ t ' h@~ `  d@`t@mb0t'@ h@ @ `t| t@@] @+ِ 㿘@a@<a@~ c#@ bܐ @r 0#|`   @z `"   Œbd@~u @q@4"㿘@. @Ր @("?c %!+ `Ȯ' --    5 c`!ڣ*5 "5 @ԑ4`: @Б4`   *@* %,!?# @ʫ#' ##' #`Ș#* #* #*  #* #*  *  **  Ģ @bct  5 "آ 5 @U5 c# @|  t@l"p?#cp@+=@@ t   `͐ @ ᴐ @ %@+w"x@7  -  @ #ta@'"@Y0&@ "@ |c   V"|  / / / / / / //?" "@ ''Вb@ ?? *`" * "* * :@B:@{  `   B;` ( 8    1   :1  "@ǐ: M@ <  x #|`?"x'#|@:  @   *@ - #t`e` `̐ @B v@'@"@"c` #@x  @z# #@ٔ `@Ԑ#   IJ  `@D @ Ē@# IJ @ 6%#` 2 @X @c`IJ`@  %`@  ޒ`#ta  *  @@a @@h@c t+'  "    `D " @j#  ?  %#`' %@` ?"`@* "@@     *   @ *   *  @=@I@6c?Բ`y?    @?ma@ `'a@| `'t  `'`@ #R%`'a$a@^$a@#ȴ %#'2 %@` ?"`@* "@@;     *   @ *   *  @֐?@?@ϐcմ?@Ȑ#?@Đ ? `@#  % ? 7 t  % b@`?"`"@ * $"@@ @p̐"@`  ` `? (?888* 2 ?cx %!?c' `/  % b@`?"``"@ * $"@@ @p"@ c@b ?#cp@(?#@b?#-@(?c @bc| 8@(@bycx  P@(@bk`:#| h@(*?'`&'B' !B` B()!B ?@(X??#c @b/?#`@b'#|f?#``#x  @vt  @vm @x@ @[d ?   #@vW  @w#  #@vK  #@wؒ #\ #@v=#` #@wʒ#d #@v1#h #@w#l@'@a?#@@@  % @($ 㿘     (   @u@B: 2   B* 2`@ : b`D 8 怢`  㿘 @zD   #| @{`?#| @'n`?㿐`ݓ*`" €@!0 `O"*` €@ ! 0@!@0@!`0@!0 `@!0@!0@!0@"0@"0@"(0@"@0~@ݐ"h0z@ِ"0v@Ր"0r@ѐ"0n@͐#0j@ɐ#(0fc#@@Ð#h0`  00@#x @# @#  @# @# @'@ 01@ 0M@ 0  P@ 0D@ x0@   @u 0@q 0   @h 0 !8@c@ 0@]!`0@Y!p0@U!0@Q!0@M!0  @H!0@C!㿐 @;" 2` 2`  @1"X 8 ?* 2` @("x  " @!# '@B@b @;' @b,  ! %# @b`"@`?"`"@ * $"@@G 㿐#t` ' @̰  @'!H!@&F!!@'!!@&9!!㿘 * `  * *`@ @"0`   * *`@ @"(N@ ĠȢ̂ЈԖؘܚ &HT `@ ` D `@ H 2H#l;p#\#`#d#h;x;#cH@Ȕ ?#" 8 @ @ `. @ ( #t`@F# @ #@>b`@&@7 02 2 0((  ``? 㿘 %c@"@%X 㿘@ D D D D D D D D D D D D D D   $ 8㿘` @] /%#)!+-1 %'5 $-9 8" *  @€ $!$cА %#$# $cА %cԐ %$#"@@B   $#   %"@`0@$ @(?А?̑* `@#Ȁ cЀ  cԀ  # @0@d@kא"@ `X@' @$#㿘 %``! "+)'% `h @ha耢   p@E/ x@T$   %@ @k 2㿘   % %$` #Ԁ`` 2  #Ѐ`#̀`` @`@  `@2 ` ` #Ȁ`@` $?"``@ $* $@@i $Ȓ@`+#`@` ^?"``@ ^* $@@J ^@` I?"`` I@ I*#`k`/@` M?"``@ M* $@@  M@` -?"``@ -* $@@  -"j ` &`T `  `  `/@` ^?"``@ ^* $@@ ^E` ?`@@`? "`` *:   @ * @`? "`` ,`:   @ `* $@@"  ? & @j  &  @ #@, x  " 6 @ `@`X@ϐ 㿘 %!R `` "+)' `h @g7   @y  x@$ T` %@T` @Y 2( %RbN !`)+@ `X@ d*$ @#%c %!`@x %!@@ ?2X@j @!@@c? 2  #@戀 x "c㿘@1)** *********)*******************)*****)*****)㿘      @ @" `@?J@ -D  J@ * ?* : `,ʐ *`         "b "cܨ  @ @`J 2   ? `@Ӑ @#@f3  (?@c@U #@f'  (?@c@I  `#,!$# " @f.@ 2$$#Ȱ?`#  "!*1  " @ @K@"? ` @#0#@ڔ@"1  $ @z  @@"% !'! @eԔ  2! @ @" #?" p " t@@eޒcȀ  @@ ?`@"  @@e̒a@ @! ` @!  `"@e@ 2  2 #Ā " $   2@c@ `4  2   "1? ?@` c@ € ?`@` ``2 c@ €?`€@  "?` @  !   !  @u ! @e1 #@sr  @ 1#Ѐ  ` @  !  c@e # @sR `0@ @!O 㿘! !?@R#̒ @1 € "c̐?$!$!㿘 !#c̀ %0`@@| @s" 6V @`c az@s c@"@s  6V @ H"?"c0a@r 6 @휐 X"!"!c0a~@r 6 " l" l h) %!'' Ȑ@ # a@nU?a`@  @Ɛ 㿘N 0    %#8* R  x" 2{ zN" & T@  D "  & T@  D  @m   8@~ Xa 8 `  & T    Д `  %#8* R ?  `* & T    Д `  %#8* R ?+ N \2 `" N @_n 2 ,  N` `@__  $@ 6&"@{ &㿘 `   0   %#8* R  x#0 & T@   2 ` ` & TJ   2 ` 2 p x@0@   @   &`# %a ''ĐȒ Ā !/’c @^! #̠! 0$ a@m) a@ɐ a @ x# %a`''7@  @a@z ’c @^# a@l?a@畐 a @f ؁% %'@6H 8x@6D @ '̀'b' @8> '̐!'Ȳ .`А?``"@ N @8D  2NȰ !'N  & T    ( N  :$ *: ?'̰   'taNt /t.`" " `` N @!'t 4t t''’c @^'# a@lg?@!( @ؐ!8x# %a`'?#@5?c@ !H@a’c @]# 7a@l4?a@Ԑ!`a @!xx% %'’c @]Ԑ#c0a@l?c@洐! 'a@l?@槐! @x!p% %'’c'Ԕ @]#c0a@k?@憐!   #@>WԀ'a@ c a@kɔ?@i! @:!Ё; %a5'   @y$'$  @]b%0@ka  8@y @]R0a@kx  @y @]C#0̔@ka`  @x @]40@kuaH  @x @]%0@kfa0  @xՐ @]̒a@kX  ` ` Ra/ %!@ @ `Ȁ 4 @@!ɀ` p` ?#@ @" 'hP7lXh@l{  HX`\'`@s7d@ѐ@4z |@*  @\0a@k ,``(` "!''bb$"7ƅB' B'@@䘐" `@䔐"(`   "0@~@ , p , $    $@ #0a@j?"8@~y@d   `  , @ "  "  & T@     :"    @6   @7"H  %@` ,?"``@* "@@t ,,  ` % @~!b@    ـ   @"P@ WD""@"p#0a@j/  % R  @`?"``@ * "@@'   @Yb %@`?"`@ * "@@ #܀ a@ a @r"?cP#- % `'%?#(  %?@3E )’# @[' a@iϔ  @Z L`@ぐ"G`@3) Р@3$>>'#' @[l0a@i @N",`  @]"  ` @T#?#А@& %@` ?"`@* "@@  `|`#~? @#㿐 x %  4 @#(  %@`?"``@ * "@@\  >@#0 x  @ @#@  S@ @#P S`" R''``$"7ƅB' B'@@ѐ#` d R@̐#h d @Ɛ#p B  B `2`@⼐# %@`?"``@ * "@@  ^?# @`6 ^@)c %@`?"``@ * "@@ߐ  x    v* * 2 @ ch# %#a '" Ȓ  (@v(’c @Zh#0 a6@h  @3 ` @ """ a’`0@r  @ H㿘# ##bb * !$b’c @Z+! b! #0$ a5@hh ``@ 㿘#  `p@8  `@2 %`@,  `4`@,`$㿘z# )`@ "?c 2  @a @ ,  %"㿘T#  a8@ "ah@ "@ "c㿘:#  a@Ԑ "a@ΐ "@ "b㿐 '#  a@ 'b(@ ?# @ ` `    @:CbP@ *` $ h 2```2@  @2  22 㿘#@N? ΐ`@^ 㿘 !Ē@;? `Ж@K 㿘@9ѐ  a8@ ",@2 ?`@, # @ @la @qe㿘  `@2   @2 2   2?㿘` i@Ր!"! "m#@ǐa !`@` 2` @ `!(@୒ 0",` 2*`?# @ # 2!` !8!@"@ a!"`@ @?# @ `` 2@6 `@r!Pp) %!'"// "@t’c @XZ#0aK@f : @ #\! @r a`@X;! !h @y#\! @r{ a`@X!!p@! @֐!) %!''’@ "#"@!`@# l`@# # %b@`?"`b@ * $b@@9 ``  `  2  ` @s@@ѐ#0  @s @WĐh%'0a@f  @s @ߵ#@@R30 Ȓ  (@se @W̒a6@e 耢 #X@[뀦 @oՑ*  cp@* a6@e'쀢 6cx@ @߄#ؒ  ؀@;b@`?"``b@ * $b@@ b@`?"``b@ (* $b@@ ( w b@`?"``b@ )* $b@@ )% %@`?"`@ * $@@  Q@-#! 5 &! @2!!,`  2 !#"  @ ` `  @ ` آ`!,`  @@#@`?"`@ * $@@3 i" '  @   2耤2@Ȑ# @Đ#  @޽ `@ ` `@o #Ȁ  @ 0#,` #, *!1 @  $ 2 ( ! @O#Ёx1 %! '#c̀  %@Q +!`@@ +’c @Vn )¦!0 @qƐ '@x@bؒc @VZ c0a%@d 6 @& 1@6# @r /"#/؀ )!0 @qc0a"@dz? c@ 12 @q c@#c @V !0 @xD'ܒ@ #@ ؀ 0# a0 @qg#0a#@dH? @ 1 @q @ݐ ! c@U a0    %'@x ܒ@ 0 %@`?"`@ * "@@' ! @ @㿘# €   "a ?? * " * h+ %a'' ̀   @t +&a`@@3 ސ  #\! @oޚ b@U! P@݂#؀ @В ! @q0’c @Up @pʐ0Ha"@c @7 1"@F ` @q  / / #\! @o b@U?! x@?В ! @p1’# @U1@p 0Ha%@cn   @ 1 @    @}@  ! @p̐# @U  @pg0HaI@cI  @ 1#@  @  @  @  @  @ݐ! !@ג ! V ! @p# @Tǐ @p"0HaQ@c 6 `@؏ 1">@ݞ! 9  "2@F @ܧ!8` &@"!H@ܙ!@ܔ!P@ܑ!X@ &@"!H@܃!@~!P@{ a @4!h㿘"㿐 ".` ` , ,  @,n @Ð @@o 0@H  #@`  @i9$ cД@b 㿐 ".`   '  @4 ax@J  `, ,     @o̔ 0$  * "@  * *㿘  N 2 , .`!@2, !@2q %@`?"``@ <* I"@@) <FN, 2 : :  %@` ,?"``@* "@@  ,* : $  %"@`:?"`` "@* #"@@ * :  %NN 4N` %@`?"``@ >* "@@͐ >㿘`U O`. 2 : D  %@` ,?"``@* "@@ ,@* :` . :`  %#8* R  %"@`? "`` *:  "@* #"@@ `@* :` ݕ:`N@N@ 4`N@``p ".`ؒ  @n̐  ''aH@Ԁ  @ba@& ` "`cД@ @nO `? ?  `  ` `&`6` @*ԁ㿐 ".`  '   @3 ax@  `, , ``2   @np 0 @nk ` ` ,` ` "@ * ,      " 2 "   2   :2" 8톀2  &  㿘 %a@n<"@h) %!'  $@n’c @RQ'%0 @`?@ A!@ ;!b@Ր  @c4` 'b@ː ̒@`p?b@   `b @R6  2@"(!8@ 쀤`@ ! @"8㿘!#h@a!㿘@ !@"p0’c @Q! !   , ,  @ # a@` @ڸ"㿘@㿘 D@Qے`D㿘 D@QՐ`D㿘`@ @ (`( 4   ? ,`,  ?㿘`@ @ (`( 4?    ,`, ? 㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ 0`0 4   ? 4`4  ?|㿘`@ @ 0`0 4?    4`4 ? i㿘`@ @88@4 2  @<<@( @ `@88@4? <<@?>㿘`@ @88@4?2  @<<@( @?`@88@4  <<@ 8$4H` p<l 㿈@V'   @kߐ" @(+ "c`h @^  ` "# "`"Ð "`@)À  Ð "`%+' !5 $-7À`Gߐ#ܓ*` € % " ""$Ò "" "В $"" "# o% Ò "" "f% Ò "" "% \$Ԑ "`"$T% Ò " N"Ò " H"Ð D"`Ģ A`Ð ="`` Ð 8"`Ò " 2"Ð ."`Ð *"`Ð &"`Ð$"`! Ð "`Ð "`Ð "` %` $ Ð  "`Ð "` $ @e@)"?h?ԑ*@`&  ̀` ` Ā`  ` "`Ԁ   ` Ā`"`Ԁ  ` !Ò @tڐ &!: $ ` % "  @  = 7 D5#H `.! `"&"P$ "      ," ` !$ `!ߐ \"`t # Ѐ`"@Ԁ   T `  P %p@  c@ ഁ㿘 `"ܔ @   @ @@q  `j ` `  @ /-+L) 8`D  "N`D0B3 "2N`D0= . 5V`8  `3x `@ֽ $`@ֶb&x@@- @ 0@a"0N`D"``D`@D`@S%@? 2`:@^`c@  %!'H'D' U  ̀` '` Ԁ`  `H '`H'x'|' ''t'p'l'h  'd'\: D@DD@" $ Ò " 2 LD2( `2($ .2 ( `2( $ | 8'|` @@D (D 8' x 8'x84 8<8 Ԙ `z' ` #\@ [ @ U# \@Ғ @ @ih4'h@il 4'l`Ȁ  @rQLN #@ip@ 4'p   `  @e  `  @F   @M$@ @  $` @M<  Ș 'tȀ ` @  $`@MN`-"$@e$d 'd2(:d`S|'`'H 7't''! # @ ѐ@i3'l p''# @ Ő@i''x#  @ @i` '( @ @i' 'h' p@ Ð  "`xH  %@e % @ ސ#0㿘 :"0 @`: )   "  ?="R 8  `2 À  ? t@€㿘P㿘  "  @  %@` ?"`@* "@@   2 p %!'R8  Ԁ` ` ` @t"@Ԡ#8)' % 6􀥀@` ? "`@* $@@\   􀥀   %"@ `?`$``@ @* $@@= 2 @`?"`@ * $@@' 㿘 ̀`    `  Ā`2 `M% %` E >@` ,?"``@* $@@ , `( c @` ?"`@* $@@ݐ  ` ?"``@* $@@ʐ   P ``2` @`?"`@ * $@@ 㿘<@ %@ I0?(@ 0@+ I07@`?"``@ /@9 /@`?"``3 |@, | %@`?"``% @@ @ %@`?"`` =@ = %@`?"`` *@ ** "@@Q  㷐 %V 8!'2   D@U$   D@K$@fٔ#@̦@? %"c@da. @Ɛ#@(a @}#؁㿐 `@@?#@Ч0#P@Р㿘N 1% &#Ñ*`: ?T  J   2N`  ?N %"@`?"`` "@* #"@@  N  㿘   %c@d6"@ 㿘@K\$$$X㿈@  @cؐJ?`d   "#(  0- ) # ' !+ $`<!*` € %# $c $c  %  $  "c @@4?ܒ?c#*`@&  c@ېc   "c 㨐@+ /   @)  #`` * @)ǐ?㨀   @T  @Q @7 @M 8@0  @F `  @ @ 6   `@@ ?7'@'耢 " # `@@  `@ @ !#@f " `@  @`@ @ @  ' `@t@~ =##l` `, "@`L 2@`6 #* $, @m, ?@mZ  @`@@=G @;a0 @>@єā 㿘@6  a 0@ O?@h`  a `@ 0 @_ X   a @ @_54? X@b{  $ @@V "   $ @e$ ( (`$  <$ @  $ ,2 $ ,@Ccl 2$"cl @_?@_㿘#l   @^ T @^@^`$ll`"  `2@ `2` 㿘@    a @   @^& P    a@ ?*@& T*`*`*`*`*`*`*` `@c  㿈 @ c l c'쀦 ' @@ D@ f @4d @ #`  ,b 8 @M  ,`Q"*` €@H    D& ,2 @& ,>& , @ & b ` @&  & ,  ` $ 8"@`& $ & $& , ` #`@0 & , 0@0b @ & 0& ,@_ @耢   D쀢@&'  6' D' 2 @ 쀢  b @ѐ 4 @ @ À@ Ò "`" #@ " `"` # А"@# &  #`    b @  㿐 8@   ,4"* € 4  && 4 <& 8& 4-  #`  ##& 8 & <@b!@"@@l"@& 8"@@ϐ& <  0   & 8  bؔ @Z 08c 8c <@& @& Dbؔ @E 0#@  8Дb? <& @ & D?/a & @& D #`  <b 80 @" 㿘 ! %@`J?`d ! %cP@`""@`cx0 c@`""@`c@ 㻐 # %a'P 'T'X'P # 4a! % @轐""@`c a$@@&a @W#㿐! #?' ? $#c㸓*`@\ #??$#㸀 "$@\$$@# z  P) `F`2E`2B @"> `29   㸓.  @Dj  2  `2(  #`$@#㸒`@\ʓ*` 2 `@ΐ @$$ 㸓*`" `@  $ 2 `"`@\*` `@ $㸑* "@ c   !.   @ @$㸁p c܀   @\. @ $c`0@ c  @\ @  $`0h ? "c c*c *  " " " " " " ! @  `0  ~?  @ :1Ā &#p@ǁ?@9`0 0i'Ԓ ) @a  6#p@l@9 `0̔@֐ 'Ԓ ) @as  6 @V@9 `0@  ??`@??'#p : @aU ?"!Ð $"cc#p ĖĐ @" @""%#`"" # """ "" " @?@9`0x p  Đ"b'#b#'' % a '' ''' T "  P" ` 8   $ )## # #  """   "  ?  @      # # ##   ,% (cp @i  P@" 0@Ʊ`2 #`$ 0@Ʀ@9@  0 & 0 @!XP %!'!Đ"@C     @~@8ahFx"`  `)%  )   )`$ )` ) ` ``"` ? @   `2 h h !h !" @ Ĕ .c$@d `@^+h   .c$@dw `@^h n c! Ĕ .c$@d` `@^hHW L!`1#$? ? #$  .@dC `@]hx`  .#$@d1 `@]Ԓh) !#$ .@d   ,h   L , ` $ L``!$ ,s$ 0! @#p 8 p %!' @#c80a@O @~?@7c(ސ J2!7c8 a@Oٔ <?@d@7c@. X #@R  #x   #   #    # ? @#؁H %!  Т '???? @C)#80a@O{ 6@@7tc,  A A29  ( 4????? @#80 a6@OV @`"& (@@7Ic  9?a` Đ  `   a @ @ G  㿘 .@ G.` ` .` * * * *  * `Xh@ H   ?''''   @^ F @X A  @^ 6@@%  2  T@`" ` 2 @\P 2 @2 *  @X @[ @@XА0@X͐ 㿀   )'''''  @^[ ?㿀   )'''''H' H@^D  ?h %!'  @_ @@6c `U@_ @S̀ @@6Q `C@M `K)+@[`@[ː2=@`@[Ő@2  23@`  2.@ ? ? 2'@ ! @[ @ސ @@[10HaI@N  @Þ@6   `@  @ n@f `@ e@f ? @n  : `" @ ``@ "` 㿘 c䀢  @Wǐ @  &#` 6?  @ ;Ā`"#h@F?@5` 0  @  #Đ#<X   @" " " " "   @&?@5`  8 %!  '` @u  @ @5ya0k Ua !(@Za@ @?!0JaJ@Mb @@5[a0HM 04`( 1  /-"" 2  @ 2`@ ` `@  .@a*  0(h `@@ `  ؀@e0a @!0' %`ᴢ<'  `  ? ? ?  `" @ & & @ " #@ %N * 2@  * @ @B ? 42?@(?d2d d@ d 2d ?@+ ? 2 :$"(@+ bs?:$ !? ! `  ?*#!  N !$" @) ?倣  N"8@+q = N! d;  B;d   & S!쀢 ;d0  @0a'"H@+@B  S" 2+?N@, `"` @ "@@& &@" #@  "`   "` & &  " # $( @[%N  㿘?  !?"P@+  "!N! `?( " ! !  2 㿘@ W? 4^ @ 8Y  c @ F%N*2  $ 1: $$@) %d45 d8/  d@?S" d2 d@  8  +  c @ F+ 3` @* @ ( 㿘1N!d @d!:0@D?  "  @L?S 㿘 q N$ !2 N@4  2 @( !2N! "(: S쀠?N0?N$ ( 0 $(( @B 㿘!N! @$@ ( ?!?(#@`"( "(`B : 㿘1N!d( ? "d(d 4!21?d$  !d  !d ̐B? ! ? B?"(: N! @$@ (@     ?  8   㿘N! 2??0:0  !N??:!2?!N!@$! ;$0$0 $4;$ ;$@#$($ ?? ?#$ ;$0! $ @)R ?"h@)k 㿘` @4U  N!?d? "d;`#@``#`` "`"`#`#` `" "`   N*   ?㿘!N!@ a` @"`@@;/"a@2`!"$㿘  @( ?  㿘# `@j!N $$!$8@3   ???:$ "$:$0"$ $!" ""$:$"$(` `Ӑ `!d ?"d `@G!N!d?""d:㿘!N!$  ! !d 2   2!@Hd!?"d` @:!  $!@ N  ?  &TH  ? &T " ? &T   㿘  & T   N!x N!@u 1NN@ & T@    N !@^ 1N!@W 1N!F0F@DDEdE E\F`EFFPFpFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFE\NNNNO"#("c""㿘NN"#"c㿘@&@=8N!N@"@=1#@$#㿘N@=(!㿘%N@&@=c@$c$%NJ "#N@= cSؒ@@ @㿘!N#N#c@ N#c? $#N#N!@N"#㿘)S'N+N!%N" 2  c:  @ J L@<ʠ @!ؒ"@2`@:`@ L $Nc%c㿘)S'N+N!%N" 2  c:  @@ N?L@<@!ؒ"@2`@:`@ N8?N!$Nc%c^㿘%NJ , #N@- [O "` 㿘O` "`@C  z  㿘NH  6.@.@H@(0?д(`? H@F26N!MNNNNMNNNNMNNNNNNNNNNNNNNNNNNNNXNtNNNNNNNNNNN8PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNPPPPPHNPPPPPPPPPHPPPPPPNPPPPPPPPPPPPPPPPPPPPPPPPOY\Xh[^WPbecb\TXW[t^@]P\c\`H`\etaP^\bc]YZ<^cWpX,ccca`8Zdd^^_d_bee[]bLcceeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeU㿘@*>@#㿘Os" lz7Ol @ 㿘!O p O  W"`l p @Z" p!T" p N" p H" p"B" p ";"7"" 㿘O ? @##O /"`l `#``   #  #  ɒ 㿘}}O`l`*:#*` O |@0.L@ +"` "`!  Ѐ "L@@5L@ $ $ O !OL @ , O | L`L@0O | L@L`㿐!O l`/!(*` ?Ѐ @֒  d} O:xo$ l #OL`  S SO` ! ? +   @S S " Y"`k  !MS!IL` G !O ? ,`@ɐ   @c(K @ɐ  -/// / ٖ : d  ?`;  8*`   ! " @O`p  "`p0  o  l  ?݀   3  㿘@$ Sa? a?a  @d 0a@`0 S! !S"0 @$"0$"0㿘 !`O @G@#1?SO:S" SS!   @ Ԁ S S""#O` @' @!` :$`@!qS"X `  @7Saؐ ( @!_#0$`㿐 b'#`@"n㿘 `O @"J" @# O l   g   0 @-㿘! ! !O $!!O l@ #h@"2 q !* $!㿘@7? Lݠ?:L㿘@!O p!! @g @j  p@Ɛ0+  >$ p@  @  ` !O p@+ p `$ p`瀊``#@!ޒ @㿀S!O 2  :  S"p"x eO" l#SbO  O:x  *@,S! ?Ib O eb;b 2O e- e!O l "/ "O  l "/ O O)/@'쀢`H ??`c!*` c   bO`x `x !O  x`x S""h!O x   x` @: < xS"T O@  x  @ ; dOO`x `x !O  x`x S""h!O x   x` @: < x x  @ g <O!O x   x `   < xS"T O x  x O` (OO@ O |!O x   x `   < xy x !O x   x `   < xgS"T O x  x O` (OO@R O |l !O x   x `   < xB x q !O x   x` @ : < x,S"T 2 xO@!  x ; !S@Ab S$!쀢  "  @ u b  S" $!쀊 " 2OO`x `x  `x S"!xS"T 2SO@  S!x @ I rOO`x `x  `x S"!xS!x @  ZOl x@#@&@=IO!O x   x `   < x@  x6OOx   :xx x ` d  d:xO@ |OO`x  `x @  O@ `xOuOx S  :xx@(Of@$'#^>O쀢 J OOxO x "`p     :x\OxO x "`p     :xJl!O x  x `O`p!O x  x "`p    < x-  x G O%Op p ?  ? #O`x`x"%Op p ?  ? "@p#O`x `x$p`     <`x`x  `$p@%^]OS"@ a@#@  MO!O x   x ` 8 x  < x x@  9OS"   xS! `5  x` x2   (#Ȓ#('&#!O x   x `   < x x@p` O x  ` ##('#@OOx  x ` 8x  :xx@O  "Od#  @  @ @_O@ uOO O" "0OO" "`0c  / 0`  (  Sa OS!O  @O`    Sa OS!O  @|O#@? vO`   0Ox x S` Sx S""t"t S!ؓ2  :  ::xSO x: @  x O` (O :; xO |SS %" Ox x S` Sx S""t"t S!ؓ2  :  ::xO |SS  "#!O l / `0  =0#S"X  8O"`vO㿘:L ` , L   @3$ L@ XL@,`L@  @L  ,,  L  L  *L㿘 ! @ ! "@* Ɓ㿘  @(Z  @&$ $$  ?㿘 #  `@M 㿘 #֔  @? 㿘ɔ  @2 "@ >J@H  @3` @ "` g .`"+ ? & +`J`g+` f`J@`J@J@"`J@?`J@2`?`@ Ɔ d㿘 d  f   d f" d㿘 #㿘 #㿐 #ؔ @1 'N   #ǔ  pS!) %!'@ S7 !@ 1  +, ,԰ ` ` 6 d` d Ԁ!?3L ?! !C! @ 㿘@ @1Ȣi@1&@@  0&  & @   @  ?@   J!N@ "    J!N@@`  ".@ `@ Հ㿘`@1@ @*N@  N@ "`@ `@ J"?8J?   ?J?8?㿈# `Ԁ "@*耢?`쀢?`@!@! # "  @`O`@#@-#$# " ԁ㿘   @0 @㿈+ `Ԁ" @a`Ԁ   @^ @ܐ'@ @ V `@5  # L'@ΐ '!@q@-w耤@Z@-o@I@-k@-i@)q @&  '@'!@P@-VS"P  @ @ !'@耢 y Y@;"Ā@-6 " @ O"#"`@v%``S@maS "a   Ѐ !  ܀@`?S!t $ @@ @!" S" !'@@, 㿈@  @ |     @ Ԧ @,ΐ ! @~  @ Ԁ @{@m 㿘 " @2 㿘 " @: 㿘 S"  @@퀤 А 耤  㿘ݔ 㿘  ԒՔ 㿘Δ?㿘  ԒƔ?㿘 @R "  @㿘1  Ԁ " @  ԁ㿘 @?㿘@-@8}    ` Z 㿘 @F# " !8@  K J 㿘0@?@㿘@/a   J!N " N`6 J!@2N  2/,  ,N`&  J!@2N  " ,@@/3N ",`@ " ,N  ,㿘!h !x㿘1 # 2 #Ӑ! &#!&##㿘. @> @ 㿘٠@.L    *`J!:`@ J!@ L 2  L   `/ @.Ő U    J!Ja@ON*`:  @"@ђ ,N  ,㿘 - L@ )@.@. @$    !@@$ @+  @8@+㿘/!˒  㿘L@) *`: `#`%2 @(L`L "L`L@ `%`#2     Ԁ "@ `@.2`L@  @漒 L@1*: `#`%2',@(L`L " ,L`L@  @`%`#2     Ԁ ",@٢`?" @'@- `L@  @,P% %'a !  @T ?   @x @   @    @ή!ȁ㿘  @( ??? 㿘 d9  d@ ,,-@@*/@-, ? $@S  $` ܒ$,㿘@!ؤ )L &x  @-f@-c  @@@)a@@)0@ahS! KאȬ( @KȤ  ؑ,7@ "@-% @)Ȥؐ宒 Ȥ ؑ,@ "@- @- %@͟@)Ȥ@,@O8*@)@)㿐S"< Y S! 2h Z?" L/@" "Z L |  @,ϐ@,̐\   2 L %2 J  s2 @/@, ,@, 倥`.@)=  V @=  @ې O&&@ ߐ@̐L@  㿘S! K"@<" A@,k @,h@,e " 4 L %2 @J  s2   @Ő@@,B`.`@,;@ ݀ @(ϐ @v(ǐ@Ғ   <  `?@((  @,  䞐@2 cȔ@|0$@ S@L"P <  @+ * z@ cؔ@X@(w(@F  6 "(㿘S"  㿘S!쀢 S" @??  S@ Sa "a㿘Sa @U"a㿘    S!?4 S"4  S!? 2?3Sb0S` "!S!?@ @ @b0   `@Y? @ @ "d?@ @ib0  CS?  2N?@"0I? @  @   S! @ߒ SS@<.   ?S"0S"0  S  䀢 SS "aS"0 Q@S!̀ S" "?D? ` Ţ @Β?  @Ր ? S!쀢 S"!􀤠 S" Sa "a  " @d " @ %?㿘@   S!?S S"!@Β`@G? @? `@#@ ?㿘S" S!  w  E$ 0A@X??5 3` S! @ )S!쀢 @   @9     @1??  SSa  "a| 㿘@ ?  `@ ?@1U  S  S0S #?㿘"@@j     " 2 㿘`2@  @ && @" `&@&  `@ "`@㿘? " " `@?"`@㿘 0- & ??> . & & Ȑ㿘 @ !  Ԁ@'$ ΐ@& @& 2    2     㿘 2ސ   @㿘#  `@  2`2  㿘  "   @: `: ( :@ (:` * J   "   " 㿘?S-"H   P*  :S@ F?  @F茒 @@聒P? @?`? 0#S- 4B? @ S"\ S" , ?S "B? #Sb ǀ ?  @?S"  0b   ? 㿘 S`"H   P*` :  @ @ f   @?F? xS" '-S  -S0S" a  ?0U`B -S K ?2-S 紒 9 @-@>稒0%kB? @ S"\ SS" S!""@ ۤD@R? @? ?D  @y㿘?" b 0`F +?   : !`F ?   : 㿘 "X@* 0 ?   S!  @0S!  @㿐@r?    S"T S"@0`8?  S@n"x@ޒ 0?"@ْ㿈@@@[㿘?  "@ 9?  "@ 0@   2@ 8SD?S" @ 㿘榒 S ? h[ S"T #@㿘@ݐ@t &@ߐ?     8 wS@Ґ     ! kS] #@F 0@  @??   W @8R(S@8!"?   0S ? ܀@ BSSSS!"a""%? И 054@  S"T $@ 0 %S? =? ߀@ S"!@{?  㿘#(O "`J 2 #@"`В ޭ$ "`H ި$  $"L"P㿘% P' * H@"Ò )    L@"  PP@" $H @S   $@%Ґ@P $@%͐% L$H$P S OOOOOO " "`*#  # O x# %!Sa ",'  @  S" 5  HO   *```?   `  耢@ 2       L  *  L *@OOଐ `""", 5Oؐ@2 @%x $  !O   HH`P "@ @   O   `L*@OOO @`"# #`OO`@a  HOਔ + `L* `` #` "a @#P㿘L   N  `@  "NN `4N&J 2 J `JJ"  㿘%O#O`" 4!O " 4 !   Hѐ   H  @4"  O`  H@ @  * `L@ @  *  " `OS"@ !""$#!  S    0   0  SSSЁ  S    0   0  SSS㿘 !  "* %?l   !O `    L@J?` ` `  L@J?㿘O  `H?L"J@!OK "@$ 㿘O ?,   HJ   @  2 ?  㿘O.  @9:`@ 㿘` " ܒ`B @W O`  "`5Sd   {d  ZO`S@ؒ@@ 4Y   P5O?@ ` J ``  H@J? 27 L@J?    LO *??"`  L@J?   2 `2   O` ?"`  HO  *@ OL *@ଐ"ଁ㿘O S  Oaย   $@ ?T* @@?? *` T  ؐ$@@7$ *@@  T* @& `T* @" > 2  O` `"` 㿘%OL  O`@2`Ȁ ",+   S"x O,:  @SS!@S!O2  : @   HO`*!"@㿘 S"x      0QS  O O3O` +  ?`(&` % !O  # `H. J?:`@ `H J@  Y  $  a&` -  ` (  $ !O # `H. J?:`@ TR`H J@  +  $ O 2"` ,#O`(  O "   !  H. J?:`@ $ H`J@R  ` $`O "` !O `    L@J?  ِ ~  !O .  H: J@  _   ܀`j _  _ /`_  `     L"@ @  *  H" J@   !O H J  0 "   O    O   O "` i  ̐ $S [  Y  c$  S"x \ F 2X S㪐 8S"d A  ">㩐 a@!O`S@@ؒ@@42 N -*`: l O `"  N       M O` "` 㿘OJ  O !SO`A`!SS"!@6OG" O Sa؀S!䀢  S!  S"d O  HO + `L*@ "O  H S*@`L*   O  H **@`L *@ 2$!O "@S$`h H L H"@HO S "!㿘??y  ?E?  ?&? H;*  ? '  P?   B? `H*`H&㿘 42 ?` 7O&" ظ  > && > Oؔ @b:㿘O `؀2 O`؀ O 4  8 O  @"P#@"#@:`:`"@"`$  $@P@ #Oؔؠ@    4 2   8  @ 2 P#@ " "㿘#p@    "`㿘!P#D   d$#D@$#DPcH` ?$#D㿘S", ?   O2 ``ذ  `ؐ`؀ 4 @8 @O`P "H b@ f4; 9 2M P"#D S= ?"9 D@ " 47@50D 2 P"#D S ?  SD@8 " ߒ㿘  O2 ``ذ ~ `ؐ`؀ 4@8OOf ؀" b@ f4- +s 2=?B@@ S) 2`#`D (@%K 2? S 2??D?@U㿘@ ֢ ? ? ? 3S@ v?   ?a& ?@B? 㿘N -  ۽@#@@# @uI @ @ ] @( #@= 6@ Q# ) L@ &N ֑ @@  ֎.@@ N 2#i@9@z@(` @ @(\@3  ` @G@D#@H@) @ڕS "a@   4P#h  ??:㿘? . 1N* "P? #@0  . 1O* #㿘 '"1R . $0,! ^)P  ԰P  > & 1"P݇ ' S P#P> & ##P!P#P@ A   $#P H  ?  ? @  㿘`?㿈  @  > &> 㿈@ 耢? 쀢?   P#h"$:$:$㿈 (R H2?2 ?2   S"# H  :" ??Ԁ@"ِ 㿘[      0@r ??  4Ph  ?? ;`xhX㿐 `P'@  2`  X@  0 "`ߐ㿘    " ՐҐ 㿐 6S  "@098@?Ñ* : `:/#h*` S"`S"`S"` "l ` "p` "t`S"@Դ &"DS"*` ' @㿘    S0S"(㿘   @㿘   d "@m  @j"@g @d @a!@^!8@[!pԶ ' %ᴀ 'C  0ᴰ  p@А  *`, @@*`ВБ:  @  T@. $@ QN@ ,`  T?* @?*`@   " "`I"Ԓa0@ % Ԁ .0  a0@ 0@@~ T.   "@@԰ 瀦 0@l@i "@@Ƞ0@`@] ؒ "@@'( @( @9!㿈 +   "N@00/N@ @  *!&*aN`   N` !@ 0 *!N` ` *! *!  ! a//'"/@㿘S"@    "(@ 0 յ@  "` Sh4SʬDDDDDDDDDDDDDDDDDDDDDDʬDDDʬDDDDDDDȘDD4444444444㿈 'D+R`h"J@   2%`h€ %`h@JD@ `h`"@%`h%`h  DJ ?`03'D1#*` DJ@ +`? `}'D  D"`@| +@ 'DJ@ + ` ' d"`Ð aDD z?'D @]? @ @< 2 '"'@Ғ '  "    5( D/ )%`? !@ J  D 'DJ  D@U 'DDJ uD@ "@€ DJ lD㿈@'H@ @'" ` @@' "2``!" `@ސ'"@\0ɐ `   HJ " `@  "{``  "&   o`L Ci`"_`"```" ` \` `?V"``?Q"@"H`?I`?E` ` & T      & T    ` @f`)"@4(`$#"` ``H@Δ쀢 2 `` "` "@#8@̒ 09`  €H `  @  `  "`  `` * @'@`` S "a` @  ` 㿘1R ``@  `㿘@א    S@ 㿘@ː  ` 2`Rh@ 㿐'#h@U㿘R hJ㿘L@ 2&@с &@+*`: `$ "$ @Ð 2 N $". -  & &.   &@@G@*N 㿐 L -2    ?А  &%?`'#@/  А  * .  @*`: В@ Ѐ$&`2 㿘 J `, S! " L d2 SbXؐ $ $ $ $ $ $ $ $  `"  "@ "  €  $L S HJ@   `  %<*`P  $J2J ? ?* 8-`? 㿘@ @yS!쀢    b$ "b$""$ "$  Д  @? "?㿐@&㿘@@@@  2@3㿘6`.  .`@B2`* @ *`B2*@* @X d  @ d  d@I @C 㿘 ( >@ɒ @.2 @2  @# d @ d @ 㿐S" S v"a M >    0           Կ  Ԝ  `@D 2    S"" S""Ԛ Sԭ SSwS""㿘% (R p@  ܀    @FS "a$(㿘Sb "b! "(S o@ "("(* $"(㿘N*` : N x% % ' & ``/ @֖ `0?, @;  ` -?,@ @= x% % ' & ``/ @ `0?, @  ` -?,@M @ !㿀% %6 '`2 /@ؒ  0?,@  ` -?,@$ @!㿀# %a'Д [@a @ɐ!x# %a' B@Ȑa @!(㿘N2 *`:  % (`N n   s dN2N@L`  *`:  L`   N@@@@`N 㿘@ p q P   ?㿘S"# `ܒ`""  S!t  S!В`܀`S!t   0"0 S!bS!؀S "a㿘ұr "HnS "b㿘!  ܀ S!t ҔW@  ܀ S!t f 0 $S!ؐ S "a@?S??  h S S2 8 h* 㿘7Sᨴ  h.8ᨴ  h(8S   h* @: h8Sᨔ   h*??@;ᨔ 㿈#S%Sap@"! "h ?@d@"ha??a a$"h$p耢?쀢?"h*  :? bh4!?S 8?! 6?bh*42 ! !bh?㿘S! @ 4  h* 2      Sᨔ ? h*@@" @ ᨔ ??: S $ S6?L$LLLLLLL$LLLLLLLLLLLLLLLLLLLLLLLLTlLxLLLLLL4HXP㿘˵!8!S$""˯!p$ ˫!$ ˧"( "blˢ" "bp"˜! $"t㿘@#SSa@!@@ "  @B6a@@$a@*@㿐//x# %a'p ؐa @Ґ"x# %a' a @"㿀# %a' a @#㿘#㿘? ? ? #S?   ?a& ? 㿘?. > `6p8"*` S!@S x e@ Ð?P LSW"SX! 9 @cMSM",S", H Ұ?2C /  $< 0:S8!? 0Ҙ 4+ )`'% @  ҈ `o@ x ?2    Ԁ@  㿘?`68#*` T? 0S+"0s  `S! F?:: B 8 `   |`zS!?: F?@`ߐB 0    $5 ^͞ B 8 Q`O   H`FF?0gFŞސ ? 20 * !    ̐ѹ  ^ 0'S@S x@ J @? "@J? @0&#0   Ԁ x  J:" ?." \ J2 02 0?㿘?* : ` &9!8*`  ?* : `29 l*` &@?&@? &@? &@S"&@&@?㿐#S`x%S$@N 2N1N# `:&`?`%%`.2* 0 `\* Ñ: *  N%  N '( 2  N  ?'  N 2N@`x` @&`x㿘 "l 㿘S"DSSaSS!""@ *"@  S"a㿘S!SS!"@ "@ t㿘N@= ` & T@   @ %$ #8* R  N@ ?"@N@ 2 @N`  `N@ "N``, `N@ @(,L? "?,S` Sx2 Sx" 2 S2 Sd" J &T   J  Sh2  @ 㿘S! 'Sz H0 $HS! )Sl&$H! ? !  @  拒̽W! ?$H㿘  ? `?ES !?? :耢; -S! +S&a* n?  ae 4?2a? 42 a@( a;ma ?㿘f S#( 0H  `?d"H㿘b!  ǰ @?O   # @ #H ?b "$b@JU$b! " @ ǃS$""ah 㿘! " " @J= $"""㿈S!h"  "@ "@  @p4耠`? &@ & 㿘# bx "?@ Z ??SS:P$bx:XS %S ``"S 耠2S S`"; 1`S+SH-  SH2'  x"" 42 2" 4 2 ( 2 㿘  `@ 42 ` @   " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@ 0&@#㿐)  S`   ` `>    2 J@ 2J@> J@ 5 2``'D J`  `'D 鵐 J@ `D` D 'J '`J@D  J` ` 㿀'P>'T ;'PT  0 PT "@@ 8 F :`@ F :`:`5T(N  PT  Pj '"x`2@㿘S!d S" S"!`h㿈7耢?쀢? Z? @? 㿘~S"HS`"!H㿘 ` V ͊?P M2F S"p  ` ? 9 S "` ) ?* '#Sa "? a 0?? ? ?㿈\! S" ? 4 d d 2+:v4 ̔ `D  D?? S ",d 2:M",  @, $Pv# @ 2 `  "S  S`SS"H  `` 2: 㿀`N@ 'e 2S]#(!h "@U#X3SbH  \ bH  SSaH S"aHS1"!H(!S"   SU?`"!d" S"!`" S"!`!S"H  ( S""!H"H ??? ?+#xc &??#\#`#d?  S"H   02SS"S"H    x#SaX-SP?耢 Ā ?? 굔 ? PP?@ @aX aXaX`@ B P*  : 9FaX"SaX2P`( P  P*  : FS!P@!P2S S  P*` :  P*   * @ :`@ f !X 4 (S(&:!P#\#`#d ! S!X!X?"    S @?S:!PS:XJ@+`H8 2 H "H`HK@2 `2"2" J@ @ S☄ S☄ S☄ ☝㿘  Ac@o Ac@k Ac@g 0 @d  @a  @^  @[ 㿘S" Q """ @N  gÒ  @C  @@ @s(@t* Ac@8  3S "a #S%Saa؀ S 2  : S "x" Ǐ ` S, "`S "a",#ƒ x'''@g؀ ?؁㿘 @:#S "b "b㿐S"4 ? ?Oؐ O   /S㿘@K  d PTt   0 @   Dl  % !!S$#` 'cP''@ $ X5 1 !' FB* @€  b@א &## "`b@͐   =&t$` @ #J@ 6`#b@ @$`8]$` 㨐 X"` T$``(P$`#@ J@ 4`#b@ @$`(9$`` @5$``@ 0$`# ,'/@-)+ ' 㸒@h"p`4" `"P``@`"D```; > "S``` < M{ @"V`@"M`40@Bj @)e @"N`@@C[ J@OU 㨐 O$㨐 L$``(H$` @E$` "A&#c@ # "`c@  & =3$`0$` -"# *$`  "c%$`  "2 $`$`H$`L$`P$`T`$`$`H$`$`L` $`$`P` $`$`T \~#@ J@ S#c @ i"`#@ J@ 4`#c8@ $`$ S$`` O$` $`   I"##@ J@ 4`#cP@ $`, 3$`#@ʔ J@ 4`#ch@u $`  $`#@ʴ J@ 4`#c@_ $`0 $` "c@@G ?i? $c* &@ @@`@u@ @c@5 @  @R @ݒ @o`-c@ cؔ@5 @9 h?'S#@ [ Zc@ @Ӓ @  @͒ : @5   *#S@ޒb  @M3 2@5 0 b@  #` ' ` Ԑ =$c`&`'   'ش S#`7S'c` `&9S"-a+  ; #  o-  5`   ؐ@֒,    c 2tc`@ᥐ Xoc`#"2`''` 2  ܘ @ٚ  "''@iܰ  c 2Jc`@{ hEc`@C & $''$'' #\@FFd    2c؀` #`w`x@@4cc 2c``@v@4Րc c` @ @$c`c`? #$c`1 #  ?@&#  ?`@4 @; @;@D @B @@ @T #`&#@ <c` N Ⰰ  #`@ @n "@Ⱄ @40S"2  &`&`&` S&`D&` 㿘'HH@턔$㿐@뿒 J @ "`E    >  &` `@ϔ 6@돒` "1 `  ?+@` &@뀒 ! @@v `@"` `2  ` P`  P&@ 㿘   %`@."@ 㿐@ ' @3 @ `@㿐 ! ~@r!h "L@ " n L` o `@ = ", `"@Ɛ 2  . @ @ @`!!ap@  2 &*@ &" a@  "&&@ @@ # 2&@@m`"2 &@aȔ@ &@ 㿘@+㻐# %a' @ ?6  $@x  , ( & J  & T  J   2`J  & T    2`J ݚ`@ ߖ@Xa @%!  :+  J  &T `H 2J  &T ` 2J   *  㿘 S#h@$0#h$@@  @&& @ْ & @ 㿘!S$@s#h@ #h& @ &   &@Ŵ& & @] 㿘  "   b4 z @ 㿘   @$  @ b@ 㿘  b@ 0@g 0@Ґ @%%%%%%%%%%*x*x*x*x*x*x*x&&' *x'''(*$*x*x($*x*x*x(D*x(l(X*x*(*x*x*x*x*x*x*x*x*x*x*L((*x((*x))(*x*x)H*x)h)x*x)(l)*x*))))(*x*x*x*x*x*x)*x**h㿘   %b0@#"@ 㿈`U! %TU z"aU@ @*``!U"!@(*`$!Ȑ@J? "U" KU!܀ G@N ^J`$`?#U aЦ`?   `@@Uȓ*`"  *   aЀ   aВ&@"#\ !#`! #d@KT@ǐ`!U!ȓ*`" !ȑ* @*!ȑ* @*Tc "c㿘w$ @箒 2@k㿐a@j   a@1= Z @ " J ``U "a @a@1" @ʐ㿐  %U$J f g e    UaА  "aUaܐ "aUa "a  6 `S*H *` `T? & T    T "##33 ̀@Ta @a TT*` * ?А""!#@Ř #@"J@ 2 #Aa @< TT"#"#!#  TT"c"@o #@"J@ 2 #Ta @ T"#"cUU U""a"UU U""a"UU U""a"Ub "b UUU""""aUa "aUa "aUT㐐 `"~" %"a8 @~ @ U q"aU m"a#i $@ c$@$`^$TU "aX"TU` "P"㠔 UUU"!"H"aU D"aUT "c>"U :"aU 6"bT 2"cU ."bT *"c!#@m  " #@d!P #  "`@Z     "`a`@^ U "a $#@@      @A ’ $#U!& *`` @d`@} 2@  3TT# cc U<?U!Ѐ Tc "cc!U*` * " @ؑ* c$!@ԑ*`c/U 9%    U!܀  !UU!U!@@"c!U!@@ !T - @@1 "c !T#@@ "a@ؐ c ΪdU!耢   %@k"@  T#  U "a؀ 2U@ @ؐ`?! "?@Ґ ?  @??@Ð`? @e @b ?%$@v?  @Ė $ #\   @  $   $ $ @ܔ @ @ 㿘 @0 @ @  T"pH "   "J  2p "@p"TT x t㿘@㿘@  $   $  $ <  @`Tt `$ $T"t"#xTcx""cxT|Tc  "|@Tt`T  |@ | "tT x 㿘0@ -  㿘0 㿘U"Ua@   U! 2  ` @K[  @.:   0  `!@`!@ @ `@L6 2`:㿀  !aJ ag U" 2 !@mQ y     /T /T+T???耢'''%c.# `@J? 'U a'@x 2㈀  2c %c  U!Ԁ U! T B?B 'T# FM%U U!؀ 2@k!!@k#UaԀ  !@k!U"  !@k  2aԀ 2" 2   2 U! 2!@kŒ㿈U! T#LE 'T㜰 ?  U! @U"       ?,`@? @`– T# 쀒@2   2     㜢`@Ơ$T# `?     23U`A3UaĀ`U 9! 5U! 1 )!U! `TT#T#@ T# `"T@k;!T#Tc $!`&a]T"#@i :0@e -aĐ?&aā㿘@U"!U!& &$ &$&$ &$@  &N@   % <* R *  &N@  *@& *  "    "  !* `#   %#8* R  *`" #   &㿘@& &$&$ &$&$@J? $  ??  & &$ N@ ^U  ?& &$U"  U!Ѐ    *?"   $@a@”  2 $ @ ?a@Զ    ?& &$ @i $@ @ @&  *@ ^U  & T@   2"U  & T@   U _ , ^ $ = - : / .U!䀢 "'    % <* R +  2  :  `&   `   @ &a? &U!Ԁ 2% U! 2  2 2  `   ?"6   `&$"@"@?@   "* "    6 $U " a*  `#   %#8* R  *`" #   &$ "  @ 㿘??>>    $$ "$  &   2@@ ?2}< >   :>$ "p @  ? & T@   _ ? _Z    @  & T@   C@ _? 4 ; @6@  & T@   2 @ _$  ? & T@   2  ? _   @@"@ ?2p  $  < ; >>$ " @  ? & T@   2R  ? _"M     @  & T@   26 @ _1 4 2.  @() @  & T@   2 @ _2   ? & T@   2  ? _"   $  ? * @$ 6  @@ ?2r < >   :>$ "r @  ? & T@   2T  ? _"O     @  & T@   28 @ _3 4 20  @(+ @  & T@   2 @ _2   ? & T@   2  ? _2      @* @&  (㿘@P a@) 㿘@ b@)  :#? @ @ U܀U`." 䀠   %<*P@"    * ?2`@ 8  @ @ 8+ *㿘U!؀    %@Ēb@ U!   %@`? "`` .`:  @* "@@* @g" U!̀   %@`? "`` .`:  @* "@@*ΐ " @gu   %@`? "`` .`:  @* "@@*3 %  @b@b@`?"`b@ * &b@@* 㿘@5GPGGGGGGGGGGGGGGGGGGGGGGGGGGGHGGGGG`GGpGGGGGGGGGGGGGG㿘@c %U#,' $`0'Q"H*` €" U "b$U"b # $ "`b(@  @c U "b@@@:=b?ђ?* @   @*   "` @"P "@@   @:@ 2 `@ 㿐@  2 @(6 " ,`* * * %X T@м Z @M D @  T 2 >X %!'@g @` h< @   @ݔФ  "`)@"#Ъ @˒  2! @Ĕ   @ 2 @  "`@' 2@  bP@K  !U@  @  ,@?| @,@ :  @?q, :, @! U"`"@eU"$`2f !U" @6 "@fʒY "P@   2S O" @L ,  ? ?/7  @6 ?H'D'H'Xab'\'L @ǘD @ސ"( @5o$ 'H'P'T'L T#\1"   @lb   @ @  @B"㿐@`   @f]"7 @64  ``@ ` `D@  T2`@i T 2` `D@  @Ҡ! 㿘 "  b`?  #U@W    2b@ 㿘 N  nc@ 6  UN  oUU "b "" %   @ , ` @3*  $ @& $@ , `$@  @ؒ , 2*@, $@㿘 U" "- @ "( @ . " *"@x 2  @q " @ܬ . "  *"@d   " 㿘'HH@s$㿘 %c0P@m"@ې 㿘@/㿘   %`x@\"@ʐ 㿈 @k 6 `@&   //07'c@ꭐ@? 㻀 %!'')'%- $ /#x@1@7? o* & @ @' '`@e ``@%Ő ఒ@  `@% @g 㿐@ϐ ' @% @ `@t㿐 ! ~@cے Ȣ "L@ " n L` o `@ݒ = ", `"@ 2  . @ @ @`  `Д@  2 &*@ &" a@ΐ  "&&@ @  # 2&@@_a`"2 &@a(@ &@ 㿘@?X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`X`XX`X`X`X`X`X`X`X`X`X`X`X`X`WX`W@X`WxX`X`X`X`X`WX`WxX`WhX`X`X`X0X`WTX`X`Wxx @    @6 #????@  6  -@d!x -@d! -//V0" "0V"(""("` #T+ $`:OU!l*` € c  G"c  c  B"c  c  "c ! #/@J 6$##a@܀?! a@$x # @7$#@D!@yc "c#J`"@0 !a@ @##@g@6aЖc*  @  c  VV@R??"N795-+/@ @   @@z +@@@ 2@@ 2 2@@"(@ X @ڈ   @ڂ`   @|bh p@@ @@ @, ??`㿘   @]bX  @Wb`   @Qbh "   @ 2㷀 %!'@ b@8  " d'@א!'$'@z *`"  ` '쀤`  @X `@@i *`"`*`'" ! """@aӖ  6#,   @aǐb쀤 &@a"@u? 0K@b#@@l  " @{ #'9%$@@`@]f` `#@bs (@bn  2@]Q``#@b\0#(@bW@ @Ր@耧 "'@aW @bA#0  `2  a0 `  @A #8@#  a @#@㿘V"0 # @\  2 c`? 2c@ 㿘V"( "1@C  2   21"㿘@ : 2 ,@cH@# @V $ V"(  `@  "   2(@㿘@ @Ð$@$ $   $  "& 㿘 'DJ  nc`@   J o   "c'D"#D!"0ϔ#p@` V㿐 N  cx@5? a@", @y ' "@㿐@'")@ 2@I, N  -,`$@` = `,` .$`c,`$$ `@`9#p 2ܐ?&@&&㿘   %c@""@     $   㿘 %'H'L'P'T'X"@|BH@x 㿘   #$` #@`$ (@  #$` @` 0   @` 8@V 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@[@2 h㿘 'H'L'P'T'XH@$ (@bT / @yP <   L` r`@ `@2㿘@b5 / 1U$"(@׮, /,`p$@"("( @$"( H "# ! x@y   x@_ 0M@y    @_>'< @@#0@#  %# @x  v@_e !  @_[ @ `wâ @ꂐ `2 㿘 `@ Ԑ @v `@ ̐ 㿘``@  @ﵐ  @`@  㿘@ɐ `@  㿐V@" "@Vb8" "b8   5/ %-@G  `0; 7Q``@^   `2     0  `2 @x  @E@ À Ϧ``@`) #,#,@4V  "8@R eu"8`` 2@`@ I!0e  2  ` `  !  @^z ` `  % " a @B ` "`$`  "@$b@ $  "" @ @ @ c(` $`?"c(#,?%#, @ Q#,V"b8 " 2@h2V 2b@ 2 ""# %a@b  b"8%#    HbP@ϒ 20 !0@aP @a 㿘@ %V J? &`T   ` " 8@8  @ 2 J` 2 o & *&  & & &8& "@" c, "c,㿘V"8`)'`@]"X`  % @]h 2 @]P@`2`㿘` % @Շ 2p@(0 2 # H$ E$ B$ $ $`$ `"@$`㿘` % @  `  @  (   c( "c(㿘@㿘b@א  ` @<b`? '%+ $ m@X 2b@5 @!@v@@0e?倢 ?c* @ @&@`  `J`p  &` @ "!@- @`@@@㿐 J c b @@b@  @  @"J@ b@֐  @  @"J@ c@Ő ?# * * 2 `@ ? 2`  c @ @_ c@@  㿘  #@0 6 @]Sc@   㿘  !    %"@/cH0 # % cp@(b b@#c@ 㿘@"sshshshsPshshsshshshshshs shshshshs8shshs,㿘 %c@"@l 㿈!^+^7^)^#% $5^-^'^%/` \"<*` €#$" %b &T %"P@c  "`@c "` @/U`X?ؒ?& * @&X %L "`#$H   ''1^'"` @ܚ ?`h@a   "``p@  " x$""P X@[ L@[ H@[ "@[ "@ӽ "%b@ӵ`x "@ӯ`Ѐ  %b`@ L@Q蠒 H@͐  @p XH`@ @ @ @ƐT`2"@Ha@  @O H`@  "@ٙ 2ba(@ @W@耢 a8@ِ @ (  @c؀ !H ` " ` ؀ " `` `!h@ڰ 0@  @[ @  !@[0HaB + cB + 3`  *`  @L  !@01@ta: Ā@[ǐ!0@0^b      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@" ^    @   ^^#""""b!!  "@Z@+@2 ^ ^bP"" @Y"0"耢`""`"h@Y"H@Y"xb"@Y&@"@a &&  `  㿘. >@Ö 2@b@ @rbؔ@ 㽀@Q `@ @*  b@ ` F ^"""  ^`" b * "b^䀢 c@[ ^"P`#@Y+ b @P)^'`, * ""@ P @Y0b @`P @Y #80$c@@3   cH@,  cP@ @ cx@ @ a@| @5VbH# Q@ 0 c@  @I@ @B * @   @T@6 x `*  d 0#, &@T x^b*  0" 0 ; `@ C@ 8 ^" @ ^c@ "^"@P  #@X`(`(  `P5^3 d,*"@ P @Xmc0   `2 dP `@X[#8`>P #@XR`X 0#Ē tP-^+ d,,"@ P @X6c0 t `2 dP `@X##8`c@B  㿘@ PPPPPP`<4@h |DTT\||||||||||||||@,||||,8$Ht\\㿘 " @ؐ!  ! %a@""@b@S 㿐 ' 5`/`+_)_#_'%`!9 $;_7_-` "* @€ %| %cܐ %#Ԑ  $c@  $ @*<"X?ߐ?#* @ @S]&@*'cc؀`&b`@ഒ %ؐ  @ %؀?2@bp@Q   @ ?`+`*` €&̐@*'&̐@0 @@0w@@x_#̦ ` bx@ `bج @*' ) %`@J@ - @ ` `  `0  `0 "   "``  "` "`=@;@   ?''''  ܘ @V b@ې  "_@z b@ϐ  ܘ @= b@ @W#(#@@V"0r_cԀ  @V"`` @#@V`` [#Ԁ " @ ,K` ` L` 2D` ?`"܀`2< . ؒ@,& _#܀`+#Ԁ @$ #X`@ @ @UƐ@ `? @`@  @UcX@U#h #@㿐`%a 8*` €` 4  ` < cp@ _`b "` ``0 "`0 2"@%&@㿐_#c ( 'bx@ @M g"?`b@) ? #`+`5`7_`@J@ -`@t``-*`a  €`   ` `    `   $`   ""` $`Ҡ 7Р$` "`` "b`, %`,   !"(?2`@ @ ?2`@ߐ @  ?2`@֐ @ @ ??2`@ʐ @ @ @?2`@ @ @ܔ@|?2`@ @@s??2`@ @ @Ŕ  d&?2`@ @ @ZWS,N ?2`@ @ D?@{      @6  @0?@, ?܀ @@̔c  #c@Ts Q $`  ܀ 2$`@Td#@Ta $`@ @_ ? 4``, 2  2  ` ``(@j   ` "  +`#_ 2-ML (`"&M`  "`c`@| @O"M@? "M@O`3`@O``M g@L @O܀ J!`  8@SL`  H@S` ` ` _#@'@Sא X  @Sѐ `  "  7 "0 "0  h x @@S @ 㿘 # `@J@ -@Ő`?`*`a! €       r@p@ !@Ӑ `   '  ? ( ?* ??* ? *  ? ??? "`` "`( *``H 8 *@㿀 %!  ' 2  2   2    2    2 #    ?? @ڼ    `@+ ` `@_" a @ ``    #!"``? "`a",* €`"_#`# _ #`   _#`@ ! ,`, @ސ  ",   0   0 ` "   ,`a!Г*` €  ??  ??''%'ܐ@{Ā 'ؐ@sĀ `@ ` "``@  "``@  @ǐ@K ? ? ? ?     $ 4 ؀ 2       ## `2  2` 2` * *`$*`*`*`2`2`2` 2` 2`*`#@@' Ȱ , , , , , , , , , , ,  `,  ][ @lYV  $,@O 2& + ` ,`' @%  怢  @ݐ " `  R* `#`a@  @  @+/  2&  @ $ a0@ِ a@@Ԑ 㿘@O`  `   aX@ ``` "`@`@ <`  ` @- "@?`* "   * " * " " " " " " " ` *  `*`"`& &  &  @?#:,@`?x   ?''''  ܘ @M b@Ґ  &@q b@Ɛ  ܘ @4 a@  @̐*@~㷈 %!`b_ "'+`@G )'bؒ@jm(? @L`"bؒ@ @. '@@P!@b؝㿘`@L " @䋔"L a c  g  `     /`  % *+ /``00^_ `! `$`и `" @`" ` " `* `" `" $` " (" ," 0" 4" 8" <" D" H" *  " ``"c @  %_` "䀢 ?   b@ϔ_cԬ  @a _ # ?   c@㳔Ԁ`@a ` # ?   c @㙔Ԁ`@ea _ # ?   c@Ԁ`@Ka `  ?   `@eԀ`@1b _ # ?   c@KԀ`@b$` X ?   `X@1Ԁ`@bԢ% 6@x`"܀`23 `bئ @ _#܀`&?@P" !?  %_ؒ@i"L  #`@`@؀?@P|"@ @ߒ  @@*@ J "*@` , (4 @& @0 @   ( @? * @  @? *㿀_# %a ' `" @  *  @@O2   "    &a 4 "@[ @O  ``| 2   @  @O    !!@O!  % "@@ @V T;@N!(  % "@@( @H - !@@N    "  @Nؐ!X @NԐ!` @Nϐ!p@N̐ ` !x@N  %  "@@(@ @v!㿘`@"@N!      ` @^ 0@!@V  "  @ @K"0ђ L 53 %7 9;6/  ."#  "  @" " ` @"  @  2 @ ` 2  @ @ ?` @` р  ,  @@N>" !` | $ |@@N2"0$ |     @x@N$"H "`@N`@h@N"x@N (@ѐb@@N  `""@N@Nb H@M $`  L ,@M $`  L (@M 0`" $@,  0"@& 0 $   L 0@Mې_#Ԁ`" @0?H@Mΐ#  8@b@b@`?"`b@ * &b@@ 㿘@M# $! %# a@r"@@M#  "@@ka @ L㿘 `O' %@M#0 8@@Y@`?"`@ * $@@ې  @2 `` 2  ?  @ @쀌@ 1@``, @@M]#@ ?  @ @而@@`?"`@ * $@@ @l@㿘`Y ?N>@ 6  , < ?`&  @  * & @rN !  ?`&  @  * & @[N 4 N 4N  ?`&  @ >* &@7 >㿘   " @ 2  x %  a'" @ % %0:@gt#H@' #X  @!#h@L" %  / / / / / / / / / / /@w/#x@L %@Ȯ"@! @<#㿘@@ @*    `А *`: ?А *`: ? *`: ?ɀ`2    a",  €* ,`  *  **".@㿘` " X* X*@# `c@F `$"`㿐    @՚ "c @/                         ,T@h4`T```````````````$````d̴̬̼̜̤̄̌̔p   '''''''  Ԙ @᳚   `P@ 7 Ԁ "@  @ +  Ԙ @ᙚ 6`h@  @K  `L 2@@ǐ@@@ @ؐ  P   '''''' Ԙ @d ? @G$`*8`@    @ۃ  @ ْ  Ԙ @G ?`@ ̐  @K-   @ * @@` @ۄ㿀 ?  ` |`  " ` |`  "  ` |`   ` |` a!a (0#\#`#d#h#l#p Ȓ@J֘0!p#\!@ahax@JƘ  :  `" @`` "` P %! L' `u p " "p@   Ք c   ` |`"  " @j   ` |`"  @\  @a D H@Jn! (`@Jh! $!@Jaa $   L % b@`?"`` "@* $"@@   @#@J@!ؒ"@`?"`"@ * $"@@  a @~!! #t 2p  #t $#tp@ƒ @TĘ`   `` |`  "  @I Ș`   `` |`  "  @7  `` @[ @I!㿘?`l#,*` €! " "" "( `@IĐ"80"@@I㿘`@@    `"X@I 0 |`, "`@I20 ,  "p3 @I 㿘 @I"`  @h?@I~"" " @Il"@Ih"@Id" @I_"@I["?`%*`l# €@IN"@II"@ID"@I?"@I:" @I5"@I0#0 @I&#0@I"# 0@I"㿘   ? ?  ? ? & 2@S `@K@-`"X@H 0 |`#(@H0 #0@H h %! '瀣@" +    +@H! @}u#8p %! x' _"x"@! 2," .@" "`@!,"  !_c@!@!\!  `Kl#*` €@Y M  ???ؠВ'@ɐ  /Ѐ/؀``ِ ` ِ   耢 /'/@_!@֐@c " !^ #@8 #@ `!_H!@|!! @|#P㿐 'D #@ ` |`D @"ٔ  @ . _b@  ". D'@ 1_!@!!㿐` | `  1_#\!! @3 c`!@ ߔ!!㿐 ` `` |`  @  2  #@" @HN !"@`!_!@!7!` `!_ h6 !@|!*! `6 !_ p6   6 6 !_#\6  `!@{!!6 6 !_#\#`6  `!@{!!h  %!' '  '  ' `' ' ''T @`8 `@ A ؀`@ + 3 "$` "` ` "``"` " ` ` 2 `````2+ +  IJ` * (* ` `؀ ܀    䀢 $#@@#` |`2 #\Д! @7 `@{K!!_!@{C!! @{#㿘     ;@:@ @ 1_!Ж@{ !! ^( Q(( ?_:* c0  .*  ?** *c(p ? / / // 7  / / / / / / // ////2 2 2얓21_1Y  @z!2R  #@Д   ,`  #|@Ŕ  2  ,` 1_#_$%!_ #d   % #\#` @zz!`L!`,``0!`1_ #_   K 0 *  2@aP@z_ ,aP HaP@zU!2 㿘 ``  2   1_!X@zA!!   @i @`,(m("` "` "`L "`T"`X"`D"`H"`P((" 2㿘@.n㿘 !!s@!x@Z`  `!x @M`Ȱ ` s!x@u $t   s!xt`@6t6"!#`"@m` 2  2  s!x`@at?"a J  @R!   @M!0  t @)! kk"""b|㿘!k "ܰ %kЀ4p#쀢  `"$" ##` "2  !8@0t!J! @ !  @!0 "$$"܁㿘  c"`U 㿘  c"`K 㿘  pc"`A 㿘s!xjap@ؘt?"a㿘s!xka@؋t?"a㿘s!xoa@~t?"a㿘 'D'H  'D` &`D  D@5ӒH D  DD@5ȒH D $ HHs!x@Mb t``@7*` Ht?F"a`"H`""`H@J a j! "0"8"@  q#  @ `H"`  s!8 H@  H"`H` `"` `@:`H @ԑX %!'H' 'DHD@5[H HHs!x@bXt?|"aHor "w# a4@  's@ې!Ps!D H o"## H@6I t! ?JJ & T    "J ) *` !/K & T    " K  %#8* R +  *` +q# s@  s!8 j@ k j! "0"8  k"p    @!o# Hs!L 1k"p &"p"p@5Βb # $#&"pH @4 2nLD  k"䀢 Mo# H@5 q# H@ s!8 j@  j! "0"8H  k"p  @- !o# Ds!L  1k"p&"p"p@5pb # $#p&"p  ,@ֹH, @F H 2 H@@"@WD QL# DH@5C >q# "@ (s!8 j@  j! "0"8@  k"p  @ǐ #oc 2 s!L !k"p $"p"p@5 b c $c$"p  o@D?@ɟ o"# %! @wF"㿘@ 㿘 !X!X`""@ 㻐' %ᴀ 'D''H   'D` &`D  D@3H D  DD@3H D $ HHs!x@b t``@4` Ht?"a G t! B  J  & T    "`-   *` "/K  & T     +`:   %#8* R +  *` +H"   q# H@ + H"`  s!8 H@  H"`#H@[C   (H`@B"*@ :XHH @4  H H` `"` ``"@   :X@@ @vH"㿘@8 !s!x?`" * " @Ő !x@)o# s!L r!k#r  "p`$"p"p@3$` $"ps$`!P@L $`s%#!P@F 㷈 %!'H' 'DD@2H HHs!x@ct?"aHro ""@C$ wc @ a4@. 's@!Ps o~"## {s@4ǒ 2 Hs!xc0@۔ms@3b gst! 'N     & T      % #8* R  +K@`*q# s@  s!8 @@  @ k"p    "@ 3oc ss!L 1k"p &"p"p@3cX "&"pc &c&"ps!D @2H 2yN@ǜ o"# %! @uC#` hp㿘!r `s!x#!`ocx@9 ss!x@e#s!D j@%    os!xc@!0s!x@N#@% j!,'ss!4J x k"@ck"tx@` xjtko`8ؘ"@bk"ܤq#k"pk"x`h@ۖj! r x`@Δjv x@ƒ`tn!tj!x`@ӹq#  tjxa@ӭsx@ڐ!0s!8  spxa@@ӛpx@Ȑ!Xp#<'sr 87!s!@xah@Ӆr (,xx@|ak$"ؔs!0 !!`@ka%k̀ x@ٖ"̠ t j0x@ @Vb ̠ `t"!㿘  `? & `@ch   & s`@ cp s &!x@@(b(?" !s!xb@@㿘qĖHt"a㿘kؐXts"a"0㿘kxpt"a㿐  p#耠 `?9"# s!x@@b(t`@ch 2`p %"c@cp 2`p"#   @#􀢠  s!x`@ҹbt? "asp "!@"3pcW1s!x@ҧbc耢 s!@!x@Ҟb!x@͐"ct"!㿘kBt"a㿘r(6t"a㿘r8*(t"a㿘kp8t"a㿘  s!x@@\cPt?e"a  j!, `?1"!, `@$ch  j $"a, `@cp  j"!,2 `@ `k "b @ `!`#0@K!#0sj "a4",!j!, s!4 "sJ  !,s!x@c$!,!,saxs!4J k c@ j!,t"!㿘kt"a㿘jt"a㿐  s!x@@Ғc*t.p`@ch 2`p '"c@cp 2`p"#   @#􀢠  s!x`@ѩ`t?$"ap"##쀠 `?"#1p#쀢 qc c ?"c#;!s!x#@ъ`0#쀢   t"!㿘'H  'DPD@.H HD  Hs!x@j`ht?."aH`@ `t!!`k"܀ Hs!x@ׂ H`@ ` `t!"&`s"!Hs "aH㻐# %a '  # &`  s!x@@%`t`@0` t?("a@٬`  `@>""t?"a@?$  s!x`@t`@> !t"!`a@͉a @q֐!㿘'H  'DD@.NH HD  Hs!x@Ӓat?"aH`@ !0㿐'H 'DD@.,H HHs!x@дct?I"aHor "w# a4@ݐ 's@ì!P-H !oo&"## "H@/ !0@Β# Hs!L 1k"p &"p"p@/a8 # $#&"pH @. 2N@ã o"#㿘'H  'D@D@-˒H HD  PD@-H D  HHs!x@DaXt? "a`@~!x H`@w!㿘   &`  !&`   s!x@@at@@Ya !!`!@M! " `@.` 2`t?1"a!@> "``J |"`@.֐` `@.y!Ѐ 2`t? "a`⨘ @ s@0!x`@k@f㿈'H  'DD@-3H HD D@-'H  DHs!x@ϯa!tH*  ?a''"?@ HJ |H@.{ @.!Ѐ Ht?P"aor "w# a4@¹ 's@ˆ!Po#+  a w/H,`@!Ș @ 3oc os!L 1k"p H&"p@@-"p c &c&"po#` D?@Ҁ`@~ o"#耢@@Ґ 㻈' %ᴒ '@l  @h @ W @٥   @Z  @W @Κ" L@ "@= / " -/ @*#@Bb  +/p#쀢  !s!x@'!x@q @C!x  r ,(@9 @9 "0@;?t"a@oF @@쀢@ @ ?t@;Ր"8t"!"! @o"H@# %a'H' 'D PD@,HD?  Hs!x@Νb`t?V"aH`@֐" 7 D  H@"H"`D 'DH`@" # D H!s!x@ԧ"@!x % O@Z@c?,H" D 'DH` @"  s!x@ԉ"a  rD 2 ?H` @"r?"`a @o'"؁㿘!k"ܒ $"@u" 2$"t!!2 $"s!x@Y"@e#$"܁㻐# %a'@<$  s!xc @a@;#8at"a@n#@㿘'H  'DHD@+cH HD  Hs!x@cXt?"aH`@!#x t!!k"܀ Hs!x@#H`@ #㿘'H  'DHD@+,H HD  Hs!x@ͱcXt?"aH`@# t!!k"܀ Hs!x@ː#H`@Ր#㿘'H 'DD@*H Hs!x@}`t?"aD!`@#H㿘'H 'D(D@*֒H Hs!x@^`t?"aD H@H㻐# %a'@o$`@>  $" @a @3    *@ . "0/@h a@א a @n P㿘'H  'DXD@*yH HD  `D@*mH D  HHs!x@`pt?"a` @+`㿘!k"ܐ  $"  @`$"܁㿘!k"ܐ  $"  @ `$"܁㿘!k"ܐ  $"  @`$"܁㿘!r   @  @s    @ @m 㿘#r` @ܐ !u" "s@s!D ?"aH$"$`k""́㿘  s!x@@}at? "a2`@!@"㿘@/ s!D r@, r  t "at"!@  k"@t 㿐'H 'D(D@)H  HHs!x@?a0OtH@$ ? '!s!x@e!H@!xth"! !s!x@V!`@u!x1tJ`  k!s!x@I!x@h!x$t@" t`@A @ϐ J r  3o!s!x@+#@J!x@ @) t?)"a3oa@3Ґc  !o#!@ڐc "c @vDH? €`r  t "at"!@ @ 㿘tqt"a㿘tet"a㿘  qs!x!q!@$##t"!t ""at`!@  j* ` @ j` Ja&`0J!$J tJ@` J2`@  ` @* 2  * J *`0㿘'H  'Ds!x!s!@{$!8!8tC"!  DD@(H D   Hs!x@/at?*"at1rs"a , @?"8saD`  L " & ,@1 ,r ,#s@:! L " p#@0# s!   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   pK +`" pJc1b  0. 0cJ [  \ $"J+2+J  +J $7 J & T    * J 02?L  @`+J@  l +` f @ "`  +@  W  *`G: :  \ $?27JJ & T    ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J d  J2J 2J  ]`\J BKsJ ,V ]":R & T    ")+J 02?L ! @`+J@  +`  @ "  +@   J  +N 0  00s!x@Ͻ"㿘k"܀ "8 k.tt"a㿘j "Ht"a㿘rXt"a㿘@ "h``t!!`k"܀ "s!x@y"p@ "`s "aH㿐 s!x@f"0 `@ # sJ s!x@O"0 !xb@ :!X㿘@ O#0㿘!k"'H 'Ds!x#8  DhD@&eH D  kHs!x@cxt"p s!x@#"#j*`H * a0@ "̀k ""@ s!x@#tz"!" " `t$"q"*` *  @* *  "@"̒a0* * ` @'%o`? "`@e   "耦?̑. :  .@"̖a0*` *   @ƐN "Ė.@`耦@ %3 %a`? "`@; a  &a耦 ?23 %?a`?  "`@&  s3 %a  ` &as!x#@΂t?"a㿘'H  'D(D@%H HD  Hs!x@3`8t?"aH @'9 ?  tHs!x`P@t"!㿐'H  'D(D@%{H HD  Hs!x@`8t?"aH @'J ?'H@C@hNs!x``@ t"!㿘  h p@ `㿘⨒? s!x`x`@`㿐'H  'D(D@%*H HD  Hs!x@ǯ`8 tH @&  t?;"a@ J  `@W?% `@ې X 'p)k  ``;`@y' ah@ `@    `@|    L  /!@^; ,@ / "L 2,`@y '?!@2l  @߅(?2`r??r:@a   %&@X!' 6tR"N't!'@? bt@f sa@  r ':` ; @%n?@ V'a@i r @ B :  " '   p@w` p#耢 6r 8 2r + 2s @&s!x #`?"``@* "@@Z #s!@ :r @ F  s@(ss@!x@Jd ' p#耢 Fr 8 2C r ` 2<   (8 s!@r  :`  2s ss!x?`"@  #* "@  #s!x?`" * " @ s@!x @1"9 @$ kL [@3  ] " J ``:2* @2 : p, #쀢  s!xbP@I @$  !` ' 'o"@iH$`o"`x  P@d@i3$  $@+ "@ ?'`T` `#\! @ b@#!k"܀ s!xb@``@P` '?*"`@M`  ``#\  @S  @+ @+@E@+"?'b``2`@$ "@0Œy @b!k"܀`' s!xb@ã "܀ s!xb@× #@B J  @: @ : @Z c8@ǐ @ % 2* P @ @   @  cX@  `@   h@ k"܀ s!x@Fcx `  @ ? @0K#  @Δ '   ?' *@ " p J? "  p#쀢 s!xc@@+ Π c@_   cȐ@X  c 0 ` " 0@ڐ# c@D  #@Β @wr??:  @s '   ?' *@   J? "  Rp#쀢 s!xc@¶`@  `  ?@rb:  `0@  k" ` s!x`@@ˆ @?@@ @ X'I@a  %&@z!'  t@/l!  R"N't!'@]    @   b<@{ sa@  r ':` ; @"?@@ 'a@|  '   @r` B:` ' &  p@̀`2 p#耢 7r 8 24 r + 2s @&s!x #`?"``@* "@@e #s!@ :r @ F  s@(ss@)!x p#耢 Fr 8 2C r ` 2<   (8 s!@r  :`  2s ss!x?`"@  #* "@ #s!x?`" * " @ s@!x @. XG @!ɐ r  ?k kr  k@ k"܀ (s!x@Ǒ p# "܀ s!x@LJ"0@ '@5  @.Y#  @.S"  @$ `@ 0?@˫@@@ %! @b 㿘@$ !s!x@E @d!xt!@- 㿘@$ !s!x@7!@V!xt!@ h %!'Ds''H'L!'@  r   H  b @ b(@ @Y! M " @O!0  M "  Ԩ H* @@   a@@ `@~   `@~   c" 0L?[0W`@~  r Lx?J0F /@ :@@ @ < :8`5`*  @,@ @ @ 2  @I!@0` M@  M  H*` @4!h0@-@*` :@\@X /  * ` , @A :`N@ ր`p,@``L@  @. /  * p#쀢  s!xax#\#`@r   S   '''   L "!k'' !k`"$" @Yr   $"  @H 2 !@0  k"  ` L@ a@5@  `L a@) 2 `L@  !'ؐ ''s!H J"I?L kC?"܀  s`!ax@za  @`$"''܀  '` L!k"p"'$"p 8 $"p " ''  t!@@ d ԰ @ڐԐ 'Ԁ rD 6 rԒ :H* @P kr  ?   %! @` "㿘 F @@z   b(@ϐ N 5 N + (, %2%,@J & T   D ",J & T   D `@,`,`N Р $, * : &T ` : &T ` "ɐ? * (:8  &T ` * : 8 &T ` "??ɐ?Б* : 㿘`@|y  `@|r  `@|k  @bP   㿘  X @ 㿘@1 0 㿘'P'T'X P@F| 8+ %as'"a0)t  @"  @ !`  ''''@c7'?-`bh/@[ bx@U  pВ @^ OВb@G  OpВ @^ POЀ @c ?"@Ӕ t@"@ʒt?"a `c 8@!c 8@!c 83o&c Z?     #\! @4 `@ٔ!s!xb@  @  6 2"@    @% "  (`     #\! @ bȐ@!"@*@%u"@@%p?"  `6  @*z"t?@yn"w " @ @yd'tb '@,  6 @*_#Et  '  @T  @*L#c0@!!t$"hc8@"h1u &"`2k@ #@"h"܀ s!xcP@c@ΐ "h ""@|" t@vt?"a '?c!@   op#쀢 @*#ho#@k a @]ϐ#x㿘@ p !s!x?`" * " @L @"!x L aP `"Lt"<@ 㿘p#! 'H'L'P'T'X 7$!L3sax@#H#@  ax@Ր#ax#@  axax@Ȑ#ax@DȒax?`" * " @ @ax3ub  @_#t?"a& c@ b@DHb@™#@bj "(@c耠@`?!L ƀ @ 㻐; %aj'bp'D @!$9 @u#    t"!  '@7"h`݀` `@/"h!u"c  4!t@""h!u"c  @@`"!tD  @k"܀ !s!x@,#@K!xt!"a ` >k"܀`4t5 541k"Ԁ ,t!Ѐ  s` !xso!x`@@s!x`? "`` ,`:  @* "@@0  & T `    t*` * ?А"  t!?    t! " d   & T `   2   d`  `) k"o d--  d`("  `- t"! "!t,!t@U"h` `k"܀ 4 !s? 5k"Ԁ !s!x`?"``@* "@@꣐@y!x $8$t"@? t!`"#ٴ 1,j"!( @?t!!a @ !L  #@`"?П@ ?a  @[А H@ t "a 㿘@j !s!xo ""L@ X@#!xt"l@  %sk'!@r 8:?`'T rr  r?? 8 ;`'D'H'L'x  LJ -s!x`@L`s!x`@Ls!D DH@ L %kkb|"Ѐ  ᄒ 't'l'hc8'pt'\@"l /j$ j!( 1 !H @?&!Hl l@ h h@ p Tp@ Trt?" 8J"c0@z 'laD@u 'pH@y`  Hr %8!'|`"c"80aJ@ |( @] H'hc0@#ސ'|| r"@'&l@J h@G p@D t`8 ""`8#'t07H@zc0'|| 4H@' l@+ p@( t L't|@R  <  "sH!x@ْ`l@ p@  |@<tr:@ tl@ p@ h ?h@ ?t"trT"`8@"l m3 aX aX UD@`耢 D@ޒ` JLk"Ѐ  ?| aX@za\ ? ?| aXa\@R ?2 ? ?1 H@&    :XtrT G"8!X !\    >!XtrT 7"`8  >!X'\LD! .l@} p@z hrT`" 8{" l@k p@h hrT`" 8h@^ t ( %t|@" %\@ 'xx @]? @G kb'h`7``@  S"  >`B; ` pxR @] 4&@p#耢 ;r 8 r  3r  ` *s`  sd !sds!x #`?"``@* "@@7 #s!@ :` Br?` @!x|R @>F$ rp#耢 M`r 8 rr  C`r ` <`  8`s!@r  :`  2s ss!x?`"@  #* "@ #s!x?`" * " @Ր s@!x`H@%` 0]p#3   ` 8`  sd /ds!x #`?"``@* "@@矐 #s@t!xs!@p :`#薂 B?`  r 8 rr  rx @;px `?"``@* "@@o r `B : x`? "`` .`:  @* "@@Ur `B : |@` p#耢 Br 8 r  :r  ` s` sd sds!x?`"@  #* "@ #s!x?`" * " @ s@!x| @H@$ x @@t r@$!r??: @ trT`" 8t|@x@ l@ p@ h "rh@ r ` 2O %  K %@f G %l@v p@s hrT`" 8h@j j!( 1 t?."a!H @?&!Hx x@ΐ tt? "a| "rt|@r ` 2  %   %@   %! @Wސ! 㿘@ !s!xo ""L@!0@8!xt"@ s!@'H :r8''Hj''?'Dr??'Dhrr  :  ; 'L'P'Xax'@`?'܀ #k"܀  sH X sHJ -s!x`H@L`s!x`@Ls!D  t܀ tHD@ L0Y'!'䀢 ' ܀@ t'@"̀ +j& j!( ! !H @?$!H䀢 @ 耢 H@ Hr"`8Djt?" "ᔒb@ 'aD@{ X'耢H@{` rHJ |mH@w  [rH@$͒ /@"  @  H@#* 0o2,H H0!!@P   /,rH@#  0R  r@  rH@#! rH@" 0=  @ H@ 'HH 0*   H@ 'HH ܀  k"Ѐ  ’ 0kb|"Ѐ  ܹ L@ r:@  t@ߐ @ܐ t?u"a@"̀ !܀  X X  X\ϐ _L  D!Ĕ  0" 0@ݐ#0' X 2XH@` X %"@j'5"``#HJ | @ 'H @c8' rH"@"U`0`8 ""`8#j"`H@vP' 4H@"? 0 L'X@VR   1c$'1c!8@!c@!<@{ $!<@" !&!8&!8`<  r`8 ""`8j" @G?k"Ѐ "    X X   XR @Q\ @۴ _" ca<R @D@?2 @  & Pr` p >`#B <;` r 8 r  3r  Ȁ *sȀ  s̀ !ss!x #`?"``@* "@@  #s!@ :Ȗ Br? @!xccR a<@:8 p#耢 M`r 8 rr  C`r ` <`  8`s!@r  :`  2s ss!x?`"@  #* "@㷐 #s!x?`" * " @㧐 s@|!x`@ @!.!r??: AH@!! 09H@!05!X!X @ @vu    @? "   @v^  H@  rHjD" 8"`@q` Ԑ 'l` #3   Ȁ 49rȀ  s̀ 0rs!x #`?"``@* "@@% #s@!xs!@p :#薂 B?Ȁ  r 8 rr  rr` B@:` ` ؀ `  @< `?"``@* "@@ `` p`? "`` .`:  @* "@@ʐr `B : @Pn` Ԁ  !s!x@9a!x@h!p#耢 Br 8 r  :r  Ȁ sȀ s̀ ss!x?`"@  #* "@ #s!x?`" * " @o s@D!x @@ @!r??:  @H@ @  rHjD"`8 "@@ @  @ @$l r ` ܀ ` j j@Ɛ j s4 L@mL@ ?h'L@ 'PLPH@'T?]@אL@Rs!xbH@|<rHjD"`8 "@  @ j!(  t?"@ @ 03@1 !Ht?`"!@ѐ &!H쀢   @ "r@r `   @V @h @e 㽠 %ta  ''\ 'H ? ?@?@k@"Hkt tt"  @  @`  "aH@ "U q#  ?c \@  t@"xtb   7 Sk"؀ ,#sa0 '"ta@    s!x @"p# `$a0s!x@"!""ta@    s!x @Ő""ΐ!o"耢  s @H?  Hk""tm$"!x@"! `b@ Dtb  2st! @T  h s!x@#@! l#\#`j"pchptx@| st  @stw*`* k@o*{*@  ( @ 4 , *$ b@g t! @ 2 t s!x@G#f! t"  ?  !tx|Xhl#\#`#d#hj#l"pcTPp@Jt PsT ^sP ZsX Vs  @s w* *`k o*{ * t*b 6.&x|Xhl#\#`#d#hj#l#p#t;x;;;;"p`TPp@t s!x@Ӑ#! T  sP sX s!x@#!   @h*(*+ s* w {*`, @k+`o@(+(@+ @ t(, @$ @6.&$R$b@ ! t!'h@9  c s!x@n"! #\j"p`@`ab@l sO`Oa@ sOb@sOc@s!x@N Pm! t"tb@ n4 @  !o"耢 @"U!  !taH "@c" "  S  H 5'\)t"tb @l +r`( 24 # aH?" @Y  @8   $aH@"H, *%`(`( " ?c \@Ԙ  "@̐ ` !    ! "!H '\aH  \@  ! @ !  '\aH ) \@  ! @ ! !H"@= " q@ ! # !H?c \@   @"x 'L!H"@%L !H@{#! @f  6`(@q `( "@ܔ  `    :k"؀ 3s!0 0 `"'    #\!@   lp#s  "a0s!x@N" @"    9    #\*   !#\#`#d #h #l#p #t #x #| # ## # # ## `(? %`('H(@ H` %`("    '\!H  \@ʘ   @# ! @)!HH?$!Hr "`(  % @O!Pht " % %k'bt`' '!H# aH@̠  @!`@aH?$aH @aHр $aH 'Ȑ  @  6aH@w#aH@M @OD!h㿘@Pr `   @j @@"㿘@ϐ  aL "aL㿘' a$L@j   sD ec "D" @sD ce!@b"Dr %o&@"   @3!`. `!t"$ @! a @ !t"  @}!a @ythu&!<a<k"h&!@a@k"|"&!DaDj#"|&!HaHj("&!LaLr! "(&!PaPt`#! &!TaTq#`&!XaX!t"&!\a\!" @!`!a`@ !j  @ߐ!q  @ےaqs8!s&!a!"8$@ѐ!!a@͔$!p#$@Ȑ%e$@Đ# @ԒL $L 㿘@  !s!x?`" * " @ @!xtdo` t"d##"L"<@ 㿀'D'!'H'L'@!x  !xr  !x 'k"|  1kj!$  t! 2 1k"Ѐ"I "耢 s!x@m!0 r   "s!x@`! t?"a' j!_bp t@#"< ; `X@I '!D!ML @= ̐ 0@Ȑ ǐ !`'9H  ! !P `$!P  @  s!x$!PHa@L0@  "!PD@ax  s!D  !jD@ax  !js!D !( !j!( 2!j 2 !j!H &0!( "s@ s!Dg`?!( 2#!j 2!j!H "!jU !( @Ӑ M t"d t?"a@ 0B!( "s@ s!D7`?!( !t"h R  '7@ϒ  6t@i!t"d t?"a@2  s!D     t"d t?"a@p 㿐t"h R 7' @   a@5t?@"a    㿘@ /  1, !!@G   /,`%h@ < s!x @"04$@ P@ݐPP  .* `&   d,,:   9, 0P@ ,:  02 ?L? . ? 1,?`,??`"ߨ 1h P㻀% %!u"' @ّ"(t"d t?"a@[$   @L+"R  @s  ""@!"bP@ @"t"h R  ' 7V 7'   @ 4 6t@z!t"d t?"a@C    V @0$ 4V  t!"(   @L("`(8L\$x %!b'Dto"#"'H'@f"k  "bJ  #"b kkkjkrs$3k#o%j"a@#b p ""# 8&bt$b@$,t"aks"b"0@9# . L * c@ 2&bt$bc@ 2&bt$bc @ߐ 2$,c(@א $b&bt#0@u  @ɒcX 2j "a,@#hs "a4J !j#x"a4!j!,  s!4J 2@N#$!,@#Ƞ  L c@ c@ @c 2 %  %!@T s "aLk "bܔ XRs@"ax }`|@ Q vr s"`8`Bn!*`   g"a`  c"a`ok""^"btr Z"`<qp `"Q"kN""kK""kH""pr?D"`8kA""#`@4 9 %"s4"axk o""t-"#t("!#J & T    #@e!k$"`@ k  "bxk "bk""@D@AH $#jD* "@r" (Hst  'D'H#a("D@#! @ϵ @M@ @$ "#@  `h@ D HH@  r"`<DyH &<s@Is@x! @Iؐ b @ b(@ H'  'ؐ '`''D@͐ 1k"Ԁ !r   s!xk"@t (@"  k""s@A!`?  b @f b(@b @H 㿘@  s!@@ 㿘@#r@  ` !u" " ! R @ے @x"$"! !H & $`@ђ @!H?$!H$`Ɛ `  !u" " $`R @迒 @\"$"$`t"! @" @㿘 ss!x?`" * " @J {sL dƀ`", s!x@ H!`? "`@{ !  &!耢` v!s@#r`4 P1t!@r? s!x@Ȑ hBs2 L s!x@ 9s  r   !s!x@ +s!r"` €`4q# " L  s!x `?"``@* "@@֐  !D@s!L " oj!s@~!x@!xo# 1 %$@g0!耢  ۋ @4 nb @l b(@h   -    `"J@ KJJ@J`J2  "  " `2J@?㿘or%t# `@qju""#"#`#r$`4 $`4@ @' `4qcjJ@ `䀠!$ u J@ `"#cJ@!fdr" ,J@ "` ?uu`  J@ "r" ,J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " `* `䀣 #cu"    ""r"" , 㿘 T?@%sDs`!x  @C`3 a<1 #* ` D L a<@qa<#*   *@ '@ 0!@? s!x` s!xa@  ?!xa8  @? `㿘   %   aH@"@G`  / %'@g"h  L " @ِ # @E ?"@Խ $p@Gbb@gi  "`P@ "@͒ @bВ! &/@̒ . JH" 0B 4@q :'iX@dt (#oc@dn "c@ . "@dd c@dx$ c$L  @ . @dM  $X@d` L@ 0"!@   i8 Ni@" @ ii@k" X&@@`Xހ @}b  i P@cR   ?@  i@j X&i P@KR   ?@  i@j X&s!D i)i@  P ")i ")i  'ks!x@!#Xì`%j*` * 0 *    ``@ P  & T   ",  ,i@ P is̀0k` ""@ 0*` * ?`"-$̑*`0 * @ * * `"%j* @0 *` #o@ԛ PEs*:  ,L? , b耤io"耤 s!x@#7i#@X`X@?    i@4   i@D"@A# ii@ P s!x@#xis!x@y#i@*"@'"i@ P? @F 㿘!i P T @1 P  ` `,3#i`"`X02.@ P. @ P`"`\.,`X2.@  P. @ P ` ` ` `,퀢`\.L`X   !d` !d@!`X "    㿘@8 2 `(@ҍ & & @- P &`(@҂ 㿘  @2 *@i&  &`(@m  * "  & 㿘  `  @ .` @$` @*@@㿘#r`'H  'Dso!x`8 DhD@ݒHD  sH!x`p@ct?"a!j!, k"t!H !, Hs!4"J `@     !, H`s k"܀ ss!x`@$4 k` $`@A"o"ja @9!r"oa @1"s"<ta @)!r "0'ta  @ k"kk""Ѐ"b|H  @f p#%k ܐ?$%!( "!t` 1t"@  "@  sL? ."? ,s!xa0@Ĕ" 2,!taP"@z  s!D t "aj "a$` s!xah@$!D t"!j"!$`"a@y 2$s!x@!$܁% %'L'`'H't  HLt Ht?"aְ H L - r < 'x !!@B !@=@  'H@@ 2!'H!@_eH@Cڒ! !'L'H 2"/'H@  @@ʢ 2 s!xb@& s!xb @ %/ O@b@?.@O 2'H'HH HI"0`L 2@r"8'LL:"H``t `@b"P'tt*"```st`"` @о"h 27 r < \  s!D  *ob$@# ð t!r 4R@5kr? @ "` ja0"x@ ̲`@   @C"㿘#o@c $ s!x@"as!x@bc  ,@ $ %"@@ab K@f ?L@ ",@ i r 4@$ $t!&@㻐o#/ %ᴤ'`k"䀢 ! jB" ! ? @;$!"䀢 - j ""`"` "" ! @" N "@J? /  $d @|t ?@"а ᴒ@#$?L@ / /,@ $"b@@@" #@ @a1k"ܐ?&"&"'p耦`$s!D`?`#0#8  `#@t!@ d t"&`s!Dv`?cH&"$@b%@/ 2!  s!x@ʐ#P #x&#i!`@`{$ `@!$!@ 2.` @Bb#㻐' %%kp' E#r` 2B !s!xc@b@!x %@`I$ O/   %#8* R  n"$  p a!x y!x!x$p@l#  $`!xc@0 @,c!s  @B  hk"䀢 $ Ȕ ,@, @ 2Ȁ  @ (@>  @e & @λ @2 㿐#p%kc܀ ???$& 8 " t"@ )  @f0J   & T    2$ܰ??"$c쀢 2 $!s!xt@"!x@3 $܁H%p'k-t܀ ?$ @ m`#tbL & T    " LL & T    2 `H@vє  2s!x@q`P  2 0, ,, Ĕ#\#``@㴐bȒ  ,@:?'''?Ēx''''@v ?쀦`s쀢  s!x`@8b$"$쀢 2 $!s!xt@["!x@ $܀?"%㷐# %a'$@;@@Q`Ѐ # @  O @  /2 @@vN 2  N /   a @@ΐ!㿐! !?@$!`w @?? ! `?㿘@ r 8?@ @"`7 %ᴲ'!j @\ ؐ    jaX"j# :А@N r 8 /r 1r5  X@ B `5`-  -`@B2`* @ *`B2*@ *@K  d & d4 d"@?t!Ԣ?․`@@S d@U@Rb""@#\ !0@?$@  4`  <   4  a"@, @-@*aJ@"` "@#\ B#\@?j Ē"@'ؔ" 'А"@''j Ѐ j`@j"쀢" ; jؘؐ  "ؒ@ # 'j ؒ " `'" `'А"@@''#0`ĉBA?ЋD.'@ @@""@@?R.@@""@@?Eؒ.@$t@@"$ <@ <@$d@?+%s  ` #8  `@(@p@m""@@?]%s @`@]""@@>M%sX @b  !@?В. ȅąB'@< @<@9""@@>Ζ.@.@+""@@>ؒ.@#@@"$ <@ <@#@>%sxR @@v `c|@9 @ 0@ x?`" * " @g @=x @>ː# k"+ %a`' a@݂ j ؒ " `'x" `'|А"@@'x'||#x#r` ĉB@?pp# B3? ?  @d  ` `  `   `   "#pr p#\@;` #ȁ B ;h#x##p@ @= d U` ` P ` L p㸁 Dr`@ !X` @ D 49 2@ @b !@{?hp. hąB'@%.@"@#@ d$ <@ <@"@=  s!xR @@va @=#㿘   ,@@4 *t!Ԭ @ْ "  @ I 6C, s!x@  s!x `?"`@* ("@@5 %@,`s!x   ?`"@ * "@ 逤Ĩ 㿐@s!x`hR @?   Pt"!t P"a@p"㿈'''' @ 㿘@E88P8PPPPPPPPPPPPPPPPPPPPPPPPPPP8xʌʜʰʸddddddddddddddddddȀ` "?    $( 񀠠"     怊 ?`       򀊀  H+ %a '@qT"@ }(? @  a `  ` "c  )0q {a0" X` a` a" t` m 'ؐܒ`@$ ؒ @ aܔ @@ ha" H  @   @@ " Raؔ @" H  @`@ڒ, " X` :a`2 4a"$ / , " X` #a` 0` "` X@a @  " H `@  @ [@: a @;  㿐   @`Z   @`e  `!*` # "! "a#  "!  "!@_(@}?ݒ? $#* & @ @N @` \1 &"@ 0&@V " "`H@ @b4@K "H"f H& 2"@ X" @@}  @ x%  " `@o? @  "!@j#@p !b  @v? $ ,b  C, 4 @"b "@  2O!"# %@J "`@zb"`H" f @  b@n`Ѐ`"@t @9א @b@+ !"b`@\@"`H" f @ @M`Ѐ`"@R @9 @  "@y   %"@9`!  @J  ?"a!@  @E!  @:!(@=!X @!`@r?@!x@ i@"b" @ ?@!@p@m@x!@  !" H `@  @ J  @H """!@@Y"@!?2@!@c!Ѐ?2` @!` @?2 @! @{` ?2`@!`@?@"@ "`@""  H@"`͐!@o"b,㿘  ! %b @""@b8@8 㿘 H@  02  @!0@'"` H"`, H@@ H  a@ ! H" 4 H @ "8 H@6"`<㿘 H@;@ H D ", Ha@Ր  H "`! H" 4 H @ @"8㿘!@/ x@+ H   ` ,@"`"p@ @ U $@@ @@l瀤` H`"  H "`0@a܀ ! H" a  H""` H c@   " H   @ @ "  H@"`0  a@h  H "`! H" 4 H&  @0# 8 HD@"",@㿀 (`H ,@ ` @` `H       @,@%@x@L 2`H@ؐ"0z"`!@`H aЀ " @S`H`!"``H ` 6`H#"``H ` ;4`H <"``H  "@5`H`"`2  : "`H  "@%`H` "` 2`@ : @:@" `H ` "``H ` 6`H#"``H ` "``H ` 6`H#"``H `  "` `H ` #"` @㿀 H`< `"`, H@` H`   2 """"`@_`, H`"  H  " H@" H`@" H `@ @  H " H@0 Hc" H"  H@s  H `@N@G H@`" @" H @"`@ 㿘 H@ @ H`D"`, Ha䀤 2  a @(  H"  a@! ! Hb" 4 H   "8 H@c"`h * (`H"0f @   @Ȧ @@   @@@"0@Jh  "  0:07"Lc#tc( #@@Ő@@y0##xc8 (`H"0f @  @Ȧ @@ 2!㿀!؀  (##X`H` `,@ ` @`   @w@p#h@*`H&  &  0 * @ u 2& `H    2  `@  e 2 @m 2!@"0c 2`H 0 $ 0`H`<# @ $ ,@p"p@`H b@?  4@  @[  `H $`H" `H  !4 $`H` 2"`@ 2@"@!& &@ ,0#x@0 #@ǒ0 a@ x@L㿘@(4 @b#~  @'(4 , 0@ "@  8Z$ 4 @@@ 4"*@ @ O, & ` @ !Ѐ "! 2"!J , "!@u A & $1 ( @@`, $* @@ $ 2 ! $@ P@ $& $!Ѐ "! "J l @M & (  h@#0 @@)  @T`l (* 㿀 (`H ,@8 ` 3@` .`H     #  @-@&@ `H @ِ 0@`H"@!@`H "`0㿐 H'4b "@  @0 5 b  0   H`< " H "`< H < 2 H`" H @=  H " @ "< H`<`@  H`<@ @x 2 H * H8  b  "8@ H2 `8@9, $`8 H"f `8@$ H@ H2 f @2`@@$<  $`88 2 H b "8 H "@84@ "@  "8?#  H2 H2 H H!`H"2`0 '@? H`8  @&a H"  'e`@@ H`x 8@w㿀 H@@ !0 H` 2[ H`t H' F! !H@7@0@ H@!h@ `, H@@k" H `@d @ 2% H H   " H@!p`@Œ"@  Hc @"0"@!Ő@ G@ H` 2 H@"`  H" @ 2@ "@" H` "@ H` "`  H" 2 H@! @  H `@  @p H "` Hf "@a( @Ӕ@ax) % H!!'!4"@2 H b   H "`!@0D` 2 H`< 2 H@ ,` @b @/ 2 H H`," < H ,! @'!@L  H@@" H `@ @ !@:  H `@ @ H "`n!8  b  "8@j H2 `8@, $`8 H"f `8@$ H@X H2 f @4  `8@< $`8 H`  !@ `8 "  "`8 H  ??  ! @$?' H C  7//    2?0#42H2H2H'ܠ @@! H'e`@ @ H!a8@ ! @3)"㿐!" ' @ @l" "  H'e`@@] 㷐 / (@ H %@ @ H!$  $@ & @!$ &  ` $@ ` @%`!`$ $@ #%   2 H , "@ , $@ ` H!*!,@ H!,  @"@ H`"% He!+4 !,"e H *`@ H *`A H *`B H@g* C H "D H2 H H2 J H" L H" P H" T H" X H @, \㷐 / (@~ H %@y @!$@  H $  @!$@   $  2  H!`4a $@ $  H ``2 "%` @%`!`$@$  @ 2? H , ?"@ , $ ` H!*!,@1? H!,  @)"p H "% He!+ !,"e H *`@ H *`A H *`B H* C H`,"`D H2 H H`? 8"`L`L`@` H H2 J H " P H" T H" X H @ \㷐 / (@ H %@ @ H!#@ a $ !`4@#@$`!`#@$ m耢 " Hm#a -$! H!,@’!* H!,  @" H`"% He!+4 !,"e H *`@ H  *A H *B H* C H,"D H2 H H2 J H" L H" P H" T H" X H @5 \㿘 $ " (@= (  @7,  4  8@/   , @)㿘#b ! !@QobЀ  $b!@a"%@x@Qb% H  @   "H` @ @xbb@R   @x b@R p2 `0!u# `$#$#`0 5 2! !@QbЀ &!@"@,b`02  @$c @c` @@@c(`(@ c@`$@cX`,cp@ . `4 `8   @ c@  . @ah`!c#\l#` #d "@@aT` cl#\ #`#d "@@aA`cl#\ #`#d "@"@`@w"㿈`'쐆`" @' '@ @'@U @h  @d쀢`@]@u'@V @R"@f㿘#b d H& $&@Ȑ!$&& 2@: @T2 @&"@& 2&@- &" b!`p@Ԑ h``@͐ h h`@Ȕ㷸- %"0`' @@@``< G `@@`<'ؔ @ؒ @#@@ - @@~@`a 2 `( @v @r#@@)   @d@]`@i`(`@b`$`@[  `H&  T `4K-  " `H M  #0K& `F@  # @a`HȔ @`H`8& @@  # @a`H`8@`H& @@@,@  `4 `8  @y!   @ o @   H`  @.ސa(@Ԕ @/&!0㿀`(''耢 '@*'`$  @#'耦 @' D@  @'' ,``4   ``'@dz "b$@Ϥ@ @ޔ(4@ڔ `(@զ @є `$@̢ @Ȕ @Đ@ `8@"@˒㿈@d= "b$ ' '@  @1"@@I "@ `@!P @!h"@Ӕ 㿈@d bHb$  "$'@t' !@쀢  !@` '@!@W@v㿘"  H@df-   @c 2 fJ =2 f "f@X`2 @ 2 $f@f!$f@!$f$f$ff" @3@0@-@ f- "@f  @!  `$``2 " @ @*Nf@ @@@`H@-㿘" H& "$& &@&"&` 2&$& 2 H-2* _* H* 㿘! "    "a"@) ?! @"P! !?@ !@ !@ @)!?$!㿘 4.` 8 @  @`#!.` @h  "X@ @ 2 "@$@  "@ !ā㿘N .  = L .4 .`.`?? & T    !$  & T     _ - _2 _ 2 "@G  2L 㿐  N. & T    2 *:    N " @H@ "  㿘1u#% `@Ԑ#= `  & T@J     @@2 @,h0` " ' $ ` \2 ,@ \,@ `,@`` @* 4,@@Ɛ#81#P#㿐@? @ @}#X@.!Ѐ?2@t!"! #h@̒`!@ܒ !@ْ !@֒ @!@ 7' @?? @n @M#x    @                 P \ h        0    t   T |    DHXhx4<hhhhhh\hhhhhhhhhhhhhhhhhhhhh<hhh|hhhhhhhhhhh㿐"7  H& @ " " <$ "$!" """""(!, $"$$$$ $ $ $ + $  + $  + $ +$ +$  + $  + ᴔ$ @Kc @ ?@-@ ^@r"L`?㿐! @ !!@Kpc @ I? ! @] @ #@@q㿐!" Hf @ />`%|*`!$ @2l0@.?|* hy" @%?s* h o"@ @?i* h e"@ @?_* h ["@ b @ @) 0S"@`0N!!@@ "G$@!@ @!@0<b b b bbbb@ @0$@Db$$@ @0@Ւ 0@ђ 0@.0@ #@@  ;@ #@㿐@ ~ ! @ > .@ @ ) @ `:@ }`: 'a2@ q@   0@$0  P# @ Q @㿐 @ P!!!? ( x  #,  @GR 2 !.@ !@ / ,"ۤ ; 0@  0 @  0 @ @b 㿐@ !" "@m   @  { !@ @C0@ ! 0@ ? }@ 㿐"'@ ߐ {@ А!@ 0@v(4 2 @ !H @(4 0 * .`@$ 0@ ?Y }@e@  `<0V HS"   `  2 @|  2`  H"` ``H $`H/"  H&! 6  @|q    H@ Z!`0  H " H@"`  H"㿐@ R>`L*`! `0 G&`0@ A!3@ 1 0 b@l   b!@ %`@u/b+&`@ΐ /0$`,@Q 0(@%&`(@!&`$@&`@&` @&`@`40@ !@G@  ;@  @=h- %'@ ̠ !  !!?  @ Ӑ!Ȁ ;"?@ ? #, @lJ̀ 2@ !0ؐ# ,* : `2"(*` $@"@ !@̔  $̐@Y @=؀ ؒܠ $@I{@ !" @ t"p ;"?@ ?̔ @  @ l!̔ @ є @ \!̔ @  @ L!!!?2 @ 5" ;"f?@ b?@EKb @EEb ̐ /@E<b @E6b /@ "ۀ ; L@@ a"0$`L@` @`AK?@ L@`A ,"< ; # "b@@ "(0"P@ @ 2?@@ $ @ # @&@ @'#(㿐@   2 @ #@@ 02 ,( ;@!2@@J  @ #`@Ӑ @j$$&@@ڤ ;@  @ Аp' %"' H& ؐ@ # (@  2@ # @* b0 $$ @c ,؀ ;@ Q @   @'v#@ E#@ ᴁ㿐@I @ \#`"3 D`  2*@`@j  2$@`  2 D 6 X . .   @ @` D 2@@! 2`@ 1#`@jr & D@`2` D  @  @@ ,ǐ @HD@K   㿘"(   @, @ 0 ! @ 4 1 "0@ c$"c "@ @4*`" *  * ?)"(   ǀ D   T 2   "@2`2`` 2 @ @@D?@ # @ @\1!@ p@\*!"( `   ǖ D` 4`  `T`2€#  `~"# 8+ % !?a#'@*@}`@_`@`P`@$`P  `L /a`P +@~  $`T @"c @@a1",  '@Ք # @ϐ",a @&% ȁp% % ' @ ?@  ТВ  @ @iF0a@w? `A A`7 a@wz?@ ?@ @  @% p% % ' @O @Ȑ РВ  @Ð @i0a@wE?  ?7 a@w9?@F@B @%!H' % ,ᴢ '  @ @hѐ0a@w  a @J̐ 5 A A21  L 2-   (@p @h0 a6@v @}  a@@J & L` Đ  `    @%L!`㿘b0   "  2 2"b0 c  "c"@  2$ @ !x$ $ 0`$ `  $"0"  4$  2"$0 "2  2  "0" 㿘@S  !@ƒ"($ ""($ $ $㿘#b(  "$b( @c h% % ' @! @ РȒ  (@ @g֐0 a6@v?@ a@@I̐ @ @`    `@   @$n!ȁX' %ᴤ' ` 2@$ @y   @e @D!`Dbl@uɐ "@6 @$8"8 ," 0㿀 'Đ& ,bq@u 6@"H  2 ,@ "h ,! "p@u䀢 6 ,@" ,"y@u䀢 6 ,@" ,bf@u~ @# @o& 8 & 4 8@#  b& <& @ D"`D h ,# ''bg@u] 6 @̐#P "l "<#@''#"< ,bw@uE 6 ,@#x ,bv@u: @#p% %''ܖ@z  #\@' 0 '''@{ఒ @# @##㿀  < @@2  @ , 4@- 8 V  ?$ @$ < @ <"@ 8 4G$ <@ @  <  @ @ 8$ <3` $ < 4@ 6 < <& @  4" $ < ' @  <  $ <"  ' 4@˒@  <  ? $ <   ?$ < " < 4D4444443\4434444443444444444444444444444444434444443284444T/00000000|000|00000000000/00000000000000000000|00000000d㿘  0@( c@u  " &  `@ !Ԁ  `l@  ! `,@ @㿘@i@``c`%@`@ !*`! "#*` $"#ؔ@ ""耢   & $"@ 0G@ pD&  4  0 @v  #@9 @ٔ. 0"@  @vʒ` 2 #@# @@@@@$@.@}$@@ ` @* ` & 㿘@<`?cА@     @`* @@` ` ..@@~@  ݴ .h %a;' ? c'  @  ,c .  [ j .   @+ @?* : `3=ʐ"*` +;  @ ` & T@J   &@  x t+?+` : *?ѐ t+ +?` ` `` @ !0@c .   J @#.  !X@}c` @ @s!쀥@@ #.  &@c!@; @o!#. @f&@I!&  c @ΐ  ?* : `6*`ʐ!  ; "- 7 `  & T@J    @@2 @ Ȩ  " ' $ ` \2 - \-  -  @* "g- "- a-@'@̒@cz$S@@А@ Mi?g$@@* : @* 2 ؐ@ 8T?R$+L   @ #??<$0 !!@c,$0J@!@j@g$`@  : -  @8А - ' c@a"! %! @ *"0`# %`a '@r"H7a (0@ '''В@~ 'Y'̀  " 'Ȁ 蹐 腐 ,   " @{  , a @"p㿘 573p9&@&&bD <"#"b8*p*'"L㿘 ? & @f  &c؀ 2("c؀` 8#@ #p"bD"8 8 "##*ĀPb8*?b8*@Đ "ā 㿘<? & T     - ""H"b4@Ӓ0G? & T     ""H"b4@02""H"b4"*'+ ## ? & T     # "@\ ""H"b4@\㿘cԠ#"H "8""<##"H""4  #cb8"b< #$㿘)#Ԁ  %H'4#$c!$#gH%#cЀ "D""<4$H#$c$4$#̀ #&#ԁ㿘? 㿘  #* %%`@"%#* `\`" %2@x"%#"c*!㿘#,c  Ԑ x  & T   D  c@  "cؐc* %%2@?"Ȱ%#"c*!㿘!,#! -_ & T     @i  "c؀ & T   D "! #* %%2@"%#*"c@ 㿘@@;㿘ϐc!Ȕ "@p  2 㿘!'H'L'P'T'X!@$1!$H@S! a@C9!! ! "@|!!@o a @j  @C%a! ! %a@|"@eB"@\ 㿘!'H'L'P'T'X!@o$1$H!@Sq! a@C! !  @|Ȑ!!@9 a @4  㿘!'H'L'P'T'X!@G$1$H!@SI! a@B۔! !  @|!!@ a @   㿘!'H'L'P'T'X!@$1$H!@S!! a@B! !  @|x!!@ a @  㿘@l" %`N m`@Vѐ@? :&@(. *` 2ݑ: .h%'H'L'P'T'Xʒ$"@#bH!ؒ$@Ɛ!!H$@R! !@BT1"< @BO!bH P4  "4 A"a@BB  ! '@| "  @@!㿘@^T^^^^^^^^\^^d^^p^X %! `'J -'Hê  "P@Yna       %bP %!/ $;795À * p@€a   `bP  @  @H@!(??@@  @OY Ôa0@8 @}kÒa8@ .@.  bP@@F a@bP Ða  @;  "HÒ!h@:  Ða8 @: "Òx@: ÐaÒ@Q᠀` @e @_ ?2 Òa@a @gՐ  @gҐ !@ߒ ?T?@r?N ?!@}!?@ᖐ!@f?2!@᎐!ؐ!@j ?2 @ᄐ! @ @@  $@~@^C Ĕ`'Ē @ܐ Öᐘ !a@!@hO @o  2 ?2  ?@?@ ? @6`@Fa$ @u `@@u  @u,  ?@ے ? @` 0@@| @Ȓ ?8!@U 㿘"P `"pÖ!@ %ÒbX@s"@b 㿘@ %!  $'"c"#'|)'à|#ä / o#x@\@P@Uc? ?* & @ @A@`@S' |`c@s ?`' ''|@ "@ۚ " - "0 "0   ( P@ۅ@MĘ` @Ж@ 㿘 %Ē`@sy"@ 㿐@8O ' @. @ `@o㿐 ! ~@[ آ "L@ " n L` o `@W] = ", `"@1 2  . @ @ @`!!Ē`@f  2 &*@ &" a@N  "&&@ @5 # 2&@@`"2 &@Ēa8@+ &@ 㿘@ E㿘"`{ " "  "bx  @"   b|  @3=" 6 @T R!P' P  =% # b  $b" L@oM 2b@T @ !hb? $b! "  @ " 3 @N / $P?$L $b! "  @ " @9 "| L@協  "@T^ Đ!x@ ð 0 >  BL="+L㿘@n   @TF @ !hH N 2 #&+!+bx '| @4  6|@T' !P@ߥ!: <"%bx| @y !??:"@T Đ!@ s @n0 "<`@ $`" <B<" 㿘!@0 &"` "& `"$ 㿘"`@  ``@ @  @@@ `@@ 3!?㿘 b !X  )"bc : A! T!X`"T@#!X7b"d "T /#!XT!X "T@#!X%b:! T!X "T@#!Xb "` "aT  #!X  `@"X"Tb? #b1 "  @ " !T@0 !T㿘! "#"ĒaȔ @Uu!`@q!`? @[2a "b|?@{@SA!`@ !? 㿘1"| "@X   @S,!`@ " ?&"|@ެ!`  :""bx 㿘"| @X{ @ޘ!`@z㿘 %c!@ڞ   "`""`"`*  $* !t!t((  #!t    * rrrrrss$s8sLs`sssssssstsssssssssssssssssssssssssssssssstsssss؝㿘  #""+##*`*`*`*`*`*`*` @r6,@  㿘# ! a!@#@$a$!! a# `$aİ?㿘# aĔ ! #@a $!$a!  a#*@`$a ?㿘# aĀ  ! # @F$!$a!  a#@<  ?㿈 %!'@"N @z  @o@  ?  a @"(㿘 @@Jp@ p?Ѐ6QۄP(K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?㾘N@ 0}N` x X25N@` N@@ '%đ*` : , ?$@ 8 N@ @ *`  `,   "@` *  ` .  B  0AN` b B;` N@@ '%đ*` X: , ?$@ FP N@ @ *` ? `,   ?"@` ,     *` . ,  $㠒@U 㿘#` !     ` 2``$  . `$ @  "h㿘`0 !#   .``$` ?@Ô ؐ"x#,# ( (  (  ( ( ( %( "@nKc. !#  .``$` ?@玔 "x  @v㿈 %!'  @Ȗ J  / / / / /  / ?//@^ s"x㈔   . $ ** * * * * * * @j2  N  K"?@]A" ? ?9"ذ?a @%"㿘#cJ  @#9?@J cJ@`$c@!\##c# )G #䀢 `    @\ `?c@ݐ c@ 㿐  c@R*c @ ?#0Đ#P@E?0Ħ#(@ 1/+ `"  @0  %!# ?4 @'c̐@J?` 2 &?΀ @Qc { @QܒcH bO@ ) "  = # b $b% " @j3 2b@O{ @#hb? $b! "  @ " C?@4 ??%"?$ $b! "  @ " "@ b@l̔b"cL  @R & @ a &  @ #  #J`@ U 㿘c%   9#1 "`&"c@iœ,  2"@O  @s#h"? &"! "  @ "  ?@Ɛ ?$?$c &"! "  @| " @ 㤰 c* "  $㤁㿘. 6%3;cc㴵. c cc  ! c ! (#  # "#(@##㬀@ *``"㬁㿘! "#`c$"""##@h#c"$c? $"! "  @ " @) 㿘N !Ēcx@  @\@-,cx 2@NC#@. 6N'? ! @q   "@S   @N(Đ#@?0"`## %"@l`&㿘Ic @ #`? b  `  ##"W" Rb`&b b? K&b1 "  @q " z?@ v?`$`` @) b? +&b1 "  @Q " Z?@ V?? $3 b  @= b "@r @C 3  :?    %#@qb㼀  䀢    %#@qb䀢 㼀  "    %"%b`&  " 㿘 +O- ic  ?/# b  $b㸀" @g 2b@MA @#b? $b! "  @Ő " ?@ ?%c?%㸀 $b! "  @ " @ 㸓,*` "c " ? & @R  &  @ c  = # b $b/" @g 2b@Lܐ @B#b? 4$b! "  @` " B?@ >?%c?%㸀 $b! "  @K "  @  2 #*@ @ @L @  ? /㸐 *@ " *䀢`#` ?㿘N !Œ`@; @@+\`2@Ls @1 6N*? ! @Ԡ   "@QĐ   @LWŐ 8@?0"`## %"@jB&  㿘u b  `'@&-+) V 쀦@ `c䀢 # *@ @ 6@?`@─   " 㿘"  ! #"  N@`  N@@\d` @K @J`X?" 㿘#ܤJ ܦ"@˒  &ܐ?& bL >+ # b  $b"bH@fc 2b@K @#b? I$b! "  @/ " Ұ @d ΰ %L?%bH $b! "  @ " @O ܔbH@hbH @`* 5Ŧ?@ `*?@ &  #̬@ J L@Őp  ?%   $bH"" @e 2@KC @#? $! "  @ǐ " j @ f %L?%bH $! "  @ " "bH@ bH@h`bH@ bHL  < # b $b" bH@e 2b@J @\#b? $b! "  @z "  @  %L?%bH $b! "  @e " bH@ bH*&bH㿘) %!  3/? %@Pz!  %!耤X' >+! "  c̀$"" @eO 2"@J @#"? G$"1 "  @ " K?@P G?$?%c̀ $"1 "  @ " c@; c̓,`*` "c䀤` 2` c&`*@c̰! @ ?@JQ @  %ܐ ?6 ?6 +c*c̰%܁㿘 @V  ! %Ũ Ȥ'ŀ  #Ȣ`@ @nM"@ "@ ^*`: \"@`?"`` "@@{ "@` \?"``"@* $"@@g \N``Ŵ @K "@"@?M "`  "@]* @I ^"@2  0`"@  "@* $"@ @0 "@ 82  0`"@  "@* $"@ @ "@  0`"@  "@* $"@ @ ``N?"`` "@* $"@@ J "@`?"`"@ * $"@@ڐ  ``````HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH(HHHHHHHH,HHHHHHHHHHH,HHHHHHHHHH,hH\0,H㿘  0@J!'('D'H@f!XH"`@fz   H J r`? ""1-'%  ! ) %+ "$ x p"0 0 %+ $"H"c@fU@Ð H!`D@?• s $H*@'HD" 'DD`HJ@-D  `"""H 'HD'D@O !  $" @P   <      @P @  %$"@ϱ"@@ @OȐ b,@Y: `@@Y6  @Y3 `@Y/ @X h   %!h@l bW!pM %  ""D+HJ@%H@@ H |   "` ) %HJ@!# %H "@Iݔ  %D  %b@k!H@J2 ! "` %  %"@# 3 %! 5/+ )%';9ŀ  b ba@e 0 @k@Mѐ ?'Ȁ  "`b@k֐!b 2 b !ؐ @e[ 0D  ?&> #̒ J  ! ? ?5 @T"#ఒ ?@c & ? `@ ?" b??b0%$b  b&@kQ!b b  b !ࠐb@e  00 aؐb@e 0 b@k3b`o b !ࠐb@d 0ܐ b 㿘"c"#"   # #&#$$#J`,`; #Ԑ`;##$`@ #Ԁ 4  &## #$Ѐ ?㿘  #J@ `$ccJ? &`T   ` cccJ?`U!4*` €cܐ $cܔ & TJ@ `$cJ?   ` cJ? &`T   ` cܒc@&  @$Ő<#@y! - ^2x v& ? &`T   ` ` - ^2 b?Ycܒc@&ϔ  $Ő<#RL!Gc܀ . 4$cG?@@ / @`? 9cJ@z `w$c܀+cܐ`$cJ``@$cܰ k (?c܀ ;Ԓ` $c" "c#c܀ ?#쀢@ Ő"N?C 㿘   !J@ `$##J? &`T   ` ##J `p%$#"*` € J`n" `p`l   2  $# $# $#ܰ #J ` $#" #`@@ cꀢ ` @  J`n" `p`l   2  $# $# $#ܰ #J ` $#ɐ" #`2@c@ b &?@  ?` @  J`n" `p`l   2  $# $# $#ܰ #J ` $#" #`2@lc@  zc   2q$0o#Ȁ` "`"g?#Ԁ`]"8#J? &`T   ` L"P@ I J`n" `p`l   2  $# $# $#ܰ #J ` $##" #@ Đ  &?@s &?H 6L@?  ! "@F L@  @ J"`"p "- &?@?  "!""a#Ԁ`ސ"8#J? &`T   ` ͐"P@' "˰?L@ ! "J`n" `p`l   2  $# $# $#ܰ #J ` $#" L@ ! "@FH @ 5"@x0#`"#@  g G  xG V` `& J`n" `p`l   2  $# $# $#ܰ #J ` $#I" `%6 #Ԁ`:"8 J`n" `p`l   2  $# $# $#ܰ #J ` 8$#" #Ԁ`"8 J`n" `p`l   2  $# $# $#ܰ #J ` $#"   " " J`0 `0 %Ő"@afa0#`ϐ" J`n" `p`l   2  $# $# $#ܰ #J ` $#" #`c@c@? `@   J`n" `p`l   2  $# $# $#ܰ #J ` $#s" #`@X#c h@ V #J c $#U" J`n" `p`l   2  $# $# $#ܰ #J ` $#0" c@ S `@+ % J`n" `p`l   2  $# $# $#ܰ #J ` $#" c@    ?`@ )#Ъ# #Ԁ`c`#쀢@6%#֐" %c ̐"ؔ J`n" `p`l   2  $# $# $#ܰ #J ` $#" #`@@ @ `@  J`n" `p`l   2  $# $# $#ܰ #J ` $#q" c@ e  k i?`@g a J`n" `p`l   2  $# $# $#ܰ #J ` $#;" c@ /  5 3?#Ԁ`)"8 J`n" `p`l   2  $# $# $#ܰ #J ` $#" `  `# 2" # "#Ԁ`"8 J`n"  `p`l 2 $#܀#J ` $#ϐ" #Ȁ`Ͱ? "`Ȁq0#J? &`T   ` 2"P#Ԁ`#"c@  J`n" `p`l   2  $# $# $#ܰ #J ` $#" #` @g J""` L@ ! @C! L@  @L" c"p"# &[?Y#쀢 U R"c#') # -J` >#J`g" `p` "0+`9*`0&`r 0$# $# $#@!C  @@c%#%#Ԑ ?$cŀ#܀  #̀`2"𐌠 "##J@   J` 2 #" `̦ ""#@  #✐? $! "  @  " а?@ + ̰?@  @@Z#  "c%#✐? $# b  @ Ր b @   #  c@ ]cЀ &?#`c cА ?$ccА $cЀcА  ?$c% J@ n" p l `2 `В` ` ` "$#܀`@m g J`n" `p`l   2  $# $# $#ܰ #J ` $#A"   @' #c@ ) `@5 /)##c (#Ԁ` c`#쀢@6%#"$c J`n" `p`l   2  $# $# $#ܰ #J ` $#" #`@@#ۀ #Ԁ`ߐ"8 J`n" `p`l   2  $# $# $#ܰ #J ` $#" @ #J`q`Q2J $#ܰ?#J? &`T   ` "P@ #Ԁ` %쀢 "#"c@  &? J`n" `p`l   2  $# $# $#ܰ #J ` $#^"  J""` L@ ! @A L@  @L" F"p"W#0#8# cA 3쀢/"##Ȁ`+ "`'`q%#?#Ԁ`"8 J`n" `p`l   2  $# $# $#ܰ #J ` $#" O "b  "@` # ?ϐ #ܐ @  @<#@  ː! "#ϰ?"#Ĕ J`n" `p`l   2  $# $# $#ܰ #J ` $#" # #c@&Ē@  ? J`n" `p`l   2  $# $# $#ܰ #J ` $#l" #Ԁ`##@#@0a#Ԁ`X"8@S U J`n" `p`l   2  $# $# $#ܰ #J ` $#/" !#Ő!@ޒ`#@wz  b "@Ԑ#H0  "@` c @  ?#P" Ő"?㿘#Ԁ`"#"c#c 4 ŀ #쀢  "?㿘 3?1?%)`  ?,찒 `鑐脢 #䀢 ` Y   @  `ڀ`#`?㿐#J@ A & TJ@ `$cJ?   ` cJ`  !: $cJ@ !`@r$c܀ ' !#Ő!@!`c#؀ Ő#p][ ' ܀ 9% 1 ""`&"@W 2"@< F#"? &"! "  @d " 6 @ 2 $ܐ?$؀ &"! "  @O " c@ c'J@  # @cؒ`* '##J@ #*@@؀  ؁㿐 "`'#  `"c?  c  =- %   $" @W" 2@ " N?@s J?ܐЀ ՐҐΐː@ $@" "@ $$$" "#`b@陒b? "Ȁ %b! "  @ "  @*  㿘!#䏦 #c "@ ` U" S`& "@N` E1 )"`@$&" ";$ @ "? &"! "  @ " )?@ %?" ?%#Ȁ &"! "  @ " @ΐ  2  ` 㿘%  $ @B )? $! "  @j " 9?@ 5?#`@  ?#`##&@?$" $` %#"##Ȁ`$! "  @6 "  @k  㿘 "$?#`@  @" #⯐ `$` @ &?@@ 㿘 &`T`  ` `Ő#?* ` 2"c "c" 㿘? &`T   ` ` ?`*T@ #а?#   # "#``$ 㿘@Qs     ":@7 m# 㿘"  N \2 `?㿘'  9) ! ""`$"#@Q 2"@6ސ D#"? $"! "  @b " . @ * $?%#쀢 $"! "  @M "  @  N`\  `* #* #㿘@ "`  ⨔? * @"@@"㿘@z "`  ⨔? * @"@B@i"㾐 %! '  K  ⨒? #c* * %"1Ő# #8͔  ! @T=    @8aŒc @.c#8 鱔 @H/ 㿘 "` @H' ?⨒ *@* "⨐ h@G??㿐@?  **@"`h @Fz  ` "#` "#@"㿘 "`" N ! ƒ`@80 @8 /  Q# 㿘J@  2  `"J`   ! !X :!X3 05!X@5  . !X  #`@  @P   $!X@5 Ɛ H 0 "c!X@Δ !X !X 0@^!'!X@P' $!X㿘#ܪL@! ` "c#Ƒ* :  [ \  L@p   _`XL Y L@ ` * c) $!` =' # b  $b" \@P  2b@5S 칐 Hb? 5$b! "  א " 2   . %!`?$\ $b# b   b c cܔ@R\\*@#䀢 %c\Ɛ x \   J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&#cJ c" 5 @7 c0?J` @ (&cܐ $cc @ϐ  @C  @<#@$&@ &@ ?*:  g2 `$cܒ & 㿘cܪ "cJ % J*: @c! `%c  %ccܓ*J :` %y) ` 7 ! " $"" @O 2"@4W 뽐 "? $"1 " { ې v"% ?$ $"1 "  ̐ "   * *:`$܀` `J `\'c **@: $܀ `#`c %!! ?6 F " #̐J?` 2 &L cܕ=J@   ` # b   $b" @My 2b@2 ' b? $b! "  E " ?z ?%`?% $b! "  0 " e 䀢 $ ߞ  @P  @Ȓ R$?` < # b $b"  @M# 2b@2k ѐ b? $b! "   " ?$ ?%`?% $b! "  ڐ "  䀢  H  @O$ L ?"`  < # b $b"  @L͒ 2b@2 { b? 0$b! "   " C?ΐ ??%`?% $b! "   "      $@2 䀏`H ?䀢    @OP  !@*@! @*`  㿘 ` -+/M &A \` `" , %  `$" @LN  @1 ?$%?%` $! "   " @K @ ਢ`*@ M M 0H 94G?Ѐ4C* @  "@@ + %  b$" `@L  @1I 谐?u$%?%` $! "  ɐ " @ @< ਢ`*@3  )# b  $b"`@KŒ b@1  8%?%` $b! "   " `Ɛ `  *@  `% & # b $b" `@K b@0א Ɛ <b?$b 2'?! "  Y " ? ?%?%` $b! "  D " `y `*㿘% # a! 쀢  !d*@  *`@KI$a薒 $!*` * "Ɛ*!@ *` "ܽ*!@ *` &  $@0v ܐ!@˰ @K!$!$a㿈  ` 쀢?  a? ! ? a쀢   "c܆  b ! "bH (!@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?†!2  : * !(@2*`8:@ @('`'`*'  #@ #` #`# # # #`G!?%%!%c$ $1 "  D "  y  㿘 a ??!"a) a* @*`!@ @ ``@ _@@J@??$  #$ "a"!㿘@/,<P\l㾰ƒa0@& "`'   /#!+ %';%7 '+ *&* @€ '   '  '   %Ȑ $`$ Ԓa@6R`$  $`̐ $ '`@@8?Ґ? $* & @ @`܀  Ȁ  ƒaH@^3  ƀ a ƒa@^'  Ȁ  2  @i?"`@ @"ا. @ b@0$#(ƒaȔ@^  @L&⠐ .  *&,`$ &@@F? @`?ƒa@zT <  -  ?@?% `܀ 2 @Ȁ  @ @ @@i. <  2  Ȁ  `܀ " @&@㿘@ / 2N  2  N /"?* N /2? (@Ī   @y -<3/7ƀ "    0   @&@y! ;) V8 2 "$Ʀ" @0<b " J$`/"L? / /,  b$#  ,Ɛ"@y” а  @j/$,"@s?:  H& 2@  `" @@. 2  "@@@0 @2"@@y"@`  @ 0<    2 @Ɛ"h@yj"x @ @   @S @(@"@?X0@LR @S`?Q Ȁ 2 ܀`2 @y6"@c @   "@Sa 7ƒa"@x  .@/ " a@x  @ @y`? Ȁ   @M`? @% -@x0  @3@ 2 @ߐ 2:@`ƒb@x @:  " @:  `??(` @@ 2`@`@ߐ" ` -  ̀``@N`2G ̀`2B Ԁ`9 %ƒbؐ"@J % a`? "`@2l a  $a ? %!`? &`@2Xa  $a耢` 2` y Y@Tr $  &@@?2Ɛ"@~'  )Ɛ@@ @y̔@"Ѐ"@f ` `@^"а  @TĐ@T 06 `@ 2# , @ @d^ @ 8 o@ Ɛ"@+ @T@T Ɛ"@  㻐 %! ' @L*#?` ", 3 @b Ɛ" bb@Tѐ Ɛ#@  a ` @ @a @꼐#㿘` 3 @Vb  " @b Ɛ#(@͒b   ` @( 㿘` 3 @4b  " b@A  Ɛ#8@b   ` @ 㿘 ! /& $  $ @Tt#$  (#$  ,@Tm $` @P"  Ɛ#H@}b `  @   `0 b@_  `@S`Ɛ#X@bb   1& ` @ 0 @Րb Ɛ#X@Mb @4` " L@  0 L@Q%b @"`- L Ɛ#h@-b 㿘 !  @S"   @ `Ɛ#x@" 㿘! # % ƒc@Hb Ɛb@Hc@e 㿘@TLL(L(LL00Pl8Xx   %?a#ؐ?'"a ' J g  ' ` Ǵ ?#!ǒ`p@,$!$ 2!$  "$!$J@ u ?J` n?!$` '$!$?#@,`x  @,` "ǒ`@Y @,t !?#ǐ @G'#؀ '@#''ǔ `@@'  !"@ ?# #,`"@ǒ`@Yx !?#ܔ  @?ఠ#' `??#@,`"``` `E#*` Ǵ @,' }?@u y#!?#c@  J@ lca@Y8 d a$ _"a$a Z"aǴ @+ R !,`a$ "#!,E#a$ A"a >"! #$@+#6 ǒa0@Y ?."a ?##c'J . ./' " c@+Ô" c'$` ","$a   "a a "a@ @ ǔЖ`@ ?k? $#*  @ ?# " ǐ!H&@&`` ! ǀ aP@X !  @ /,@ ǒa@X a ?!$"a  @    @t  ?"` \"("*` ! ǐ!@u @7 0  <L -2 L  2  (ǐ "(`QaА N"@ .?#؀`' @+= ǔؐ$@熘# @@̐  < @  &@!H ǐ!@t @<  ( #! """!#a$ `!(  `@ Ґ"`23#! ǒb@@*Ô$(#a$ @ǔ$ 2#! ^ǐ"H@trUǔؐ$@#ǐ"h@taD#a !( !   %ǐ"b@Fc!$ "" @@   ! , !( @ː  a  ǐ"@G0 " @ 2 :!   @{ @撐㿘@t" 㿐@˵    `   @2     2  ?c!(; %a'`  @H @;   5! %ǐ"@>?  @/ !  " ?! ǐ"@s@P9?#/ ǒc   -! ǐ"@@P   O @)$"!!, A?! #?@G %c` @% ch< @ `?  &@: @Oɰ &@;x `?! ǐ"@g     ?#  ?@t?! ǐ"@C  "? c! @ @@# ǐ!@r@  " ?c       ! ǐ"@r   !  ?# " ' (' ' $' ,% @K @OU    ! ǐ"@ܒ  % ! ?#   (' @ ! ?# # #@ a@*a @倐#0㿈 \! X!, T!( " @W 8@ a@P0E &@ "@j "ǐ#@@x 3&@ڐ ǐ#P@lL` @ ǐ#`@`! # $@O:''(#,@O4''@F耢 ǐ#p@G㿘 %"@-T  1 c@D&?P`? "`@+ ?P  $?P ? y %`? "`@+ϐ   "耢`  % y`?㿘Jc !cL@@  '   , @(#   ?,  , `L@ 2L@ 㿘֐  @'$@ ǒc@' ǒ a r.  . c@' 2.? r. 㿀!!  ! & ! %ǐ#@I͒b@@Z<#!  X$!! $@ J *  0*@ @ d @3B B  @23? @3 ,4 4@3 @#`Ȓ (?@x#\%'@ B B@C ;<.<! )`'  % H@Ibb@ `d@ @3cD  B@3\?ȅ h'#\@9㿐!,  % @I3b0/!( 2@36f B@3/? %Ȑ"`?@B@!$D   %Ȑ"@Bђ`㿘   %`@Bǐ"@5㿘 `"d N@ r w N`  !@ "P  @8& `  L& P&  & 0& 4& 8& & & & && H @5  T& @*` X:  w.ȔH ?@< @  L@?$ & @w& "N w&@   @  @   @  㿘  2? ,  XN w r?`@z ``L`T&@ `P&` &` >` >` @L@L@>㿐?#@?* @ .`@2@ 6`@'@q  ? 㿘 H ? 2 @ L"@ǘ $  $ H ?$   ?$ @`$ 㿘ݐ ڐ * Ր * А* 㿘  ƐȒa@ @ p   e`bҐ`P`L&  `&* `&`P  & ??`?`` c@.@`~`P  & `2.@``l`P  & `"  H][`P  &  H  @T? O"p !@!@! % ` !/'/ဦ`///666///瀦/䀦 2/  / P  /'&` ''@A @&'܀`  @:0? ?! @!P㿘`H$` \$`Z!` `@`L"@@ƕ $`  $`H$``@F  6 'T`@@" $@`@ @  `$ P@ "+?@ `$@   $`H@7  @X $@  !`H  T` 2` ! T`@@D" `$@&㿘?4`c @@c@@ ? @ ? `  ?@@`?c@? @@pc* @!G?"P![@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@ϲ`!?@.#@*#a L(7@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@β`" !?@@`!?@ݒ#@ْ#. @㿘?!? @0*#   @H@Ò##6`6 ? @#  @& & 8& #…8& 8& .  %    Ȅ`    (``    00*```   0 㿘 " 1!㿘` ` " G8@ * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6 @`"8@ * a@`6 @8`  `2`` 㿘  $ 㾘:;n # '  *`$``*xݐ`ʐ.6 > ː`.6 > ޒ<J0J0J0J0J0J0J0J0==>H>T??@ @hCDFFGH`II8J0J J(JJ0 ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8*" <" 8 㿘 N 12:?@ 5?2 (1? $ ",$ ($ 0 , 2 ("l$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 ʆpap  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4<  ( 2   $ * $ ($ 0$ ,  (&@@    4@=U"@  (#$ 0 0" @8 4  @=G"@@   4@=@"@ ($ 0 0 ( $ 0$ 0 , (@@$ , 㿈  $`"Ӱ?  "ϰ? 2@  2ǰ?@ 2  $@   `8`< @`g *` `  $@"\&  @?*` * 4 @l  :ʐ  6ʧ4 `$  . * $`   $`& 8  $@ ¤ ",&  @?*` ?c4 4*`  , $`& 8   $@`   & & & &$`<$`8P   $`& 8 $@`"& `  $4 $@"&  @?*` $`4       4    "&  $@4^ $ 4 "&  @?*`?c4  $`@   $@`@ 88 @<:`@%"$`@@&@*"&  @?*`  a$``4  $`d4  $`\4ak򀢠h $@$`h`h`\@0 "o&  @?*` `hʓ*! `p*  2$`h4`\ `he0ʓ*! * `p2@ $`he0 $`L$`T$`l `p `l`T@Қb  &"ʐ"&  $@ $@$`h "(&  @?*``T * ?`L * @@7`@7 񀤀  "&  @?* `$4`h* `p2@  c$`h   "&  @?*`` $4`h ?* `p @ 4/! `"&  @?*`` $4  4"&  @?*`` $4  4`h```d@ n??" ```h`p* 2  ??$`h```d`h *o`T@ "@e0 $`L$`T$`l`lb`` `p`T@ i`` `l*``p$`P$`X`d@  @`X Xʐ  $@ "b&  @?*``T * ?`L * @@7`@7 * (7 7ꀥ ">&  @?*` *@ 2@  `L* @@7`7$ 4 $4$`@   $@ @ $@2ʐ  $`H$@`H` :`H "&  @?* ``H *@`@  $`@4$  $@ "&  @?*``X * ?`P * @@7`@7 (7 7ꀥ "&  @?*` *@ 2@  `P* @@7`7$ 4 $4 @ $`D $`H$@`H` :`H "&  @?* ``H *@`D  $`D4$`,`D"@i $@`u%`D"`0 `4`($ ""@`@8`@&8`@&@"$`@ @?.``@ 2@ $@`H  `C.$@ײ` 68  ":&  @?*` %@B > `$``&$`& 8?c4 4 *` ,` ʐ"&  $@   $@ ?M?& & && $`8$`<`(  @ 8     $@3?  ' %  B@B > > ``` $` `M"@$`& 8` `<@@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?   .?      ?   $? ( @ 4@9"@  ( $ , 4 "@8$ , $   " ? $ " ? "?" "`0   0    ( @#㿐 N?`$ 2`0H 2 < B?   < 8 " * %% 8% < ;*  8  <2`?% 8 % < % h h@ h```@ @B "  %`%@=` h ?` `z  =`=`  % "? $ 2 ?   <`?㿘 `"\?`$ "X?`("T?`, 2`0N? 0  2 4E?   $ * `( `0  `0`,€?01@84 @3 @8/a0 L%0@ a,@zА" ?%0@$`L P:А" ?%0@$`P l:А" ?%0@$`l $ * 4@8 $`4& $ P .ж6 @ Ѕ(`@`(@ 6  +`"@ 8 `Є @ // 70 0$00$%  +"@*  .@( S(.K`2?7  .@1  @(`@((6 12`@ (`ʒ    ʒP⎒}!̖ ? (?    ?%(` ?(` &/7 /(/@7 `/7 ((&1(70 ( 6 26  ?  .( 6 8 @(@( @" "&@+  (. @  ( 4` (%< ,`(('80//7 #   /1(7 (06 26  ? ވ + $% ˁ    ʄP(㿘@@H @@C@3y 㿘@3㿘@B\<]]\p]\\]]\]\\XdYYYXpYYYX|YXYYYYYXYYYYYYYYYYYYYXXXYYYYYYXYYXXXXYXXx˒`@  `J o`?#a4J g`?"耢 a0@G_  8a'耢 9@ @?А &@"@  @ ""@`˒aH@c J`"'˒aH@G/ 3 @EG '˒aH@G# ' a4  @@ :  @@ .  @@  @, @@ @@`@   @ce ? :* @€܀ a8@ a8 *00r  @a` @ck0a8 c0  ` @ @cY0U0 Ra8 O`M0   @L "L @L "L @ L@=J 4/ a8  @@DN@  ؀ " a8 0 `  @?-  0 @Kp  ؀` @.h @ 2v :@`˒ap@bА @|㿐N "?@[!     ?@􀢠 `?a@F=  㿐N ?@L     ?@š􀢠" ˒a@F 㿘!8 !0`  !˖! %"@4a0!4 `"˖"(@ %ː"@4a@ 㿘@ 㿘@ b `   "  (`*  :``J "   2 㽐 %L0!'"$ː"@A  B 6+ B+ 3` @; 2* @ * < `4@=u@A   = b<9 $ @@ "(  @3$(@  @>   @3", - @ 2         @"㿘 $4@=  @  a8  4  4  (/  6+ @}@ 2$  `˒b@'d @" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  ˒b@' @`@ 6  ,`  @"". `*41 2. 2 `)   `` ```  `J@/`  &J@J@`?㿘@㻈 %!'˒@"@t@*"ȴ$@%` @ ː"@a@_@!ٰ <  ""ː"@aː"@ޒa @Ӵ"㿘 @8.`T >`  @ Lːc@ 0F |   <  2"" #@#@  ,`T : ˔"@@# cԀ  J#%`cԀ 6 c@"@#8cԀ @#PcԀ 2  @!#`  "@t4 㾈 %! ('@2\ , /`  `    " 67 4   $#쀢`4 #0 , ,  ,  ,@1 a @#h㿘 (   ,@%  # `$#0 , ,  X %!  ???????'@u<  `?`"""@#p@]cԀ  J#%`#    #Ԁ 2 @ #  @#`| G @= ! !c#  ''/'@ -$|@͐##Ԁ 2 @ ː# ! # @  $|#@Ґ   #Ԁ @# ||@ #Ԁ $|@"| U#@|< @@ 3@ @  (  # |@  $|( 8 #@   8@e#.c`\ /','`*`:``\2@| `|J ̐ h@N P@8|@j  ̐ @= @W < \.  `?22 !|@8  |@I@|  @4 |`\*  `2 @ ̒@) `\.`  2 #Ԁ  @"Ȱ  @Ր `  ? ??Ȓa?/'Đ'''???@H'@P %!' E A`?@=  ????ؖ ???/'''''@!`  B*2 @2 2* @ * @>`@Ò  $@#@@  @ a @b 㽐 %`  !' @  P ` 4Ӱ -` (@  ˦  @"ǰ @" 8 `+`$$ 0  ; B> `  0 h: @& h` P*@  :`    @    `0   e<eD `L @@> ` 2r.``"@/ @/0` c.``@/"``0 % @/~  "`0`   ,`` .`  `P*@ :`        `0   e<eD `L  @ ` 2.` `c@/G ̐!@ג#Ԁ`"@!  @А!0  @,` .`  $$  0  :`@ c > 0 h:` " & h@"8 ! @v!8㿘 @]#`"  # #8&` &@@` `4@ ( 3@. ``4@ # c@.ݔ b`4 @  . @S4   3 \  @2+ `` @? @ː  @@``" "  *``J@   \.  ,2  \@  2@ @  @4 㿘@ @2 @㿘 ` @:  ?$, @ 0?,@:  #,㿘! T ?"@ʐ$ T %!@' 2&@&`$ <>` ('7  e( :`֖ ` Ѐ`h h ɰ @` ̖b> @Ɛ!@"`x h @. `0p?  ;`; @ #@ @ [  5/̢2  t<@ :@L@ B 8T @ @ &`  8&`@`(N`0 23``&0`` @!F$@]@lᨠ 2"`@` 0@7r<: > @g@B"`x` &``@  N`@    8 &`  05̑*` * p:  @ :`c /@  &`@6 " 'N`0 2 ` @ $@@ᨨ L   `t @P;  d Ъ` ! @!؁㷈 %!M`0'  `@ 2` % `@`  !   0@` 0` : t@<`?   `t @; 8 2   `t@` ̖b: @a@"`xr F@B@ `("X@**  `t6%* @@1̮  !`$@@  " $- *c@:59 `%`@` "M`0 2$` @ ̐a@+@:!`f *  ?% %! @"㿘 tm@j  `@7@6``@6, ` 5@6@6 , `@H#`B@5``@5, `̔ @" @5 @5,  `̔  " @5ߒ@#` @5 @5ϒ,  `̒ @"@ `"X@  㿘   ̐"@]!D )    `x 3#  @8@5 @8  * @5   @c@8 x ` `L*  ?"@<0$`L`x@7@5q%aD  x@C`L * 㿘  ` "   )̐"@  E!  %`@7$@5E` `@7 * @5;`@  @7x`* d, @      % c! @4 "!@a@ "a@㿘 $8e<`H ` 4"!D"`#" "# @6$`+@%`!* " $  %`$ "!  @( ` $ @|" e  `㿘! "$ @("$ 㿘$ 0 ;  @ C@8 ` 8 `,` $ (@' 2@F" @oc* `$"$ $ $ $ $  ,`$  ($  $ $ @*Ԑ $ 3``@ 1`d# @',` 2&`@#&# # * "  $㿘 Р@6c*      2 ̐#8@㿘c    *`   @'c ?@'@'c $c $L * 㿘g <  2#X#`̐#P@@O 3cԀ @#h cԀ @#p?"c8 @*G``  *㿘 (  2   ,@*3 㿘 ( "  ,@  2    8 &   㿐̐#@ 8  4@#@Q p "@# p@#@#cԀ "  @<@#  @# @'̔`#@}`㿘̐#@W@q#``J@ "     `4  0   *@*@ `J@#㿐#؀    `J@     `J`"  J@ 2  `@5`@3$``@3. ` ` @c@"U@   Ԁ " ͐ @  @ߐ2 @"U@"\   @ΐ  *@ , < @ ?@ $ (@ 0C@  0?` *  $` *@ cآ * @Ɛ  $ ( ` #*4@$ d $ $ $ `4 :< `4#: $ h`###`#06` `*`  .???Ȗ???? /''А c8@(ؐY ` *?"dx $dx㿐@+ * X'%;9)75 /#!J-̀ +B#* @€cԐ >%c͒ ,X b@o "Ȓ@0,X ca @a ''#(# #%#!,X8 m@T p&@!@@X `,#  ,` #,` ,#  @!x@hI?? $#*@  & @  @ @ cԀ @ 4@ݐ @@ِ    ?@@`  @F ?`  '@㿐@"J ͐!@Q㿘 @ a؀ "   @ a 2  @ a耢 "   @ a 2     x %!cԨ ' @`@y #@c  #Ԁ @K!@;?v  ##Ԁ p@2"m    " \*+`  ͒`@>"(@ "@6"@@3"X@pc,  #Ԁ J#%`"@"@"@#Ԁ @"@a#Ԁ @ "@ 6#Ԁ @#@ #Ԁ @#8@ q` `!`'`Ķ`8@0#@ڐ#X. `* (@2* `. ("2`*@ *:@2 @r ͒#x@͔㸀`` "@" `$@#' /39P;`  #,@0"  @4@ &@2kĒ 8@0&`tĒ"@" `&@#, @#,  %# @` 2 @z @t   %# @l`@ 2 @f$%,!%P`p `  @  , c( &` L  #  `,6%@0I```@0D. ``d В, @ `,&`x 2.@N@# h``@#' h`\@#'```p 9"`\#Ԁ @ H`x N @ p@ "!ΐ @@H #H`@@ ͐! '''@<ǖ؀   #Ԁ @ @x  %  %! @ǚ 㿘 $!,@/!Pΐ@5   ` `, -:1  ``@/``@/, `  @/`  @/,  @@ @ ``:`h*$@ +@`@* ``,&`  4?@1C @@  ``:`h*$@ +@`@*   (??X /'?????"O" %`,# & X  %P    @ ` %P@` @   `,& l& X㿐 %!'@<@1c``(@ 0 c`X@  @ ` ` ΐ! @ @!@  @c8@%L  ` *  0` ;  B`B #`l` c#`s9`!H@` mcԀ  < @!X 2  ` 4  ;`a<`4@ `0`? ;`@  E@;  `#`<9ΐ!h @5΀((n9#̀`= `` 7 86 2`h`;1 `h ,# ` ?d#`(`c* @ "@ !#` ` , `!` @O` @$`($$`h  e(`:` `` `9`h `B*2@  9    $`t@.#?   4`(Α, ` 㸀 "@!Π  , 􀤠   $`t@/Ò   `XΑ, ` 㸀 "@!Π  , @  `\"`. 3T``@!   2@ !@" 2@< ΐ" @ lb(#""#" ``` @ `  *@ *@#05 *#̀`"`?"ސ<c``$`p$`t4`g4`"!L"aH&` ` 4`$@-:` &`$`h 1ΐ"0@ aԀ @k"`0@\"p "`$>" hΐ"x@ = ` *@H!@  `*@c8@# $ @"㿘     ' baH  "aH @ "#Ԁ`@" @ "  @ ΐ" @ b( `$)'+-/57΀ Ӓ   r    h:`K *$:@ `2  #Ĕ  %# * @ +  YcL ` $L @ #Ԁ`@b K @D  @ v(@  2@ "@b 9 @2  @ d( P`" P"#,"@""@,P@ `  P@@ P`2@P@2 $`2 P $  & $` 㿘 $!,@,|!Xΐ@ܔH   `  )?? 'Ą /?????,)`, !P  "aT"X +  `@6+) %aX   `'J@  3 ` @  `,&& X㿘  3 3  2 aT- )+Τ   P c`T $ " $T P P 2  P T@ Ң`pX(㿘!`a\@:   㿘!`a\Ȓ@*  @" %ᴠ `' ?* : `l*`)# €@ #@   @ ϐ @ C` ݔ!퀢 X `@ : @ h @@v X    Ȕ!퀢 C `@ % @e h 2; `@ ϐ @ `@ G x@U X ǐ   !퀢 " `@  @D  @Ȑ ϐ @ `  o@ 2  ` `J@   ` #!*`c - @s}   c  *+)# ?bȡ:?  "\/' X?????؀r$a`+Ϩ0531`  `a%``a "$ @ ? 7    : 6 3 $@ J#%`  `ؒa@ "# !a@ "#cԀ @Ɛ!8 cԐ! >`$ @!H       :   @!e70  $  ?8 @ X ' '*# * (&XK%`+)#1/`  :%`  "7  2?0   !P?$ @g` %!` v  `\*` ?2  -h@U` !` `\*  3  `\* ?3    =$ *`&X# * @  `"   " ِ $  $ " *l  %! @!x# %  ( `'" $   #0  @ , $ 2 $ (!ϒ!@ 2#    ϐ a $@ " #`"e $  ` a T, 홒a# `' // /!@”!  ?  ϒa`@Ґ ϐ!@2 $ 6, @"( $ "7@ϒ7@ $`& $  \* ?2 @ A4@z "  $ 4! #' // /+ϐa`@f! $  ?   ` `@@v"@74 $ & $  \* ?2 @ 4 a`@Y 2 U$  Q bH ,@! "F E ϒa@9   Pϐ"`@?  ֔P@"?$ $ ɔP7@T@ "  $ & $` \*` ?2  "  `( $L .2%!`2L  씒b$@ "Ҩ Ӱ  .2 섒b$@ "¨ ð & $`  ϒ  ` @ * : ` )#Г*` € $  [@# $ ``J `2 ##Ԁ` J#%`}ϔ#  >@e#`s`< ` @ @  *  \ *`2  ) $ , ؖ @$ @ $ϐ#8H@)#Ԁ`@2#p5 @"#`0` $  $#`!#0 J @   ޔ#0 @, "  \*` ?2 *ϐ#@:``2$   @#@$$"@㿘!d`@I   㿘  *` - #  V"X-d %d H? ) `J `@  `J@ :?  J@ 2 `Ѐ@  D` `   `J `Ѐ@$  X  |`\*$ $  ?3 & $  $ "  `  *鹐 d& X(P㿘!h`l@̔`   `l   .. ?㤘!?   /'#`X@????V? `"ah' * : `?.!*` €` \,`R `75`#`0l2#`"  @~##В`x l`xQ  @ 2`В`ܔ `*А :`@l@$X㿘  `B '+   4   `h:  J* $:@`$ ,  2, & @%$, `  : h* $  * *+ cĒ%cĀ`Ġ0$$$0㿘!lap@   ?b % `ᴒc'?#`ࠒ @/?c(#("຀5`X $ !#Ԁ @O!#Ԁ 2 %$@ M!0 "X%$ ,`"`X $   !H  Ь!P $ %$P@&7*  ณ, @,: ଢ@@&)|@' , $:`0@@&*`@'ܓ, , :`@! #Ԁ@!А!X@H%$#Ԁ @ !p ?#Ԁ А!@ݒP@%*  ณ,@: ଢ@ @%|@' , $:`@*@%ѐ`@', , :`@@L %  * "L? ". ?#4? T#0#"`"@"U%c?P#(?# :`?" ,?%Pa#$"![#%`Tഡ,  %`XP@%഑* %`\ฐ`,`: %``?ଐ#$$@"@%p@'4| , :`@%`d?$ "@ " %`h$ * @%`l@%U|`@'* , `l:` %`d@`\"U`d?`T%`#,?"@ c0?#" @#4#@ "L@ސ!?#8  @ܐ?#̖  "  , 0$? 8?#  ? #?$8 @  6,   :`h*% +@ * ,/"!p`ܺ  #`X@ ["!l@$"l@$ߒ/@  ࠒ @ ؐ @"U@ " #Ԁ А!@༒@$Ȑ$@4 %` %` =`,?@2@N5`5`&%`$ $%`8@&o %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#0 ?#,@(@ L2@"U%cฒ@$k?c?`@c #@`@/`@"@ ` @* : `)/ ē*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ*А!:`@Дศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @Ȩ @"U8 3 @"U @ h:`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8d ``%`@#|@%x`@-T@`T@ `"|@#@6@%`@#@#@+@)@#@$P@#@%L* `-  @`X@ @#y*  4$`$>88@%2 &``l:`@8@%) &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " %  : :@ `4@ 8@@>$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@ %?$4*  # %?`$  ' ` @ ' `   @ ' ` 'P@@ t 8А@ =b  `$@` $ `  $ `$$ *` @!#?4@ M ?`@"U@`T`T@ @"U@ T T?#0 @ 4 +?c8 А p@ b0 "?c4@@@ߐ @"U@ T T`@"U@`T`T@?0 @#ؐ *`J#%` ?c$@@ F?@"U`"@`\@ " \ $ @"U  "3У- ."   \ : 2  @"/@bH   ?#$&`?c @@ 6F`@"U# `` @#@``@ $ @"U  "3У- ."   \ : 2  @!@ʐbp   ?  €`@"U@b`\@@"U" \?, @ X $?c8 А 8@ b @ "U@" \`@"U@b`\@?#, @ cؐ *`?c@,@@&L ?"X?(%P!?##@   #8А@ b  #= ` =--Ґ *` %! @"   P X P T㿘 %'H'L'P'T'X"@TH@ 㿘   #X` #P@6"@  #X` @*#   P@##@h 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@@DА#8㿘 'H'L'P'T'XH@6 (@f / @b <   L` r`@ `@D㿘@G / 1$!x@, /,Вc@$@!x!x @$!x H "#T!Ф#H@'  #H@#P0M@   А#h@>'< @@#0@#T %#T@  vВ@w#h!  В@m#x@ `wâ @ `2 㿘 Вc@D @ Вc@Dސ 㿘`Вc@DԐ @ǐ  @Вc@Dǐ 㿘@ې Вc@D 㹰 %!J`X?*#$"в '@   @~@Mђ@!p <   ѐ!ޒ@! "  @ ߐ  "c@~@+ђ@! cԀ  ѐ!@ْJ ` Ԑ@    &cԐ?`&c!@Ð!Ԁ #@!#!"`|" p`? $`$ , $ ,`$`@$ @  $``cM"@Ȑ "" ("`d"@U  HcȀ A Ԁ 2> c@ 6@n"( 1 @D@v@q,@  ,$@* "`@ф#\"Hb`⨘"@Nb ѐ#06 #`  J@=#X   `рԀ #ђ##h? 2 #   $1 ,5"`t @  0*@ *` t  :` :"  @E<` @ E    `ڐ#@#`2  " ,    <`cȐ @֐#   "`<,  ` `$ @ (Ԡ ` "`@Ő PԀ 2 @# 2 * ,`    @ ґ*@ `  "@ PԀ   @# 2  * ,   `0`H Ғ x  `0Ԑ "`H@ PԀ   @l 2  * ,   `4`L Ғ U  `4Ԑ "`L@\ PԀ   @I 2  * ,   , $H0204" 04*  `:%0@3 PԀ   @  2  * ,   %(`< !Ԑ < `"(@ PԀ   @ 2  * ,    H8%8: @ %< "! %<!@  H8  ԑ:;%8@ PԀ   @֐ 2  * ,    L8%@: @ %D "! %D!h  L8  ԑ:;%@@ PԀ   @   * ,     ::8 L8  ::@&#( 2  e,.(Ԁ 2 @! H z!̚ ` "̒ ",` <:%0` "(`H8  ; 88` L8: ;%@*`+`( ]  eLYԀ 2 @R"  F!   " "L  "P #\"eT %`"X P@F*  , @,: @@9 @ | , %$:`@ *@*  ` |@*@ , :`@  L%@  $ * (L` #Ȁ`    `@\`hc@   @ M  "cP cP 2``@"(0 4 3/57 ``0"4cP`8@ܠ ``dc@* 2 b`@ᨀ  @= xoh  0  ժ` t` &`:   ? @ "`hҐ"@0X  @  "``  "  @  "c0 Ґ"@`0>  @ؐ   "`\ Ғ`"@y*`0/   #"`" @$`!$# `@ # `"#`Ґ# @Y*`0@ Ӏ` *c%*#% @Ő   %! @#H㿘-Ȁ  d :` @  c @M 2 ! % % \F!T@ҐxcP, 4Ґpch`Ґic@  ఀ  `,`@?` &`hҐVc!ҐOc d@`d`4 @-@ $ d@Ȁ`B% ,%@ܒ  ,  @Ӓ*@  @ h@̒@  2-  @  $#`+@~#  h ?'  $ @~:`  `@  *#$ 㿘 #Ԁ`" 9@~ PӐ Xh㿘 @r?" J ? (J? &`T   ` ӒE p @L? &`T   ` "L`* :@ `` #*` є xӒ e %h@  &4 &8 &&$`0&`,&`8&@`(&|``4@8? @ @8?&`&?<``* &@"* &|?@Ő8?@@&@@&$@?@&,`&d <`` &d`( " d㿘e!`e@!x 6!x  @y@ Ӑ j` 2v `  2q ` 2l ` 2g ` 2b ` 2] `, ,2X `0 02S `4 42N `8 82I `H H2D `L L2? `P P2: `T T25 `` `20 `d d2+ `h h2& `t t2! `x x2 ` 2 ` 2 ` 2  ` 2 e\%\  㿘< @@"%  (@" 4 0@" 0 @#@  #`" @}!H 㿘#Ԁ`!`Ӓa@Ӯ`?@|! J `#Ѐ` Ӓ@|!]*cJc     %J ` %Ӓ@|א!L "@+) %@|ΐa@`$@b  $ F.!   ` " %   %`? "`@B 2 y Y n N˒@|᐀ y Y  -*# 㿘 0"`T@ "L 2+!#?" " " * `,$ "`, 0@5($  1Ө ?!Ȥ$ $ $" $ % ,, $ 6`,@  @ `0 ` ,@ @ `," 㿘 , , % $`d.  " 2 `,` `,  2 `,ǐ!@Ԙ`,  $" "$ `,$`,"`$`,  $ 㿘 $`d .@ c@`" @& & & 㿘N` A`  d@` 2"("0`"``.`` @g&` @# `  '`#P@@ 8   0"@ d * @H` 0  㿘#Ԁ`2@{!Ӑ"@r! 9"X㿘#Ц` !@#?$#  Ӓ *J#$`&) d :`:  @ @ "#Ԁ`2G"p   d: @ $В ,d!`#ؠ# @ 5 , -`)3@",L``@ `@  А, @"% TӒ"@ʐ"  %L   `рc#Ԁ`" "Ȁ "  ` * *`c ! #*` *  `@*  ؐ"@z`@5?@2&$Ё㿘 d >:`@ @  6Ӑ#& Ӓ@1W #@ 6Ӑ#  @[@z# : )9/#@ # * <` D @ :C  @ɖ d# `@#@Ed@A@zr#@ @9@zkP #@@Ͳ@@zb!㿘 _ d >:`@ @ 6Ӑ# Ӓ@= <"`p#X@t 6Ӑ#@z'#` $'+d@=bd @ < D @ :C  @P  d@Ր@zcP d@@y!㿘#ب   `8 4 `t "   ``8   !-@   h: * J& : 2` 6` @ : * H" : @6`e`@{@``@, ` ` U " `Ԁ Ӑ#x`@/ .#U% ` `:h*"@ +@ * `; c` ` ` ? #@+*@*`c 8@ $c?$$"$$` `8"o `t 8 "@ &^` `?T`  `TӐc`T    `  `` Ӑc@0L  ?? $`T/'?????# .#'̠!̐#''Ȑ 'K' "@ ɐ&@@ O / @ .@Ȁ!#Ӓc'''- !$`T ?.@|@ ," 㿘#̀`D @ 㻐# %a'ӔȒ$@'@ @;  "` @ a @h 㿘@tt@>  @  @ @ti"㿘 '   !#N 0 D l #Ԁ` @xu  & c (   & & 0p %!'@t-  X'€$ !Ԑ P@9    \'@  'Ԑ Ԓ``'''@ 'Ӓa '' @@@t" @ h㿘 8 `/  +-.`Ԕx  '; ) @@2  8&/@/ 8 /`/  8܀  8:": @ : @  @ ( (  @ ( (  @ *`? 8 :+ :+  ( :  ( (*+  **+ 8  +  + :  *  :  *  (+ :  *+ 8":: @ : @ `? @ (  @ ( ( `? @ :  㿘@#                               X@'  @b  %Ԑ"@ b@_ @s "  %Ԑ"@ b@S " @  @O 6@Ӑ"@!k# @ʐ# s C!  "a0  "a,#8@Ԕ0@JC逤f $#"B@#PB# @R   B#\#`#d#@    @E F#\   #d @< G"x @7       #\#l;p;x #`'#d#h#    @B  @    ?''' @  @ @ܐ @ڐ @ؐ  @!0@Ɛ 㿀  ?''L'P'T'X'H'`L?`' '' @s  ?`?㿐'L'P'T'X'H L?`(@r " **@& ?㿘 'H'L'P'T'X@DH@T@ А 㿘'H'L'P'T'X @4H@DxԒcl 'H'L'P'T'X@ p @IH㿘 !4 `"!4@㿘@#ܐ#@  @͐㿈   ?'  @  ? @q?@%#㿐'DD  ?   D@ ٚ ? @q@D#㿘㿘  @c Ւ`@” 㿘@ @ E @ ?Ր _@p @%?Ր U@f 㷀) %!'%ՒP$@퀐'ՒX$@z  @, 'Ɛ `' @r '' `x@r p@t#Ր`;X''@txP`2P@  @# % ) ? @u<  ?BC$0 ( ?@u. ?@? @p %!〢  !H@r ?0 !0 2!   ڐ!p@  @ِ !C!  C"!,! @!p@ 4?  ?ؐ ''' @  @ , ` !,1Ր!В!'耢'! '' @ɐ !Ւ@s PՐ! P{!@ ?Ր"`Pؐ? @t  ?@ C \1C@t ?@h?@pf Ր"0`P]B1C׀ Ր"h`PNؐ@r ?Ԑ?Ԑ     !0G"<@?'@&0͐"2 21C ","Вb@`1E"!㿘1 䀢 "  @ "  @p @w"    @ෘ &   @o @d#㿈 D  '''' 'D  @oD@G # 㿐   ''   @o@. Ȑ#0㿀D  '' 'D  @, 㿘@ 2  @*  # @`c@ & @#  c@@U , &  㿘@   " @@    @@ @㿘 ) /  +@ , @8 , & &cHP@ ?ՒcX@5  @    & (" & $& $$ (㿘  @@ `ch@@ ?ՒcX@4ߐ x   $  #p @ %$ ` !   @@` $ # V  $  # @ $  㿘%܀    " (P ([ 2 $܀  1C!`d 2@ @1F#܁㿐@?  #0' @ @ 6 # @q@ @  @ 㿈@ ` `? @??@g? ` Hs? o@@  @?0b@O 1`  Z$`  W$` "1`@` @o!?@nN @nH @nB  ֒`p@5 @@: ֒`x@5 @@@ ` $ 4 ``" @ ` `@ ' @H `@qa@`@ `@  㿘#`܀ 4H /o   @; # $  $` ("`($` (` $"`$c0H?2$ G  "a0@C $ ?A,(G H GGG<  0  0㿘! $!0   @ &  ( "1   2 (?2& G $!0 1  @q ?"!0!0 ? !0㿘'܀ D  ?&  ( 2 0;  ( 2 @駒` 2 (  &   Q& "     ?&   =#p   @n& 0Β@ @3 ܀ "1F `2 (`&  @nے  ( 2 1F#܁܀ F  (2 F#  㿘 !8@ @"!8㿀 ܀      @n$  ( 2 @D #Ր"Д@"a1Ր!@( ?"A @?; )  ? ''' @   @  C ` @ !՘ aД!ؖa@oh P֐!( P!a@ @pΔ 䀊   2  2  !8@ "!8 ֐! ,  @nQ??#@l & $`@ ? @p ?"`{` @lx ?@lr "    $h!H @ !81C!㿘@D6  ܀` `  "` `(`2` Ր"Вa@ፔ ֐!x.  @n??!@l> "%1C$ @r ? @pY ?" + @l( ?@l"   $!H1C!㿘@ (   @*`2 㿐@ې ' @1 @ `@㿐 ! ~@o! "L@ " n L` o `@ = ", `"@ 2  . @ @ @`!!֒a@  2 &*@ &" aȔ@ڐ  "&&@ @ # 2&@@km`"2 &@֒a@ &@  , , , , , , , , , , , , , , , ( (( , , , (8 (d , , , , , , , , , , , , (t ( ( ) )8 )h ) ) ) , *$ *T * , * +` + + + ,, ,T , , , , + %! b'@V ? ??c @"@  "P"#"@y ֐"@b "֨"?? `#?  ?"#x?"Xd?#c|? 0@t?"@c?"X@#p?#@`?"^#h?"l#!;9 %7 5/ @B:?;? ;3I*  @€ ,"☐ (#"@h# #'b#@b`# @Y#  "c4#@o`@M# '#$#@d8`@B# #"#@XcP $@4#   8#@Jh逤`@(# "#@>#݀`@# & #@3cҀ`@#   <#@'ƀ`@#  "@#@#`@# #b#@`@#  "c#@0`@# "#@ H`@#  #c( c`#@``b   l #L{`#@* x א   #c0m ,#@   ",b##0@`_`@#  X #@S`  N"P@# H#"#@`C`@# =&#@8`@w# 1"b#@(,`#ג@@ڐ 2# "`@a# %#@x!H`@V#  #c#@l` `?##"@~`Ð $#`*`@ & & ?@l?〖@ ѐ   ?#( @ K? b 3@@_ +ג@@僐 &ז$@͐%זᨔ$%@@Ð@lxהᰘ$@@lnגa@.ސ b 2גa@U -?x @!" '/ @??' $ .#x#d77''7?c?@"@''''7@o / !ז!הؒ$@mb?|@vȀ? אה$@Zab ??T"@̒ ?#  #@h@אa@?#@    @h@א!@א@    & rאa @ٔ  ,  @仒 `@䶐 2 אT@Y!'" bЀ  @a @A"( @e?c@  "@@hB@ڰא@-??#|c@@f@ 6 8@h-@ڛא@8<   b 2 @ א"@@lC@@3 ?"J?``?㈖@ ? & T `@ `  ?@@"h?c@@@M  &T `@ `  `M* :@ 2 ` @"@M ` @"@M @&@  b  M"@@  H "."␀  0 "@@#0⸀  b, %@@#Hb   ( 'b@@v#h #?L##b   J #b #b  #$` & ((*(& #$   ` @`  '#$ *  4 '#$ 4  #$@ F@? &  "c4   * "(   #,  c0?  %גc@2 %גc@,   ", #? @##c @""B @A 8"  #" %ؐc@ (b 2@#$2 "b@'`'`'` b'!!"@ ސ""'b@ ؒ%@ Ӓ#"b@ ͒ @ Ȓ&@@ w#$@" `&a:` "'b@%b@"@#"@&@@ܒ$@b@ `$    @ 4 "b"@j H⌀  !?#`@. 6#``@,C X#?# ?#  #?c@"@?㔖?c#\@?@?㤖?@["a b@ D"@{@ $@`&a@@ :` $@b ?t@  ?㠖@" ??c@@@?@"`?㌖ @ tb'\@<b #L?'`' '@ ? ?֒b@+ @f?`@$0ic@ @$@y?c'%)@Z ?p`@ ?`@+ X?`#@  %?ch@`@@ Z ?l@ 2?㜖?#`@a@ @i ?@+[  ؑ2  @ @` @Ր `@Ґ @@ @ @ @  ? cL  '?c@@` ?#cL֐ ?L#`@] @eS@@Đ 㿘 e`e@﷔耢 6 3bЀ  `@^" b@'"(0 @jG  #X@ 㿘"`66 e`g@ @j, ؐ!@㿘'H'L'P'T'XH @    ` @D @7 @G@*@i 㿘b     ! %ْ`X@"   ! %ْ`@"ْ`@ސb cc %⌀ "    2 b@ʒؠ  @3 㿐@ ` 0%ْ`@*w   @D ْ`@*k @g "<?ْ`@*a !@ @* &'@ː  @ǐ `2!א@h ?ؒ`@*? `2  'ِ @*Y@戀 @ (@  ْa@* <   <ْa@  <  `?㾨 %!'ِ!@ٖ8aHP' '''''ʐ   @M Z;٠ Z@  ? ??(?0?8?@?H?P?X?`?h?p?xא!@''  @  ` @ ِ!X@i@p ِ!h@iْax @)ْa( @Y ِ!h@h` @ ِ!X@h @C ِ!h@hْؒa @  cL @ "cL֐"@ 6ْ@h!@! ِ!h@h@  @!Ё %a!٦ '@ !ࠒ L H٠!H@ Hؒ`@)<  "@ ؒ`@)/ `@߫ ْa@  @߄ / ْb@  @x ْb(@  J?`/ؒ`ؐ@ոْbH@ճ ْb(@  @v 2 ْbX@(  @"h% %'@cch#`,pc|x @@@*y @c" @" %!'D''H'T'X@q  '"ch@@h  "cd@@a   "b@@Z  "cxْb@( @@b ,• :`: @,   @b "ْb@({ #\   @?""ْb@(i  @U ""cl"#pch?"e,"e(ch  <"%("%,"b@ Ր @ chchch""`"`ْb@ Ð   ٔb@   <@"d"dْc@    ٔc(@  #$  "`4"`0ْc`@  ْc @    ٖc@  @ْc @  ږ`@ z 6@ڒ`H@ t `0#`P`4? 8; 88 #`H#`L;e8 ;e@#h`P< "`Pch 4 " T < "`Tch0"`T:  "8  < "``ch 8 $  0 0  4`; @ . "2 2 4$%P$ t@$ xch$ |`|"`d < "`d  DchcH4?@8?@@@&?@@ْ|&@& ?@@ɒ?& &?<* "`ch@ch* "ch  0 *` * ?: ;%0 `t:`@ڕ<  e0@B 8@ b chx3ښ?  ;`@ ; B @@鐖$'x 'x`8 "x@Fch"`0=  @* ch?`x@ch@6x@ږ a @d(ch ` 0 8::$ `$ 0$ 8@@ch$ P@,`ch*  @`,`: @@ ch@ | , %$:` 0@ *@  ` |@*@ , :`@h @hch`0* 0"`0@=ⴚ@ > 8@wb x?  ;`@ ; B @l@$ h `0@,`x?@@c x 9ch 0@r* ch?`x@lch@x@ch"`0 @^* ch?`x@Xch@x@R @c!0||` |@cx!Pڐ!p@ct| ch@cl!ڐ!p@chx !|#h  0c$ ڐ!@cUa#h  4c ڐ!@cJb @ ⠒ch @|" %ch cP ch ""p"ڐ"8@c-ch ?@@*℀ $ #"chഔ @U; ⴚ> @ 8@嵐b x?  ;`@ ; B @媖@=$## ; @3$@ 8@唐b x?  ;`@ ; B @剖@$ถ 'xch 0@* x?@@Ӓ฀@4ഠ %P@ʐ*   ,`@,: ଴@ch@ | , %$:` 0 *@  ` |@o*@ , :`@" 22 : :`#" #h%ch@Qch# ; @$@ b @=x?  ;`@ ; B @ @瞖$ '|P@]*  ณ, @,: @@Pch@ | , %$:` 0¢@ *@@  ` |@*@ , :`@8ch  @- |@$ @& `@{, ڒb@= ڒb@6 b 2.| |x ڒb@#  x@a#ch| "@a#@ch@a#Xch@a#x`ch@# chP@ܐ*  , @,: @@ϐch@ | , %$:`@ *@  ` |@*@ , :`@chL@  $d|<$$@@i@$ఠ@$ఘ 'chڒc@ "  D)#ehL @ "Ȁ@ L h hchऀ B$XXP@m* @i|`* @*%h%`%`$T$XL@@ 8B 8  @ 2@,`@$Dch P#\  ےc#Д@a2 @ch"cX $hch@@z$, $,ch x ` @:  @ $  ,8 ? 4  @ch@,  @$&(,@@,  @@8$8@ے@`ېch @`Ԕ@ ?@Ӑ$༦"@ a  @ʒ@Œ, ch@ $M2ch8* @|@ ۔a@̐ @'@,  @8$@^@Zې8@`ch@|ے@`ch ,$ , @z  ch"@$ `@y`ch@<|ch$`$`d`$*  P ch b 2 ,ch`d`|@[:@U?$`ے"@@`J!ch ,# p%D*  0  L2  # #  # l  < "`pch @ ##tےb@!  #8 #(F #4T" <ch$%\$ @$ <$ X@$ \ c,, $ Dch$ $"$ $ $ $ * ch *`ch@"ch`/"|@$ch`#\``"HH@_ch4"$"X#`' '"H$ H#\',?@_̔ P @_Đ"0b  @T Qb@Ɛ H"c`@ ch ,@ @ 9175 %"#|@ P 2+chh@h@.@ h``d ,  d@"c8 c@_{"Ȧ @_wЦ@۟@ch``,@ #P 2@_f""` @ TX@e\ ےb@u … ch$ @$%\ H@chF`!T "e\ch`T`<``0"`d * t @uch 0  chch `,@h@```@.@ ` `d #H,@Uh``,@&h@ H@GchD *` ch %4"` ;D* ch 2 @"㿘#h @ $4@ؐh.@А@༴ @ʒ@Ɛ@@ &%@4?@ @#t!.@ࠒ #d@`h@#d"U$ $ $ ,?2@x84 4 h&d4 $ $`@V8$ ph d$T`,  $XeP@`* $\``,`: $`e$``@t`h@7| , `:` '$d@g`h@* | , `:`d ?$h`h` $`h%$ * @$`l @O h`|@*@ , :`$`ddhdࠀ@$ےb@Z %  '" @"U  d: ` "`\@@  ? $+@*d ?"  ') 0'  @ؓ, h "l0 2  #h@```@. ` `d`0,@0#h 8 #h x ` @: Ԁ h@"Uh@`8d`"``cؒ@@h%$`d   l;  +  $  * * d`h`$`@ |@p * `"`T`T@@ `"h |@ @w. @X@ @@w#@w!@ @w@%P@E d* " X@v@9* d  @@jh@- @e%P* @@@ 4@h`8hh`("`(dh (" 8 @v$ ( 1$@*`4  "  8@ %@'h@"U ``d: ` "``@@ `` ? %@+@*d`$@ "$h`8@"Uh@`8d`"``cؒ@@Ԕh%$`d   l;  +  $  * * d`h`$`@ |@ * `"`T`T@@ `"h |@ϒ @ve @@ @Ð@vZ@vX@ @vS@%P@| d* " X@@p* d  @@h@d @%P* @@@ 4@#h`86/hd'*`4 @ U"    #d: ` "``@@   ? %(@*#d $  "$h%$`9 d l  p  h  `!     h%$4+    "  ( @ `d`p怊  hh%$4+   " hd` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @```@. `  `d`0@@,㿘"b $ $ $ @$ t4b $ p!@/4b@$ p$ t"b `4   "   @)1: < #hb`4@Ib $ (#h  `Le@ @; B @ * 2`  $ hcx`d+@`4@V 0 㿘 #x "  `` `6` @`?$ @ a, @*` `2` @ٔ"㿘#h !d*#d@#d@`"U-#` 2`&#0 !۬ cd`#hc``@h8@h@ #hcd 8` &`ې#X@[9 0#h@``Ucd@ >`@Ք#h%$`cd   l: * $  * +* cd` #h?#` t# @ ? "` #` `#  "#h@ |@ cd* @"U@"TT "#h |@ @t{ @@ @ِ@tp@tn@ @ti@%P@ cd* @"U@" X@@* cd  @@#h@x @%P* @@@?4@#h`0E`4@h #ht`8 "@ " `8`̘#cd@ #`$4 "$`8"@*`   `8 '#h@"U , d: `"``@@   ?" +@@*#h 8 #h d*@cd?c@'h!& l d*@g#d#d@ "U " ےc@` )6` \? #  `  * @*ch d#d@r*ch#t"?",@ @ hےc@9  @@ @ * @   @@ @Uܒ@z x `?*  dc @,@  0@h@Ux*  @Bh0@-㿘"` "@ې@@+0 ; @>  cl@ےc@R "㿘"` "@b@0"` ; @ۑ>  cp@탔ܒ`@% $㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `? %ܐ"@/`  㿘 8 >   %  %.@>@ *` @ *` * *.@ >@+ * .@ 8"@`8㿘 8 >   %  % .@>@ * @ * * @.@ >@+  .@ 8"@ђ`X㿐`h @4?   @> x  @ " P㿘@1 , @ 8 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ @ @ @ @ @ @ 8 0 p t 㿘ܒ`@S  "c )_'#!%/ $57 "* #@€ $ㄐ $c $# $# $c %c @@+ߔ??* & @ c @@D@  @ &@0@@㔝㿘#`  #`# @   @6  @ؒ ?` K` t*` € ``s`!ܠ @l @f`!`@a @@ 2 ``U`!ܠ @N @ǒH F``@``@ ?@8  9$` `   2 `:``@L`@ +`:  @_` #``@ @Y4`  " `@S` `@X  "c@7j 2|`:@S`ܒ`@I @7( Q 3/) -<+5ܐ@3 3c  c#`c@K0%#  #@ "' @ #`@ "@Xϐ "c @S5`@XE%#  x %!' ` ?ؐ@ n`<  "` p  `@ g  @ "T@H?NP$*$@_ 2`8ܒa@  @R :@+ 5ܐ  @K @-`8 @< $@ ܐ  @5 @`8 @& @  @3@I ܒ@W @) "c@<  @!㿘@w 2    @ﶦf4 8  x# %a '! %ܒa @h"0,#`Y< ( S@  "O @f@h @ O逢  ܖ!P! %#\a0@<"@Ҏ" % a`? "`@ !  &! `  %! ? $ @!  &!耢` 2 `y `Ya a @!X㿘 @ %#@X ? (J /"*@X / J .2 J  .2 J 2    @a` $ `&   &  㿘   %a@鳐"@! 㿘@p@@XJ / `"#`@"@ؒb(   !ܔ b0"#  ܤb8@"@ ; !ܢ"H!+ $' !7 !5 !/ !  t #@@(? fcc*@`&  @ `  `@ `? `@~`@y@c : $@] :,@@` c@ c @ '@"`%`ВX@n @u 2    " @ @ݖ԰ 6 @P`  !#`ܐ"p@V @d  = @`7ؐ @~ ' J` @bx@)  '  W@ ܀  0  a@3 ' !#`ܒbp@} b@x  @@a@ ܒb@e @  @@  㿘 !R# # T`"V@2 V  @T"V  @&# V @!#  %@`? "`@ * "@V@T"0 @   @T#( #@@T 㿘  N  ܐ#X@Tzܐ#`@Ttu`sN o % b@`?"``"@ <* H$"@@ <EN * @:`"@` ,?"``"@* $"@@ ,* : %  %"@ :?`&  @  "@* $"@ @t* : 4 NN 4N`"@`?"``"@ >* $"@@Q >㿘 !#` # %"@ǒch0# %"@c@. 㿘@ "cܒc@u e`@ @#86 㿘@#@۠ 㿘ܒc@ 㿐 !#4`' !ܐ#@c؀ %#4ܒc@ؐ @@@ $8ݒ`@͐ c @˕ @  ,@A 2 @ސ $8#48 @ @ଚ  ?"c@ɐ ,'%?#<'$ #`@\  #?c@Q $'#  @I 㿘N # &ݑ*`: `T @ `  2  _ -  @   N  㾐# %a'ݖ!8@ ! "c0@Ra @ِ @㿘! !#0 ݐ H@=`P$#0㿘 !#0` ݒ``@/ X  c@{`,` #㾐 %!'  ?ݔh!@Lݐ p@ a @ x㿘@析@@斐@p %!'@E OЀ E F AА@;$ݐ @dOЀ F? !"#0@j@J@ "*@ݐ @M@0Ѱa @B ȁ㿐c @k OO㿘`* :`` ,, ` ݐ @,ݒ@!㿘@㿘ݒa@ @" 8 a` %'- $) p @w 2a(@S @!@┐@@% ?• m* @@`2@@@ 5 @@T @?` @`J /"*` @@   @@j  a( @@SS?2@@Rː!@ @ @"(',@H@O@@M@L@ `?,@@kA @M`݀ @/  @M`ݒ@R!@?<   !ݠ!P@ @Y?  / 㿘   %aX@a"@ϐ 㿘@ L T P 0 P @ T @ T 㿘!@"X""X@ @#"|*` @ * $bt`*`@ !$"x㿐 +c@0(  '-ݒa@  0(`J@   & TJ@?   `   'J   (J@  J #"ϐc ̐c@ s &`* * $`Jݐ!@ v @ `  @$` ' ) !J@   & TJ@?   `   'J   (J@J ,2M$` 'J   & TJ@?   `   'J   (J@@   @$`  #'J   & TJ?   ` `'J`  J$`$`) !J`ݒa@ %  @,`M#쀢#J@" L  L`"LJ@2 L 2  Jb@    Jb  @ `  cg!D*` € 'J   & TJ@?   `   'J   (J@` 2  * * @$`' `J   & TJ@?   `   'J   (J@$@J`c`  $`ݒbX@ " 'J   & TJ@?   `   'J   (J@J`;`~cL`bh@e wc 'J   & TJ@?   `   'J   (J@J`\L`b@:  'J   & TJ@?   `   'J   (J@J`L`b@ @# $` ' !%J   & TJ@?   `   'J   (J@J`#ݒb@ #@ l`$` ?$`& @!?$`@J@\ݖc @Ɛ ؐc' J   & TJ@?   `   'J   (J@(@F $`  'J   & TJ@?   `   'J   (J@J  8$` ݒc8@2$` ' J   & TJ@?   `   'J   (J@@@@f$` ݒcH@B @pJ@ ;Oc`X'`'J`  \ݒcX@+ @ $`@@` 'ݒc@ ?'@k`'@` 'J@   & TJ@?   `   'J   (J@J@ ;c,`` @' 'J@   & TJ@?   `   'J   (J@J`;` 'Րcݒc@ ϐc㿘'D @. `:  h'D \ ݒc@  DD] Dޒ`@ DJ Q . : !J [ @JD @D @ @;D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` 㷈 %! '%  @ &@@  &@@ " @@@ޔ``@ @` *"a @ p㿘 `  y ,@`$@ @n p&`"``&`&`@S N I/`:  \97ޑ*`:  \-"  N` -?@Ķ "N,@N``   @e`&&` & \2,@ ` 2ޒ`@O ,@` N $@%@h-`@ #Ȑ@{( 2Nޒ`@0 㷈 %!'D' ?&@&` &`&` #D`DJ@   & TJ@?   `  D 'DJ   (J@DJ g  p 9 ; 1  D|Dx w$Drހ  @ޒa n&@ k&` @ԒaDD@ #?@ ޒa@@Ő &@'D !J   & TJ@?   `  D 'DJ   (J@DJ*'DJ  2 *ޒah@ @"l`&`& @ս!? &` @G@ ݖc @u  DJa@o D M'D @r! %!'N  \ޒa@Q  2?4ac? 2N*b  ? & T*`: ?   `  ? N  (*`?#@:@7ޒbH@  @̐! +@  (+@?O#`  +@J &@ @"x㷈! %! '@ A O耢   & TJ?   ` " JJ  ?J `\2 J " J "  *J  " $@(,`@`@(  ,@f @"*㿐N 9 \ 06  $ /bް ` 2&@ޒb@o &@ &@ &@@  &`b@^  㿘$ N< 9;8  & T+ : ?   `  N& #;2+  N ". & T+ : ?   `  N 2+ . ޒb@ &`&@ǐ@P㿘. ?* : `#g!t*` €b| "b| & @I &  b@ߐ @ڗ  2 㿘    `,` `*`#@ @' 2  @ 2  @ 2 @f $$ $ $ $㿘 ` ,`  `,` `#̓*` "   2  @ 2 $ 2  㿘#̒ *` `'    @b @`2 `*`                                             㿘 +o)#!'%/ $57 %#9ހ /8 %* `@€ %"l #@$bh# @    $p %ސ"@ c@} @x?ڐ?bh* ` @ @`@ `@  @@`@ 0@ @<X@͒ @\@  @D@T#@ @}S 㿘% " K!  g0#!#a`2` ""`!5!`@c  "a@Da@%ޖ c@ a  "d$`!ߔ!@};  ߐ!`@Ô a!  "bd"!$!А@~ b`  "b`N #2Q N  nM ""pI a!@"a$b`  !J`# J  n "bp *b`!ԘJ  ! @!$`s@#!*b` #b`**!b`` #!#b``*#!Ք㿐!`?)'@Ô`$ "M  ! %ߔ`""d$ސ c@$"d  $"d#@Dc@r@ݐ `? "`@ @  "@@P "\ & f @k `@@C٠"d`"  @C%"\Q  M%"\@9ޖc@ @` %`߬ "`#31 '@ b` $b`!$&bd $"d@#  $@C"d@ @s`? "`@V @  "@@P  㿘@  "" " ""@"㿘@   "" "@" "㿘@͐  @C]@ߔ`X@6 㿘  @  @CE@ߔ`X@ 㿘#b @ߒ`@巖 ɠ @$bb㿘 %'L'P'T'X`hL@"    "`"d`p@"@cB"ߐ"@` @{q  4 4 4 $ 4 4 4 4 4 4 4 4 ` ɸ 4 4 4 4 4 h 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 , $ Ȉ 4 4 < ɨ 4 4 4  4 x D ` 4 4 ̀ < 4 $ 4 4㿀""`'3/bX@ΐ "@ `?Ƒ* : `Cq"*` €`%!"|H  +*@ bt;*`"|%bt*`$"|H*`bt * $  " " ``O"L`aK`   _"`   [p  @@   M$   ?% " @$ AbX" "  @ 8@!" " ߒ`А @ "  @ &@       @" @` @FW @@ @p   `  %` @@ @    @z " @ ْ 2@"p`  `  %` @@ْ @zg  ` 2@` % @@̒ @   2@   @   ?%$    % @@ᰒ  2$ @"p` b  b  %@@ᜒ @@z( %|H  +**@ bt"|S*`%btH *`bt * $` $ @ٖ` H$ `~$H@P@w"PbP "s@`p"bP  `2k@`? ` & @ϒ!? $`@Ar@ߖ` `J   `@   "M@@A_@ߖ` `7 A@%  ߒ`А @    `'`'` '`''  $  $  "` "`"`$ "` $ $ $  ` 2@` ? ` @- @"`@EE @`ip   `  %` @@ @  Ԓ  2O$ 㿀 `" "T    "`ߒ`    @ ܰ "4"   @  c-P? -  @q = xx@x   x"4 @k  `@ؒx@`` `   @ "4@S x"4 @M x ` $@-"4@> ("4xx`  $ @  @ ?2xx "4 $@ @#  "4`@x"4  $ @@ "4    ' " $   '' "4%"4 $  $ " $ " % "  ''`  %@@  `"1   2- ` ?  & @:! ? "` @@ @ߖ `   `  @~   "  @@ @sߖ `ݐ  ?c %!bH  '7' %?#/-ߑ, t* @  #bH@  @ߺ@bH@`@  @߬@ @J @-bHґ, @ `@!@?`" @?@ߔa !"bP%bH@x! 㿐 "!Ȁ@!0 @[$Ȓ`h @  < 2$Ȑ <$N p! %ߨ!PȀ&N@C!8 N`' & T `@ J` ` `*: \"@`?"`` "@* $"@@Ð 8"@ߔ?a@ \"& "@* $"@@ \N@J "@"@?M " `  "@* $"@ @ @C9!` N Ȓ"@`?"``"@ $* $"@@t $"@`?"`"@ * $"@@f "@ `@@>`" @>@Eߔa 㿘,` w@: & \ ?N? &`T   ` "?N?Ѐ $),`:  \2  N \ &2      $ @ &  & &,  3& "x* ?2 (?2 ?"!  $@    $  &  & &"x@ @ @& ,`    $  &  & &,㿘    $ && & "&  @Ȑ @& * 㿘@%ߢ?N  w""  { s" 1", - ?" @   @> @q ܒ " ?"& @v "& @= @] Ȓ& 2N 㿘 `""L  2 y  `"]  2  "( @  `   `@l  2 _  "`` "  U "\`"Q  * $  &"L@  `   `@F  2 9  "`` "  / "\`"+  @2  "`` * &"L $      `@   "`@ `?"\ 2  `?㿘  "T` ߒah%  ""T J?` "?x    ;; "T"`bx@6  "  0  "Tߔa 㿘@d 㿘 "&@ў  &㿘@f  2@ߒa@IN @& & "&@ 㿘 ??`@њ   ߒa@I1  "&$ `2$@ 㿘 ?`? "` &@ `"@@R 8   @ H P p 4    x 㿀` J   ! #"   P ?# #@na? L#ؒ J`* l!@!@!`@!@ "a@ 2[S!  2 ߒb @ L@ "a@ C <"( 8`J  0"8@ '"X @ӓ"@@Ӑ @@Ӌ@ `@  @@@@@@"p@Gs  $' 'k$' '@0"@*/' `@p @@p@ݐ  ߐ"@G_; @;6 @ߐ"@GT00@9z J@ @v J@ /  @p 쀤   "@p@_ `@p!쀦`߀  "@G 㿘J 6# %"   P ?c c@m? Lcؑ* `@G"p-  J` @p @  & ߐ @oV  @: @(@Fِ"0@Gm" 㿀 J`e3    L - L    L  n e  E`2L  k   f L -b L   \ ߦ"6% `63w#*` €`ߦ") '`%  @HB䨒  @F{"  ` L`  @G䨒 6 "@Fd ؐ@l֔?ƒ?  `ؑ*   @ob   ؐ?$*  '  ' '' {`h ?" @g`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *`* H ` "`@C?6   쀣 "@y` ` @ܔ 6&`@@9_`2 @J`ꀦ @[` @l 㿘 J@  w`?  #ߢ#! "  v ? V #    #@k?耢 p#خ *  `2 ?`2ͮ ̀   ` ! P@}Ɛ@~3  ` ! #@}@~%  " @6T   `ߐ#@E ?`x *` €|@E# x ߀`#8#P "!@Eo ߐ#`@Eg@l* ]Z@E^#p @EX#x @ER# 2 @EK# `@EE#@EB#:7@# "!@E2#* @E(#   #P "!@E# @E# @E   @E  " "@E"22`/ 㿘㿐J`0      r7 s e  # t   # H  H$  #  `"  5`9' x *` €# %# % %# %@ # " %  $ % # ` +,- -#@jk?Ȓ?`'@g " `'@g " # ``#ؑ* `J`-`+ `J  ` $# ?#@@C Ps #ؑ* `, ,P @  - "*#ؑ* `C `"#ؑ* `64`"%@@@|%@4W ` ! "*" h"    @@  `@ "=`@ Ѐ` `8  @|@ "`- +1)߀-- (`    @ @@C"@ `Lװ 0@C ԰  ϰ @|Đ@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@Cr "@Cl  @Cf $@C`  @CZ @  @CR @ @CJ @@@CC @@C<!@@C5!@@C.!ߐ"@C* ? 07 "! !(@C!  !8@C -@C  - " " "@@B!@ "@B "@i "@B" "@  2i@ BL5 㿈 `   "` ' ''   #  - +`9x!*` € d  '    ' ؒ@haH2  * ` "J`-`+2 J     `?` @B!p @hW @ސ!Pڰ 8@{`/`;9  =5 "@ 2"쀢 ' a@p"⠐`@p|+ `2 @p$ =0$ * $ @i ` @BE`ڤ "5)97  =@ $@@c`@z4`<`2:`27@z ) $쀢 ' !@p3⠢⠐ @p/+ "`2`@oא =0$` =*@`$`@h  "@A"P !@A H'@z`  `$ `" `2(`$ 2"`` $ E `  # @3  `" @b $ `$ ?$+ $8 @@`$`  2l㿐 #  ! %" t ? a# #   d F #@g\Ѐ?〢 d#ؑ* ` %@yw@y 2  `" $ Ԓ ?$  2@zC   $` ?$@z9 2㿐   @@!0  `?   @6   㿘   % '"  p ? l  z   ?% @f۔耢?• nؑ* `2 @G 2 @G 2   㿘@]a ` J``? # @@0!(  "@fc؀ ?c * ` @F- ` "@F#   J `" 㿐"`+     #\#`@o/0   #` #\(@o"㿈  1 L -.#  * 2 *: ? &`T   `  @z  2 "8$ @ӒbH ) ' # %"  s ?c" c@y  2 c "8@?ް cؐ@fP?ဢ lc؀   ,`    bX@n" "@?t!    *" '%@c1  '?  *`" @?  @?   J 7` ""a ' "%,`@?ɐ`` "@?"u  ' `'@  "  ' ? @@4'@@4 ?   "   @f >   6+'L % @D 2& %`@b쀢 @>Րb ?  @ǒ  `@4_ 6 `@2 @ @>`,` 2L㿘 J 7`  !@e  $ " 㿐!  "@e#؀ ?# * ` I# B# L  @(J`#8@>w  `L`2cX@> u  2``?@&  '*`2@    *`@@$ @#p@>C 0M$ @d  `? `   +// /` ?///`?" !@̐# {b&# " @k  `@ 0@7 @@2 J` `?    @P ` 㿘   ! #"  m ? # + #@dSc?쀢 l#ؑ* `2  @̔ @Ò = "*@`@ 2   2                                 Hf`?㿐 # ` "@cc؀ ?"* cؑ*   @3   6 @=k!   +   "   @ " $ $ @=X!  x %! '! #퀢 S" #@ca8? ?#ؑ*  2:@ @-!@aH8  =   , *.  .   + " @ . . .?!P@= !X@=  * А   * - ВБ:  @N !`@ @N8`y +ဢ g  o a" I N u"@NN`@!p 2N" Iax*`@<` P  ?* : `   X*` €  4 4I"N N`@! 2 @ј<``- `=`+"  N,N-"-N`,  @iax "NN 2+N !@<_ 8@  @i!㿐!  "@b#؀ ?#K * ` D # @. # "@y!!@<'- * @   `#@   `@       @Y  @/ܰ @J!@;㿐!  "@bj#؀ ?#  * `  @AM  @AE `2  " p  'д    # 2+"0' s ?) p c) u" "cؐ @=mԨ c! L   @<ԔԨ 6 cԐ!@;' cؐ@ba?ʀ rcؑ* `!?&@<)  p@g@o ?  ,@  !@; ! '   ;' ''ܶ  '   -'' '  9 쀤}?#` ` ``$`  $`@i5"` @(`$  @u @ $@ ؐ?$@\ئ,?$@\  M$ 2 @ - @Q `@S͒ & # ,Ѐ \    * @` 쀤2 `   2  ,  2`   2,쀤 " , ?* @  2?,@~[$ O @g!@: 08    @ @Ô   @g&  K @f , H ` "`@8䀤 @< 8`?㿘!  "@`ܒ#؀ ?   @Oi`#* " J7`   "c@ @XՒ 㿘!  "@`#؀ ?#C *   "%1 " @:@a  @:" ) @to    @:" `"L@ -2L` "    @tT  "?@u 2 㿐!  "@`i#؀ ? = #ؑ*  @]    "#@a@9Ő  "#@J`r` ` `@?* 2  8` ` !  @@  $  @Yv @Y#㿐!  "@` #؀ ? #ؑ*   @]j L  '"(@9@  *`2` :`   2* 2 `:  22 2 `"8 @9N   ?4`bH#  @9B J@ b  @X 㿐   `"d8 @[̔ /  %%`*`?&@Z&  &:``$`* $`&`&    J `  ܁㿘  ! #"   v ?%# #@_jb? f#ؑ*  "()ဤ@|@ " $!@8ג`  [@ΐ@ @D @)Œ 2   ߀㿐` 2" @φc#\b@gۖ0" <@t <@JC @kc#\#`b@gP@m # )b   "'  b @X?"b   b    P@ @A  @>? `"   "  " "`" R@ 2 "` d@#  "E@ڒ!@`ؐ@]_H? mؑ* `4    . `2    J`p   ဤ`"!@u `@W@WG`@c0 #P@6#h#@6  1 18 1l 1P 1 1 , , , -0 -D -X - - .H . .x ,\ - / . . / , / /` . - - 0 0H 0| 0 0 0 0 0 0 0 2P 1 2x "Ԓcp'''' 'ؤ,`2@{b ,, @rb @6L"h f ,  ''܀Zؤ V  +€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@#b "'  @ `?`?€  "'ܤ'@㿘`!H"N  N@ *`: N`2`@ 2 `@  `?怢 `N@ 2N` 㾨  `# *` €/N'NN !`? 2@W; '' J '`?@z  @u @p @e@F@[ V <  F @O J < : @C > < . @7 2 < " @+ & <  @Ԓ  < (  @  < 0 @   (@   $@   "@ @   4 Ā ڰ  @X ' $ @'@Ē   # @ @  @ȷ@ `? @X @ڒ< @X 3@͒5@Ȓ2 @Ò  $ 0 @*    @*   r$`- *` €  d`?  ^@  @Y W   ˀ@ @M K  @F D @Eݒ > @Eג @@44 @E˒ , @EŒ @@  @E  @E @  `?   㿘@E(@4  #``@E  <  I?㿘@  2  €  2  А   `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2m  €   2_  €  2X P  €    2  </   2   + €    2  8  2     @P? 㿘   ``? `"   #l*` @`?   $  ` "㿘"㿘 .`   ` &@2#0#@2 㿀J""`    -  H-b S* a*`  * * f"  a ?' H" " @Xb?퀢 S##` "L2  a`@2  *  @ 5  !p@2X 0 @ta 2!# ? @(R 䀢  *` 2 @25! @> : 5c xc#-+' 2 @p耍  2@22 2@2a : @ @2Ȥ 2I  ,@D 2?耍 2? @Ǿ @%`!@% @!@1Ґ!0! 2 #2 2@2U!  : @2 @2J!Ȱ 㿘? #"X"X """ """``@m ! bc "c "b@ @f  ✁㿐✀ 4 `"✀- "c@’`h %    ""b!   @x "@v  "   @x @v㿘@v ` J` J` @ J` @}ڒ?@] 㿐  t`  @O @l) @K  @YW   @$`ꀦ ?㿘 @]}"Ё㿘 "`2@_l 0"* "㿘N  "   ?*:  @_T N$  *@`$  N H % a@'x p"#`! '`("X` "'` '` '`'`'` '`$'' "X' ' ' ' #''` ~Ә >w$"X& & & Ԕ& &  ''///@/"X`2 ?$"X  2 ?&  2 ?&   2 ?&   2 ?&   ?& @   " @   "c@׺  @]"㿘@*͒ / 2 #b ,`,  @X  @Ry 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@-  @ ,`@  @$$`@M,`` %@  J?`/2 `撑*`'' @' $< , 撔, @''',`@@"`@' $< , w, @'''" 'r p @$ z` @21 N@   5N@ \@ 2.@  .@   N@  \.@   H@DN`"" & H@<Ð !& Hb @/h U   ` '''`$ @: $< ,  , @'''"@`'"@     . `2  @ @@wx J`2@( ` "&&㿘 @@`@  `"@㿈`ذ @#@ `ʒ`` 啒` '''P@0 @+@&`    @ L   #@C@r6"@@s0 "!@5">   &`儒` A`. * J`    $@@ $`2 @ "$`$`` ?㴐@    `,  &@  `C`*@T+?  @B  .&@`&` ,`@.. &@ @' `$< , , @'''"@`'`"@ &㿘&'   \ *`*:  ' " ` = :24J ! : \2  &  *` *:  ' " `倢 = 4$ N ? &`T   ` 2  N @|"H ` `N / N /2`?'&㿐\`o '    #!@  `$  $@$'@㿘` A  `@N.N '%L \2LL  "L `*`[`?`$"LL  (2L@P  L /"  L  \L  N ~ *`.@*`㿘 $ @@ @*` @`@K@J    K@ K @" @*`㿘 #, @ " `Ē` , `㼒`㿘`@}" (NN / ?N /"?N /2?N /2& *&㿐@f @PP @` ``$< , Y, @&`&`&@`@Mɒ`@"@`&@@e #㿀@! `  ''' '耦r@/ : @@@ `-" @M @ 2 @,  @`,@   /,  " @M@c $@< ": 6%,",'@ @4䀢 6@䀢 `@,  $@ @O@`?`,&M@`㿘 @p "X@pa  ) ' ƀx ƀ &@? @`N@"` N@ ƀ 〦`?`ƀ㿐""""b"#b#".+` ""3    "b1`#"#b(&"̒ #@DH#`"" %""$Ā  $bВ @" @Z"bВ"@$bb!"̐ "@`$""@D "Ԁ 4 !"$bА?$"@  $!"耣` H``#" :  *@#?$" b % @  6MI # %##"*`@  @  `* @*`@`   6"""bܑ* * "* @$ "  0 0 `",0"@er  @J< 㿐 2/@  0/1"ؐ?? &"@C"ؒ&"؁ 㿘㼀 @  0b>  *  *` "J ""㼁 㿘#b"@ !" "@"@"b@$"$b@ W ?㿘"'@G֐ ?@ 9""1b" `?"@ϐȀ  "@Lb8? %"İ 㿘  㿘"b!@    "؀ 4$""ذ @B""@ 㿘ⴒ@@ 0؀ 4"@  㿘 _쀢 % @ """쀦`@ѐb?" "b  )L@M@ ⸒"@]@U%""̒`" `4@  @  "b@ %" ?@L?㿘@  㿘@ 㿘@d b@㿘@[  㿘"  @g 0Iؐ??B# & T   :  _ $ -J?   ` * TbJ?   ` 2 *:  _ $ؔ  ؐ??#@W 㿘"  @ 0Gؐ??B# & T   :  _ $ -J?   ` * TbJ?   ` 2 *:  _ $ؔ  ؐ??#؁㿘" bԐ @|""0b  "$"@J" "0  "J@`@Z$"""㿘@??@ ??㿘N  * @ : N`   &T    㿘"@ ]N`b   @: N  bȀ*㿘 ?@|!0 &`T   `  ` @8 ^  ? @@2@0㿘"b@$   b؀ 4"bbذ S"㿘b @   ؀ 4"ذ =@㿘"b @*#bؐ??$b% ⸀ @   b@ b@ې 0??$b  㿘@""ؐ??#" b2J@ 0 "ذ ??#" 㿘@ @  " *@`""㿘 blI   㿘`@6 㿘`@/ 㿘b* @%"@ 㿘b* @@ 㿘"܀`@`0  Hb *@ * @"@ 㿘   !@H 0!""b"@c""@3"b"@!""$"@&""@@`"㿘 H`"`" :"@ `n 㿘"b "܀`m0㾈 %!'?/@ )1  "J??..?# %耦*.@ڐ #` `.!"@n  "&O`^ B?` @*@ ``@!@@  "  `@? @S! 㿘"`?`  %@# @~ *@sL@`^ D?0 `?:@j  ?$㿘J@ ^`@V@   ?@ ?"㿘%#*b' $ b@2$b ""$#"+@""@ 㿘b] 㿘bV 㿘@? 㿘 ?""@  0@  %"b #! @? b̀ $@@#b̨#Ā` @>b̀  @@bВ"@$b̐ "@ "Ԑ"$@""b)b@2 b""  b̀ 8/""@  ⼐"& /@  bА?@"@  b@  > *b@8 <@?" "@ ??"Nⴀ8? &bā㿘1"" @p 03" J (`" J"J"J" J" ? ?*?"*J"J@"J" ?*?"*"J@"v  ? 㸁   㸁   㸁 㿘"b" ܖ" #@ "؀@ @ """ذ@ < H   㿘b%@F1#c`* @ "#)# * $@ @6 &#㿘# "c"##?c`* @  ##""b 0@!? 㿘 " 0  1#`*`@  ` #&#@!?" @ b"  㴀 ?&#&#㴑* `#`*` =  """b""#"( 㿘@z  㿘)" ""#"#b *@Q?  㿘 @E`N *:  ^2*@ N>  ?`  +*@`?` N *@   &T     ^*@` `@ ?(*@`*@⠝㿘   "aВ@$Ő"  "aԒ@$"ː@$"b.  ` *` " * @$"0 b.  .` @$"㿘"` @#" Ȱ #"  *` *   `2 @$vb :   ,  @     2   5,  @     ` 2N@iq . %"  : . *  "@ 2 ; . b*   "8@#uG @Dڒb , @ 1` ."@ lb@*"@ "@@ #` :`*"  *@* + @# :   ?"  *@ +  㿘!"?"b"#  "b !"* "   + b@* b    Θ  ` *  ` @ G* `Ґ,$" +   b*" +  @  @bP @bX  *`&*   8("8( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $  㿘"쀢`@c 0"@"@"  f $b 㿘쀢"  "0@C  㿘#%')+b"@+bb!"l" %b$b$@&$%"9@$$$b%"%b@? @  㿘 @j  㿘 @d  㿘 @^  㿘 @X  㿘 @R  㿘 @L  㿘 @F  㿀"!""#\#`" "  袒 "@͐ 0* @ Ր"'% ". @@    [ @ 0@d 㿀"'"⬘#\#`" " Q谒  @ 0H` m 0;"    @ |@ǒ@# ` J /` "" `  2 㿘"2`@":`"Ȕ"  #"Ȁ "b"bb"; " ؝㿘 "؀`?" ` `J@"J``"" 4 㿘  !""""̀   "" "   "? $""Ā` "Ѐ`b̐?@㿘N`"Ȣ*` : N bȀ*`㿘   % #* ? ? &`T   ` `,    $b$k$$b܁ 㿐1"%"" Ⱀ '"@o " $* "#bW#"    b  㿘 @`V 0"܀`:@J?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' Ȑ0K N )   " '!N    " '2  N  "  "  ""  '" ؒ?`"NN     " '2 , < ~.. 㿘@ U㿘@  L㿘@ C㿘"b! 0"ؐ??$"؈  &" `T:  _ $"  "K?   ` *"0 LK `T `@ `  ` *: ` %#8 `T `@ `  ` *: ` %  <*`@ R`+ "J & % %K `T `@ `  ` U*:  _ $3"؀ U*: `T `@ `  *:  <* : `T `@ `   *:  8*  R + 2K"ؐ??e$"F  㿘"`'b"  "Ԁ  wN  bԀ$ %" 4  L   ( @ P H ` 㿘'#ఐ `H@3`$ $$`H@, !"b`@ ఐ`Ս$`H`@L㿈 C!  M``'''@ ` S '''" '`"  @g  `$< , 4, @'''"@`'`"@ $ 㿈!  ` '''@7":   "! #`㿈!  ` '''@" :   0 "!@ƒ `(  'bp@  @f   J`2J 2J 2@!   ''ԟ  '' (@  ' ''Ԧ?$@@?4 - €N   |-  €ܨ Nٰ N հ   ڸ ظ   $,@` (,@N ``?$@@> ,@N `4 )@s2@V  ' #  $,@` (,@`,@N``?$@@>̐ ,@N ` ),@`,@`" ?/   @<@  @aƐL m?$@@>  ,@L `[  @ ؒ@v ? @]ݐ  @,@\ ,@"2D     Ӹ`" " $4$@ 444 $` ` %"  = #    ? ,@` ,@ `b"( @] ,@T T    %"  = #  H ?"0TB,@` ),@,` T@a T@' T@@C `C@@a @a'؀2@@ @& @""@ N '   '~ | 'z ) 쀤@|z J  l'd   J  b'؀ W䀢 2  '܀`N' ""  W䀢 T FW䀢 D  A   ?% `'`  ?"` `  "`@I  뀥  ? @I ?'? @G'W䀢` @ "`ܮ 2  耥  `  *`    *` p ml ,@`҂$@`@$@ @ @ @ B(`@L:(@`` ``$< , Z, @&`&`&@@" &@` ``$< , D, @&`&`&@@# @@"@`&@(@  '  ''  ''쀥 {  *` r p + 2' 쀤@2# @k̐"Ȥ 2@b@? @` ``$< , , @&`&`&@@" &@  R-`?߀`]O#*` €G [`@ ,@?`< ,@`@6`@3 {`@0 ,@`*`(%` '  " (`'@5  @ 2  ?` ,@`@' 2,@,@``,@`ܬ 㿈N@ $`N@ #cNN` _ } `@o [ % *O  * @ *O  ] *@e@^   @2 '$+ 2 2`  @  `+@]@^' "a @@ +` J `   2&"@ &@;zర @;`*$@    N :  N   N * `@  @2?N  J  2&?&'N@ * @*  %%=# `` 2` "!$@@]w$` @ +  @`$`` ``?$@$`4`  @ [ w O  * @q O  ]m  %%=#?!  y` '''@d@]=  +  ఠ$< , s, @'''@^ "@`'2" :   "!$@O `@  ఐ o`6  ఓ, H ,   '''" '$`@ `$`$@O  @`?4` = @ * @ B? ?@\ې@]$`$@ + . @2 "@@J` "!@ += -?` J `  ` J ` "@!@ . @2倦 +"@ƒ㿐 !`@-  H"`@PP"@ $ HP V@ -``(``#`   "   @X @#   @CȖ 0 2#6 #(@@ɐ @C @  " 2 @u @ 2@ @@ 6 &  㿘@ %2#0Q@0L@8J.@ &㾸@R@2|  2   2Z @h  "  @  L / '< %@(@ @)3  ?    2. @ (*L /%< @ (@2   @)  ?    <  2 /,@`,@ %$< , Z, @&&& $@@8ٔ"@`&@ /,@`N /?$@@8Ӑ,@N /`@8 /  ,@  @;H 2,@$ @" @8"@`@@&@;P @#H@C D  9@ ` . L 1 .2LL +L .N .#@:”  @ @"@@8e@8@&@ @ 2J`@2,㿘@  :$@=@L`- &@)% (2  L  `@P 2  .@  "&@.@`&@: .@` L  &@ ݀.@@}㿈  ' 'I ' 'L@?"@$ `@7 ``*@L@` 2 *@L` /"耢 :*@ @   @'M N "&@?$@7 2,  ,N  &㿘N  +@Y#X@Z2 NN  2 N@Y#`@Z - N  @Y#h@Z@  "!" 㿘@N d@O$ 2 @ِ 2   @7A`$ `$ 㿘  @Ē  +N {2( N   `N { }   ,?2 "N  逢` $ c$0f   `$< , w, @& & &&"@`L& 0B> "& 4 N { },  ,? ,% 2# `& `&@@@@,f  2 L l < X X 8 8  D \ p  ì ü ì ü ü ü < L Ш а D ̝X'D'H'D   H H DR` H?D@ {@4  t`@O DR`VDD"`D  `  *`#cW:`'H$DIJ C`1`,@Xc#x@Y]!  cp@C"@  "а#% "# "  ` b@Cʐ @  @A"` @H ;'HD` 2 !DR`"!DR` !  @O`  @"` @+ D `%D `#  %' "@Z 6 '`O$c@` K@G@ D@?* : `9*`"| €DH@M'0+DH`H `'HH! 'H@ ` 2@  ` 2DR`!!@' @ޔ DH@ْ` @Ԕ @1H 'HD`'DDR@ !  ` @R  ` 2 HD@`@H`H "'0DR`DHϒ aD`'DDR@ HD a c@Ӑ ` 2 @    @Ő @3v @3## `   @u#@s @ ! ` 2@  ` 2@耢  @a @3 c$  쀢`$   @S @ &c@I  $ `$ $  @} H ` ?2'HDH@2b0ZDH %`D!O'D `D R@  `? DH H!'H07D!2`?D '` a\'''''/0 'D` "D  `  ' 2@ `?  @2 @2o` @ǐ  'DR` 2* `D@V` '@X DHԒ a'`0'D@Vx`@W DH a'@u '0  2 `?  @2p @2` @u  '0DH a'D!DR@@  `? 0D `D!| DE D Hp a0DD BD`'DD`eDR``D '` ) @6+  '@ D 'DD <DR`05DH a.D`D@(HDʒ 0D @[A@'@M@2tDD`@@`D@(@@xU#@֒' "c@@1Ð H @1l  H! J '`@1] @L 㿈'H J` 'P ' J`    2 ( #"@Y ?@V HL ^" @  'HH A#@H b   J`P 'P*H| a < #@8  3 @8c؀ p?+  J 9`Ҧ = #ؓ*`   @ǒ 'HH `H ``H `  `'H` " H Ha@T8`H H ` Hh   J 2  @ "N #  +)  M#`(2  @TȐ#x@U b@@Gcp  `b "" ""  @@6  ` @=nbА  @XL  2  `  @X@   `` '0cH J 9` @ϒ /  c@P @'HH    0A퀢 0<H@07H`LH `H ` H@v` `@ ~ `8@ H  @. H@a@v  ``@j @I@M @  H ` @T 'H`'Hh"&"`  `" ` ! H`"`(``  "`  `"( ", "0 "4 "8 "< {"@ K # 'H H2 + # "'H "2@   H P  a "c@H*CH"` }H@ #@ &$H` HH@H ?"@ @QH"`"ԓ*` € #@'0`@/ @/I@/ `@ 0TH`H ` H@v ` `@? ~ `@9  @c3  L `  (#"@V H @Tʔ P @CP L   # @KՒ #@@Kђ H c2c"  P""@P?'P  "#@@. 㿘@S @T L  # @ٖ  L 2    "?& " @@@"@u !@㿘@G@HJ a@d @㿘 `    @H-  L @HM& && 㿘 @Gה  2 " ?$$, ` $ @P `2 @Hq`?@OM`$ $V``$ 㿘 # N = *! +@G`@G`  " "" 㿘@GQJ < /@~   q`  @G ` @2 /`_   @R(! @S" "a  & &  @ &   ` @2  ` 2 % `0 !  @G` #`   @k     &G` ?&  `  T P`N `    @G[ & # &  &   ##Ԡ  @ #耦 @/g`& &  &`@Q! @R "a   @_ c & "c& 㿐`@G`  J`/  ` $ ?$@GM 2(@7  '?@Ғ `@ <  I ?    "&㿈2&@}{ / Ő 2X 0Vc"@Q@F   ' 'B ' '耦`:@}U : @-@$" @.Ԑ@ /, "@@.@y N@ ɲ`Dz  0㿘' @%# $$\b @8  ! #@3}$ x @@9xb$ x$\$ȁ ?      - J $`  ޒ  ' ' ' '''' J`#!'@P~#x@Qx: 0  @L!(@ H`S"*` €L J"  J `E&  @B`@/p x<  6`3.1"   @ `*L@ -  L` 2 #     @ l 6 0@L9 lc@ a ?" ` J ` "c@ N ?@Q!!2z? !P!X!`@?@ra8@ ( 0_  *`R  ?@   ` *2 "@? <@    0@Kѐ @@rYah@  +?@`'?`@Z` ` "@   @ v@   А @7  㿈?''D 'Ha@  ?1   @@  ' '쀢`  `@ ' 쀢 2!X!P@@q` a@ 쀢 R?@74 H '@+G  @e   H@+O"`H@?09  1`@  D" "& H@$!a@  `& H@ @:% @:"D@+) @7?0@?@3@q` @ <a㿘 +倢 )'% , `2 #怦` @Nb@OJ`@8@Nِ" @O@ cp u  @NȐb@OJ@ ۲ @RÐ 4 "* ? "!㿘.`@ (`@:9㿈   @@&     @   '"Д ''@2 㿘.`p@:㿘   @@&    "Д`@2W 㿈 %!  ' `A`?J@ `J@ "`J@`? * J@   : + ``+J@   * `+Ԏ`    .`  @z`? a  $ a @7"0㿘`   "`1 " !耢    㿘w㿘 &b@@ T   ݬ ݼ  $ 4 D   4 D p T $  $    ȝx"'ؒ'@&@p'Ԑ 'D'L''''@)'` @   *@"@)  L  "4 @ !@)5@` (2Ԑ '@"`"@p @Ԓ ("D  @ " @OD0@NB L@ND@)Y  㿐`C& ".` €  ''&"  *( )"  * @N   8 @//@ *`"`@`P `h ```@ : 0`@ 4 @( 㿘 `Y ߀ ```#@ @|`! 86& `"` `?.& 2- (& `@c ϐ`$y  @S@  @F c `;@ @703  *,`@"`*`   @ `@  @  ` ` ` s@耢 ``    $   `"ȓ*` € @  @_  @-   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@g `  "   8  ?3$  @   $   ?$  %] @9   $   ?$ "  `$ @"@N @MP2&   ,``* `@㿘 & T`L?   ` `2 &` ( `* @ 4  [ L * `2 [2 ` @RĐ 2( `  !@&`@@ "` $@(@K &`u`Z & 7 _'  _  *  @2L #"Lఐ $@(Ĕ@&` }"`" `"` ``@M| ఐ @`% '&`"` J  2  @iP  M ` 2&` )&`&`㿘@@L` ` & " @M0 @Lr"& 㿘N 2@@2 .`* ` A $ .`* ` 6 㿘!  ` """ " " * 㿘N`  @@" @b" @L  @ "$ ` @@ @K9&@  @ *@&@$  D D D D D D D D D D T $ , 4 <   8 P d | J D `       !8' <7瀢`C9! *` € ax@v6 )@` @'a@lV `  @5M! `u@,^X؀* K   2 瀦`2瀥"X!` J@ `@u =   @'(`$@  , `  ` 2 `6 2瀥  @ה @& `'@h7 瀦` !Ѐ ` 2 `2`2  !@t  ! @ @  @   ` @ @ ݀`@ @̐  `?=`!"@ ,) @)753+"":@4K# @$"@4Db@u  2 "@49b"`@ @@1n" ` @ @ `  @Ȱ @k6`@"0@ @!@@4 ""`@ @(@@0? @ @k@"80d @I "``@I #`H"h@#2 $`HR`  @/ 2 `@"D @   '`( o' 'x'| "  x|$" @&xx"@@1 x&  $@0,|@,y$@| @j `@`"@0㿘@ #+)' @tL   , L "     @# @ ,? `H@"%`H㿈` @%`0V@@   ' '  ''$@"  @%@c@^@f  〦$ @" @ "@$@%g@:Ò$u㿐@'z /  ` "* @*@   `+@K/ `!@)%"  "L ?   1`  " : ?@i '"@  * @㿘 `  2 ഀ  @h# ര?㿘` @W# 㿘! ` #`% "  "P`` `?$ $`": @*`   㿘 ` "`< ? @ ``. @@ #ഀ@!?- @@e2  ` `@@e `&@ > `@@ ഀ@怦?㿘 @J" <  ?  ??4? ?㿘 ) '%"@< . "@@,,  % $$㿘 `"!  "1@r 1  #@ " `&  `"$ " @S`㿘!   !"`P'Д?"`$ 㿘 `@#ѐ@r^ 2* `@31` * `  W`` * ?:""ด *` ?*"&㿐J *` " "@Eː# @Fw"  @#`$" @! k@ "`@`@{   @xG  ` " @ G@,B #\   @ ?"`  ?   ?` @@@=` ` @)` ` ` @I ` @'` @@r`  @` @@$   @w $`  " * "        2    %!`'|'@D| &@3  #`0$@0&@P! &# @  |@| @@ `@Q @Р@`@Ő2  @-#8@?  0  2? "  2?@" "@  㿘   IA`"4* €@ 7`5 @`* 0 @`* * @`* $ @` @ `` ?  @ `& & [ `  㿘 `$ : &@@@ "@*  1 @" $㿈! @    @v   @ )D"@  #\   @N ?9`   @00!    g#  "@ %` >  > > // ///@ @1  @   @v %`  @ƒ 0@㿘! @ @ $ 㿘 "a@  @ 㿘  "c@"xN'H'L'P'T'X  3 @q H@/bВb@. @,b@ 㿘'L'P'T'X@_! L@/x"А @.s"@,v"Ё㿘  "c@"xN'H'L'P'T'X 3 @B  #Ȁ"cH@/bВb@/SH @.Nb@,Qb`\  J 7` "#@B 㿘'L'P'T'X@ ! cP@."ВL@/,"В"@.' @,*"Ѐ @& 㿘 ! H   ` "  @o `   ` J- b"@.ǒcH ! H    $  ch@." H"`㿘 'H'L'P'T` 'X! "@.ݔH@+ސ"Ё㿘 x'H'L'P'T`'Xcx  "@.ƔH(@`   <   ` `㿘  @*  В @*   p@*  "` 㿘@]  @` #㿘  @y  @` ?ؐ# @h 㿘 ` "p@+k ``@Q0 @I㿐@ # &@7  & @/ 㿘@*@( 㿘N? &`T   ` "+NN  2'NN ?А@ `+(#(  %` `  2# p N  @G &?? #"#   㿘! #`  @@#?$#㿘 c   c` @?$ 㿘 # `  @?$    `8"@?㿘  1 # `# 6## #@|?&#  #@t?$   @l?& 㿘 L` H@ڐ ,ܐ $ P$$@-/@  @)6 $ $$& 38 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 38 44 44 44 44 44 38 44 3D 44 44 3l 3l 3l 3l 3l 3l 3l 3l 3l 3l 44 44 44 44 44 3㿘 P"`<ਔ "@  "ʐ!``@9 ) ' J`  *`  @(͐  J"`DJ  "`  .  * $ @9n ?.  J` "J` @l @? 㿘 ( ')<% ༀ24  2.  2  J` "%J` 2!2   @ (  @!  2  @  @  2 `@ @ༀ@2 ! "! "c@ !@(  J` @*`㿘 ` J` "J` @?  "# `'# @ $H@  "`L@@c` $HH  !@8ʔ !@Y @# &0! L@2  b ,   *  @8?, H 9 `L 0 @Ɛ #@q@ba|  $H@f @br $H@   `L@W@ba(b $H ""! $`LH #aHT # 5@r#c01`" H b ,   *  @8V?,  "`  , *`` 2` `@8@ ?,  J `@>㿐` #aL c@1 @$@$`$``$` ! ,   apA `$ ,"%"`$@m` `2$$ $  $,$ $($$$ $ $"$$0$8" ,"`$@ ` 0@; )`@,@ @`# |`  @@Sa @Ȕ !`?"$` @C"`$`  J ``   `  $@` `H  ` "c@ `@`jb@ܐebI  @ @` J `` 2J  b ,   *  @7e?,  J ``@ `! J `  @7L# #@ @7G b!@}0 "  @@ƒa"H "`8* @=* @6a` Pa@ @D`7 @b  # $8 " `" `"@# J `  b@**"0` %` "@*"@`2`  @)V"@'Y" @u  @ 㿐 c@ `, `@E" @ה 㿐 c @ϔ`,``  `b(  b@ސ  @   }X@3  @ 㿐 c @  &@ (    @2 2' @8      @v "? @p ` `*` "hT?p@  @Y   &@㿐 c@K @   @A  `*`  "h&04 `2 @ 6( @ @`b"h  2  ``2  @  @ 6  @ذ @`F"h @ 㿐 c@ @   @  `*` ɐ"h`  ` @ ̐"Ӱ "`0`\"`0  +)' "  2$ $  b  "E  2  ">" @&"2$` @s `"` @J` 2>` H` `  "c`<@  H , "`h#`h`@  ` #@В  @{ `h#`h`@< @_"Y0``0  ?@ $`"0` @``@B  :`@`(`H $``   "c@  H ! "##@`L @@_l#b`L  @' @__# 0  H`` 7$` @  @  㿘 ('  ` "  J` "J` 2  2  2 " 2  #H#P #X#P #`#P7#0  㿐 c @`(     @ 㿐 c @􀦠    @O ` @  `*` x"hB  (``    !%  !`  @ @ ?   "$  2  (  3 "@֒ch 2  @H  㿐 c @?`( '  L` "    @ @Д ? 8 "$  2L`(  % "@p`2 @$pА @  㿐 c @`0`"` "` @ `4㿘 0  !!2  @kcx  2 4c 0B `8 < " 4 7$`0)+% ( 0 "! " @6   `0 a 8  8cǐ  & 8@& 8<@ (㿘   0& ` 2@ & 4`"@@  㿘```$``$` J `"`` @ `p  "` ? @2V$``$``"` @21 2]`` "` ` `x$` $` J` 31 " H`/#` ,`  !@(# $`h`($`!#@ L 6` @@][ Lc# `  #``<# @l$`#&$`4` #` #`$  @lc`4  ?S$`# @C` `2`4` ;$``4 J` ` 2`(   " * "`(@1f `( "# `,# " `  "#`$#" ``  J `! ` "  @Y"@#"`   J ``@-@k  (     2  2"@0 2 @\?vd@V?(  0"   2  2 0 h @ HV? ("? $ ( ,l@@ $ ,?/!@$ ($ , (" $ ( ,"@ $ ,"@ $ ($ ,p  $  $t@@ $ $?/!@$ $ $ " $  $"@ $ $"@ $ $ $ @r Hd ` $   `    $@?@  4h@"㿘 2 0c 0`  `  4@`2` 4&  ``" &  &   &  ? # c 2 8 n$  8`"  @2   ? $ Mc  @` & L  : 8`  2L @r L  -`    ' !  `"R``2 2  D@!!  D@0 @! D ` `  cp@` J `   0  8?& & `"8@`8 %!' `' 2 4  @$i`( %   ?` '  0 @' (2 +" - 0 З*'; "     `0>" `09`H *  `"./  `P@d @#` @@$, X`  2 `2  `2     2  / * @dؔ @`` 0  `h@#; ``x@#`` `@#`2O $` ' a`@#֐  '   a` a`@#   ; 7  3 )' " /- "+逦``  #\#\@#2 `Ѐ   @#     ڀ` 27  "@#xb %! @! ؁㿘  * &*@;ސ`(  4 "  2 4( |`   z 2 p`:  %`m k&@L`?F#*` € ( ( V` R`0T@;`( I  J 2 @` ( 7  0 "  @U  `"`2.&@-    2 0`@ (    0`@U 2`` 2 0`` &@ 㿘`P "`P`k l (`" & ` 2@`"& 㿘`T "`T`L @㿘 ( (`@2 @` 0*" 0` T @"`"T !   @  P`8?"`8 P`,& # P#`,0" 0((2`"`(0(""(("" """㿘 0   "@蓒 &? 2  G@ G G G H ; @ J F F ID G I H4 K$ L L I X< XH XH Y Y XX X| X Y c d c d d d d d d d d d d d d c c c c c c c c d d d d d d d d a a d d ` d d d ` d d d d d d d d d d d a d bt cp d d d d dt d d d d _ d d _ ` d d ` d ` d ` d a d a d a< aX ah b b b g\ gx g h h h( %!''(593?'''' @' '= H ''&X' \J   , B% ,   `HJ` `\X " @ 2 `H " # \ ' \ \`HJ` `\X " @  쀦  \?' \@ `H`$  ?"`$J`7 "    *` ?$@s z͐#t- €J $``H$  ! [J`  `\X " @  o   !@ h`?< a &`T   ` `? -? &`T   ` `G`? &`T   ` `?/()`HJ` `\X " @ v    2,@@ @,@`@ `H,@ ?; ` *` ` `@J`!`@  [ `H @P(@`H" " <"" &`H@  [? *`< *,@:,  @  $ ,,L  ?$@, , L ``H`H @(`H" <" " "_&`H @ + ? ! '`HJ` `\X " @  ( ,`,@  '"   \ ", \0:9 \`HJ` `\X " @  K ,, \`' \ @  %8  , @ ې %)  \ `H ` $? ,: ,J` `\X " @ t $ڐ  \ " ? ` ͐ ?Ȑ ?$@  , \,,J` `\X " @ = (; {`HJ` `\X " @ ) (  @ c %  %  $ % @  2 @ N %  % %  W ,,@`HJ` `\X " @  : # ,,`HJ` `\X " @  # %@   @  %P @   @  %A  `* @ 1  , X,?$@!,`HJ` `\X " @  * `2, ," X ?$@ , X,,, ,, , $,@ %`H  @  %  ,% J 7`Ѧ @ @ 2% @ 2`H``~ ' ?2@ l , \' \ " \?2@ X   ?͐#`* € ("  ) " ' \.  \  (  $%  ? % %  %  % `' \%  " \% 2    %  '2  \% ?' \  2*,$ ( )   % 2, ? % `HJ` `\X " @ )?2@,%@a   $ @| , (,  % %%  } *?2@Ґ  } |?2@Ð ؀ (0ڀ ` \,2,`HJ` `\X " @? $", \ " 0  ` ,  2,  \, ) (  ?M% `HJ` `\X " @  ) @ݐ6 '4 '  0%  \ '`HJ` `\X " @  Q, "  @! %  , \`i' \9  % , ` " \ , %V & `HJ` `\X " @ $  \ " `  , \, ,,+ ) | ,?@ؐ ( , * , , @ % `HJ` `\X " @Z _?$@ې @3!" < > L@ ~ ``* @v ` L`?$ >`?$`HJ` `\X " @  <- & >* &  >  $ 28$`HJ` `\X " @ - $@$ > <  $$   > $ | @$@$$ $" !2m,2j, )"߰ ) ; &`H ( 4 %7 % | %`HJ` `\X " @ | ; | &!,!!!( &&!@? J :``HJ` `\X " @S (!@!~ %7$ q"`@ cH `@@ J@  ` @,@`@ `J@ ` @w$ 2,?L? L? J!@$ P@%    !  }   `. * #H@% "$! `H"!< " `H @( `H"<"" " &`H`e?! % @!㿘  c   @ `  $`㿀   '``\ "`\ !' 'y! ''+-  $ ` `H L@!?$@ , `HJ` `\X " @h`ڀL  `` 6@-%'@< ?$@ Ր, `HJ` `\X " @5` ߀`?$@ , , $ `& `\?"`\㿘 H'H'L'P'T'X`?  H `<`? (`<"HH! "!"K  @d"Đ㿘ΐ @ "!?$`$ $ $ $ $ $ $ $$ < $ (!$ 4$ 8! 4$ 0 $ ,$ ,$ 0$ 4$ 8㿘`H @J  $@``t$@͐#*` € "s!@h@`   $`$` $`^$@` ` " ""$`$@S$`" $`$`M$@`$ `< $$H@ U" $`  J`"`<@Z J?? &`T   ` "`<`<`$$H 9$`$`$$ `$H "$  ``$,`,`H $`$$`$`<$@$$HH$@``@ ` a``<$H@`2 `$ "!$`$`$@  ! @"@"@J  s$@㿘 J  ` 0  `?   $ @  ,8$@  ,,&` &  # " "b @x ` J`  J` J`  ( & ,F+ " `@ɒ ? & ?#+% , @"@  `$  `t `"@$ϐ  ,"  J "   0$ ," $٠?@ @ ,Ҡ? `@ ` %`H #` """ @w  0 && @$ 0    2)&@ %&# #̀`2JJ ` * J  *`  2J    &   @ 㿘!*` @Kz!@  p㿐 "#̀ '0*@,!H@-! @ ` '` @'  @h   # "`ʝ @ "`@ 0@,Ԑ!P@-!$ h %!'N     ިN  2  ר  @ *: ` ` `   /   `  : @ `? *:  \_ !M J :` ߑ* : `V;*`͐# €( @K@E}` }@XL`{`$@X@X } 2,@@J@Eߐ̠$@=7@X }  $@0j .@0$0Ҕp@ @{    #`Ӑ #ѐ $ // ݠ `@J@E̠x@J@E̠@J@E̠ @J@E̠@<ؒ$0 ac "h@X< `@X7 `$@X9 @X, 2,@0Ebh%@+А@,!@+ː!@,@sa@X8 /@+!@,@X, _ ~@+!@,@J8 L@ /@+@, 2 @+!@,@{K@W$0J H`p H``p" А   А ( LLX@1$0$*`:`*, : @#$ \///  /  LX@ $@so`( @6W&@!$@0M ! !(  H`p @@sO` @&$@6&@  @-*2) "%@$ ` "`2 @ "* "2 "` M (  @"Ѐ`2'@ %! @!ȁ㿘  㿘  㿐 'HJ  \  X`" @`kΐ!(.` €, :  #^  `* @ V  S  P N   *` G`, :  [A @U 2.! L #?&@D  .L  ``HJ  \  X`" @   *` ` `2, .: @\ 0 ?&@ .p 㿈   ' 'M (' '')HJ@  @ \ X `" @U?$@ِ,`: , [  ]":`  H, $$&`?㿘`X ?"`X H "a ` H@` "@`( * *  H " " <"$ H H㿘 \`  H@J  7"@`X   H $`XJ  '"#$`X! H@J  "@  \ HJ` "   H $`X㿘 `!" !$ $ 㿘`~&``& !t(@G  t "# t t`x" 9 ` # t @)5!耢    d %%<#   "$ @ 2$  2$ Ā@   @$  2  x( d` !] `  W  @$` $`@’  d<  d$` d" 㿘#@>```@$`` 4 @U : , @U % N? \ @p ?@s  L  @T ? . @` "$`㿘 % # ` (` $ $$ @Q 2 $ <  2$ $ 㿘 @)! @)   " .!@-  | |D | |D | |L |L |D ~ ~ ~ ~ ~ ~ ~ ~ @  "" @!" `M   ????????'7> @'T"`'@'' @)@>/ "9  @  # @  d @  @-   @ @`'\#` ; ` i  2#`   Y  2 $Ԑ  @      @$@' X@)9 ``  *@o*``?@@T"`؀ ``@TbP ``@T`      *"  @+ "  *`!   #`  @++   `@c"`"    @+" *" @'g @(aL /@7@ !@1Ѐ  @Ѐ@2 DԀ@ @ ( J@ @   J@  "!@( @wn@'. @@) `@'( bh@( `6`    @ @;% c!!"@@'!    @'@SF # c@(o @ڤ    @t@w'   , ,  @ 6L @x  ఐ 1`. @ $@$` ! . @ P\%``L % L  !ఐ `. @  $`   @  0   $`   @"c@@I<` ⽐!8` &%`` `, a@$` ㋐   @% $` @Xw \@Xr   \, ,$`$`  $`$`"$` \@ѐ h<     J `"L @   L  @  , L ఑. `?``@&""&@ L ,  L , J@ 2  L aHv  L  !x @x L `2   !  @l  J ` ! @b 0@&!@' ̒ J@    @Q @@ 2  @% `@&@  !  *`  *` J`  @_*`@  㿘@%ѐ!Д   #`@& !@F` ! # @R 㿈'D'H'L'P'  @  0 'v?L   `''0''@ ` @`  3L "  @   " "?`ܐ *` € ? #CP` #@`5 @)a L 3 "`H" ` `'D`" @` " @ @T`  `" " 㿘  `"`"@@ 㿈'D'HD`$ J* ''` H@  H' '@쀢 " ` @`&  <?`/*`ܐ  €쀢  2 "Ő"J )`D `  D "`D "Da"" " H@ @"`H@ aL   % t`@ D <`L  D`$ D`$ ?"`$쀢  RD D@V BV .  L ?'`ZD"  3`    D&`"`H '@.   L   D $` ˩ "c@ V  쀢 ` 2"`@@Z  "`H@㿘  J `    "쀢` " J `  !"@ ! R`ܐ ԓ*` €`@_4   ` 2`@  㿘#` D+`44  ``$ $ $ $ @$`㿘 ` " `  `@"` @#@` "` ` , R@`" #  $` ` R ` А @  ` 5 T@ ( J *``  #@   @e`  ", @ @ @Ձ @ @D @ .c@@ @;$`㿘  "    ,`R@ `@v`$  ƒ$   2 " 㿘 @ @  㿘! @`@ `h"`@㿘  !  @2@  2 㿘@ / 2@Ou r  @AbP@ 㿐`J c b;"`@D `@J@ )"` @4 ` @J@ #?# * * 2 `@ ? 2`  #(( 0@@c    @ @Eh@#H㿘@@   @ @EV@#H`     0  3 J ( 2J  㿘 – @  2@ `   @  2@ ``2#PÒ #` #p #x # # @#!㿘 ?#,@҈ @?,@v" 㿘   @ji k@N 㿘` _`@* 㿘 @    Z$  &@ $$ 㿘# . @ " @Nv   $. ?㿘 .`@ J ` ""x@ rh "+Đ"Ȩ#'Ȥ  Б,` "`@i$?$Ƞ @'Ȣ``$,` " @ 0ޜ" c !N " `,``"`ދ"``$(N "ބ"h %!c  '` J@  @K@ " *  $` *`5! @ "㿐 J  *`5 4 0    % * * *  * ` @'@qJ@-  c@bx   *     ` * $xJ  `   +bД (@Me@i7!bؔ *@M\ @i.  c J`  ``  ,@`" *  $`,@*`J `-   @׳ / ",` J  -2,`  ,`  @  cS7뀤`A2  `o`?`0* `0'? ? ϐ8  O.  , R @/#iꀤ`s# # `  $ %J`@2`R`@ %P@>耊 !`ؑ*  `J`-`+`J  ``-  J `2* * #ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%/J`#},?bܬ &?ؑ, `2 *`Ȓ$ @f ؐ*@'ɔ ؑ*`" ؔ*`2'؁㿐 @*N J`2   <#$&@  㿘 #()P %!' `+ @g@g@@* 2$  @ `C@L`?@p @#8㿘   U + M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  c@@K  `  | )`02 `  2 *  ``?㿘 0퀦   @〦   ?" ` [ * fŀ " 4 Z`"° @  ?    @ "   ? 2 @   2   2w  @ِ@˔ "h   ?g 2\ @ U  N 2C  @V@ M?J  @, @ 2        @!*`?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #   ) |?? |2  2 ` `@J c@ 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@I "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@I, 2J N :2` `&`O.` #``#`#h 5cH`:`;:`,@+`?`J N  `&`3&@`;2N.&` :2` `&`.`L : #``#`#h cp˙<``  "ؐ!1 ? `#@* ?`@ &`%&`2$<`@+`?`K   *`  &`  `* @`&`&@&`<`㿘L   *` !2 L L  *`a" L #0/L ' #%1 `'`$ "  " ?L@Ւ   " *@`" L  `#㿘  'L`+ "b @o " @@o` ` @$@m=@n" $  @,  `/-+ "@m(@ L @>@7a @l@&ڠ  `㿘`' @$  `@L@ "` @$& "$@fL@ $,㿘 @?  @˕`#@ˏ@   @˅"㿘 @v   ?  @u  ?  㿘   $`e$@`  @cS` f ~`㿘  `  "!N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@b"@@bz@J / /,  $'" @b^J / /,  @bȐ "@r@bE "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘     "!@bC  cЀ #"c`P$``@a  "! ^`㿈@b"` ' ' @ ''@  @2*@ /*@`*@`"@㻐 %!'&@ d_N /"N Z@F / $@@aߐ  N .G 2 N .2 N .  @ (;N@ /@ 4  /&@.@` @" h@a;@.@ @cؔ# 6 .@ɦ`" O / @ " 2N @v# x ļ ļ ļ ļ x ļ ļ ļ ļ ļ L ļ ļ ļ ļ Ì ļ ļ L 0 0 0 , 0 0                                                                       㿘"! 0ɒ` `0 "$`,$`$@$`(@VӒ   4`  @s7@k,  ,ذ 0` 2@\㿘`"`` @s   "`  `0`0``` cƐ    ! g`&  d & ! 0]` 0& b `  & ,& & & & & & & & & (`&& $ @rǔ 㿘`"`` @r   "`  `0`0``` co     ` (6 ``  & & & & & `& & & ` &&& $ @ry 㿘 `( ;1  0ޒ`   &,B B `$ @͐?& &&&&(&&& &&&$㿘   @H@j0 &?"$ ,0 , 㿘  @,@j &? ?& & & & 㿘   ` &  @  & * & " ,㿘! 3 1? 6`@Ӵ h@T $?"@  *@ &  ;    @I  & & @ @ 㿘!   6`X~ h@ $?s"@ `l * &a `G d@$@2\?  ,*`   &  " "@      @  + & & & & >& @7  "@ % @P 6$@`  (@& & $@  &  @ac @& ?ܢ@`  * && &     & &  &㿘!2L  6`p @ h=?@Ɛ $8"@ X ?2-?  $$      $ @s`2  "    ?(@a$ $ $$ $  $ 㿘`Ҧ `` ҟ` 4@]Ĕ @"&& &@`@ ?@ @$@( ?㿘`i `4 `0 \?(  @!,@@Β " $  4@]m&@ @"&& Ң@,@㿘2 `&   !? ?  $ @`$ 㿘@2@` @('?"7?``@` 2.?i ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@?a ?"B?@ "-`` /aѲ @(@R?`$-"6` @K`@ " ` ?(@@&@&`$` @  逢 0 2 ` ?2`?`?&`*@`&`㿘 " ?@]@㿘a0f `6aH ^ `@@`4 @\z$@@"&&`: ?24?@ $`@⤐&@&@  @C 6$@`  ?(@&&&$` @\=@"&&㿘'L'P'T'X@6Lh'P'T 'X` a` Ȓ P@hȖ'H'L'P'T'X  B H@H %! '`  @, `:  %"N@ `2  & * &  `   U`* : `L#" *` €CA?"<@;N@7 261N@ -+ )  *` &,@: , ?Ѐ`  ,@-,* :`@  ?Ѐ` "N@` & , 5 ۦ ۑ* : `S Г*` € Ϧ쀌 * : `Y` |*` €   ,` @Ȑ 0,@@gb 2 =  u< -7 +20 -`   04  ,@" 0"!!!`   4  ,@  x X,@ 0,@'@$@`!@[a ` // `@@d`%@ @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ò &   @*@`& `  @` x 0  ?*`:  `&   @*@`& ` @  0`', `2 < `& * & `,   `  ?L@r &   @*@`&  ``$@, `2 < Y& * & `4 @, Z(? %! @!㿘 H!` `?@}$    "` $ A "a!` ` ` ` @ $``@ 㿘@ * #%@   @ 2   @J  @C $ ` $` | |$ސ $`㿘ϐ "#%Ȑ  !@P   @ ` $`ڐ $!瀤! $`㿘  )+ `a% ۿ %a  `@`H `瀦 0`* &! ; &   @ؖ 2 2  @Ȗ  @ $ % 㿘 `  $ u! "a #!a#& `$  ! `  @?`?@ b ` & JH`  &  #Ȁ@ `⫐!"@"& 㿘 !@ "0 5"a@ 㿐@X  @ @T P!  i`   @c` @'''  @[` @'''ز  `!%` , "aaaa sЀa!a `{ a`(   ,  na  00"  aaa  %`~̀a  %``?  :` 6`0 @{%``H $ T耠` "@ :` @`! $`  %`ڏ%a"a`(c!0i`!,% צ%`ؐ" :  " :  2  @W#H "4" :  N #`@֢   $< , , @'''`" '  $< , , @'''`" ' `" : ؐ" :   ؐ" :  " )@o  %` %`  (є )ؤ {̔ }Ӥ@Ð `H$%`  $< , K, @''' `@ )!"@`'!   $< , ., @''' "@`'@  \!<aD'%`'''''(!" @l @X!`@     a "" " `f#H$@;@A@$0$@2a   @? @$ $@6 !"  $@! @$@@#  @$$!  @,!  @   @s    @i    !` @~!$,!% , ` $ % ,p$ T  ;   $< , ^, @'''"@`' "@ N$  $< , B, @'''"@`' "@ 2 $K` G`㿘` !"`ز "a! {! }@  ֐ ` 㿘 Z!@h ǐ  & @ @& 㿘`  !&  ,"a!!  &   @֐ @=  & &  㿘`  !$V  "a! {!  }@     @`2$`&  $4 $ 㿈!  @y` @'''@  `!$`  "a( $`%!Ò  ఠ$< , a, @'''" '``!$` %!|ݐ! $` $< , <, @'''"@`'ఒ"@, &   ) `` & $`׶ %!0!!k 㿘@ >L #  *ab(=b(J 2 @[  H`& 6 `&  {?  "`` ` ^2` /& @@ `& `  `"`   ` :"  @* `* `* `"``  "`  "@ "  `` ?2`㿈!  @` @'''`  !$`&  "a;: 8$`%  $< , w, @'''"@`'` $` $߀ ;@W " :    l`  ,  E ,   '''"@`' "@ 5㿘@" " " 㿘` P@ "D`"D T` "`@@Ő@_P" `"T`" `@ 2T`㿐 #!"`쀢"`" DDD  H" Ր  ( ` 0@D @ "@R` 2`@  //8  @ݨ"" H" "   㿘  `22 " " " " " " 㿘 c" H""#  㿘J 7`2$ N  `X@8  ``@8 " `h@8 @8`x   2 <   "  " $ 㿘 ` $ ` @ AȰ "a!   J#H @ ``H`D `A`9`7(3) (` ` `     @֒` H    ``@8`? .`,$ 2 ` .` @``@`*```$< , ~`, "``"`@"``@" "@㿘 `  $ 1 @"a!!"$ $  @`* ``$< , ~ , "` " @"` `" "1 "! 㿘` & `@ " !" ?#` .` "PJ@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` ~V  @*``@$.`6 @] 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 ~@ב*`~㿘T  ?%  * @ @N N@@2   @6 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@6ɒ .2T* `2L`T TX*`T@Rf }h $@$`$`$`$`@Q`4$"R`"`"      㿘 @6u`㿘T`  `}'* T``  "@ 2`T` &"@< *, &㿘! Ф`ؔ""b $ " """    "  T t!a 4#"a$$ "`"` a`@"$ T$ t$!$ 4$" $@ @ @ ` @! @ݔ 㿘"!"!Ԑ!`@Д )㿘@# "b  @SՐ  $b "`|0@S@"㿐 `* @X D A 4@ 1* ";" %  /`@G ,@Q` # @W  2 @6  @5 @QK  @'  2  @5  ΰ  㿘. "@2@ $   @" t" |"   2 " p"`| `@@"㿘 |`@4"@  "  @     " " H2 @  㿘 "   `" b " " t @" |"" p"      "  2@ 㿘  & 2L " @ "#@- ) "#@'  " !  & ~&  a! #@#$#@  !{` &  & 㿘" t"`|" pb  $  "   J@ 㿘"  2 ` 0 @i< 㿘 !{g   & a` & N@ !    "@& 2 ! J *` π&   &  &  @( 㿘  `    @   `  @    @  㿘   @ 㿈< ";     a@X 耢 `` & &     J *` @ "&  & !  '& ''@WՔ  㿘  2  a   ` π` & ` `  0 `  &  &  T p d d  , h 4 l @ `  X $ 0 <                            x                  4                 4  D D       @ L L     T    $ < D㿘 ?* : `l ē*` €   #@a8  2 @@   K#@a8  2@ P  `@`3  h p@| *:  !! x @j @c @\  @ # , @a@O  , `2 Ȕ @?V 2   @5 ` %)Ȑ@*   #@ a8  2А@ @! @  `'-`+)@` "`"  )  |@  2 `@b```  @ג`! В@ϐ 8@ɒ`    В@ (@` `R@ ߀` В@ @@`'"P*:  `"`"h X@p@ x`@  `@@|'   V  ""  @e  @] @V `6@   @@0`@ 2@ @  '@   `    7 L @(Ȥ @ 2@א 㿘 `       4`  @ @ `  @ `0ﲒ?`.!*` €Ѐ` "而`@"  `@В @ɒ 2  @80 !#!8@㿘 `    ^ $[  @W0 2   ^ $MJ ?0G㿘 %N  , 4@€NҰ NN`   " ` $ \%N $ (N`&* : N  ) $ ( (N` * : N  ) )  + " ( " $N`{  {ݒN  sN  NN }   }Nư  ( | )~N㿘'P'T'X@P h'P'T'X   B& @P셐`N% Nŀ`:~!d*` €zL s *`v:  L  iN(bdd 2 `2 G `? -,L K *`N:  L  AN9! ;  ;7 4+ /`  (?  $N ?  N@   Nr㿘 i vm 4 4V  @^$$ ` $  $ ? vN$  " $@@@$@  `$@  $   $ ? v-$  " $@@$@  `$@ " @Ȓ$ $  $ $ $㿘@  "u@J㿘 #N + * bP@€N  N N  N`  ?N  N?@? ` 2Nՠ?N?c  NhȠ   ʔ B#N  * b@€$[N5 N0 $ (*  : 'N`? ) $ ( (*  : N`  )' ) $N`{  {N  N  NN }   }N  ( | )N㿘  & ?uE  `- u; $@$`$ `$ ` $ `$ ` "` %$ ` "`$ ` "ߨ$  ب - &㿘 7  " u8  " u0   u(  " u    u " @  ϒ ̒u 㿘  " t " t  "tt  㿘 "#  @T-?$##H$c @? 6 @$c@$ cX @3V    @3O   c 01 @\  $@y@#c  @[   @h@#cs @S?$@3>c@SԐ㿘! "# @S?$# @  l 0         x                  \ *P * +L +L +L * * +L +L +L +L +L +L +L + + + - + -0 -@ -P -| , , , , - , - , . .| . / / . / / / / / / / / / / . /㿘!  Ps`s$`  ` #$`$` $```$`` $`D$`H` `$`L"`㿘 ```L"`T`?,` `@!"?@`@ @ ?@ ?<` `(" `, " `0" `4" `8" `<" `@" sఐsĒ`㿘`!<d #`  @@ڐa<"`@`" 㿐&@@5 @1L@ [-@ ( &@3`` `s``$@ o 􀢧(&!@.`si`㿐! `L@ ` *` h  "  !` " $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@? $[$"L``U߀` "!*` € E$  @$  #@:$ 7$  =$1$ - =@*   0L 2`@`@]$ !$㿐!  K  *`   $" $ ;$ Ӕ`#    L   " L" @ $""$ $  @k`@$ !$h %!'"@  "Z!b S @!x!@  & `" ?.@ ?.@R `  #?. @̽ ?` . @Q ?.@ 0 0? -.0@@\ ]`! @粐!ȁ㿐@ ?2!Ё㿘$`"a  L  "!"5 " @ @F @@ a   q &  ?` &@@ @ & ` &  2   !&@ 㿘"2&  """`"`  "`  !&@i㿘! @  `"?" &@ @2  "!   " `0 *`L  "*` L`x`X@   `02  L 0"     *`: N  & T`-#A : 7 $4?? 4 * `,  ` `  ` `   ` ɴ? 6? @Nܒ ?L 2 &@㿐d2 b  & p  `& & "!&@㿐@Er0@ "$  `pg0@[ @3@ "@(#@K? &`T   ` 2#@@ #@ @ @@ @`* @" "0#\" !荐, N@? @ &`T   ` 2`@ 02`N@ 0"`b8h `@D@$N D & %J T `@ `  ` + :  `<*  R *J 2J0%@#N  & %J T `@ `  ` + :  c8*  R *J 2J㿘    @D@D  &o@& @D# =,  $& @D  o㿘@P " L [ =@ܐ  @  6   * @` &  L =  $@  J 9`a @( b@@( bH@( h"P*h6` ` .@ @$ 2!! o<`@y  p/   b@ b"2   bb "       ?$"2` ?$$ `* $ p$ p@2$ "   `"  ? " n $  ?$`"  n̐  2 "!"" Ԕ  4& ̔  b    ` "  !㿘 " n @` `"&  ` n n~ `& `! @ a&!@'㿘 `* `  N* `2 ` [@| 2J1 (*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈! !m`!'''  PT? H? ?  ; gL  Д " L@ ?"@ L " T  y&Ґ $< , m, @''' " ' 6L2T $< , mo, @'''"@`'"@ m_㿘 "# `@J㿘l!<  @ 2`㿘!<[ 㿘ߐ ?`F!*` € ~`9&@| aH" 1 "c >&@I?* !@C?*  >& >&  cL >& !&( ?`"8*` €# c !l I $c 0~Ғ L """ ~&w\   0#`L l˒`$`L_L /}@Rْ  x@1 s<  m `h$`L ~&*:d9 `T/;8! " J$" G$""$K ~&!4& ~&@I " &"  ~@&r$"!H" `&  "# ~]& c" ?"La&㿘Ԑ ?`/"|*` €! # 1l3  c֋ $#E 0"`  " "b1 L l` & Lϳ 0ې 0 㿘@@Ր` @ @$@`0$`  "` & " ` 2` `k `@$ِ @ ~$`$ `$ `$ $ $$ J@ `]"?["J  ][["  㿘 [@$  "@㿘@$`!]        7 9 :( : ;| ?d ?d ?d 9T ; < E, E E E E D D E E D D E E D E E E E E E E E E E D E E D$ V V W W V W W G W M W M W G W W W W W W W W V W W W W W W W V W W W W W W W M W M W Ql W W W W W W W W W W W W W V W QH G, H W L8 Lh W W L W M8 W W W W Q W K W N I W Q W W P IL W W V W W R W H W IT IT W W L W M M M W W Q W K W M N W P O( W P IT W W W W UP Y, [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ Yh [ [ [ Z Z [ [ [ [ [ [ X [ [ [ Y` [ [ [ [ [ [ [ [ [ [ X [ [ [ [ [ [ W [ [ X, X [ [ [ [ [ [ [ [ [ [ [ [ [ X [ [ Y [ [ [ [ [ [ Z, [ [ [ W [ [ W X [ Y, [ [ [ Yh [ [ [ [ [ [ [ X [ [ Y [ [ [ [ Z㿘h(@ΐ@ڐ H%    $ `$@?5 "( "X` `2`@"`   ͐ P җ   !` @ ?@(   ?!!` @ 8`?@!@Ar!  .! "  㿘 "`  !L*` €! "+  $b ^@ "b ?bဢ 9b݀ @X$b  "! @ '"b@ "@ b  ?π #!"ᄐ?В "$b!P*  #!@0 $b@ ! /"` "`## @ Ĕ ?@  b  @!!"` "`@>R"l"l@  0"  !`@ ے @a*@ "@ ʐ n$b? &`T   ` ` *` * ?Y"!P* `Q"?π "?В "$b!P* JP` l#!"  6 4$b? &`T   ` ` *` * ?"!!!$!!@G $!!P* JP` 8#!"   @$b$b $b!P* ` "$b   @c !Ā  J!؀`  @Z/$baX *@ !@!Ɣ ( $bbXbX 2 ĀaX @  @"a "@"" @  0@/$b@  b2 ! "aĐ "" E  !' ?!XJ ?   &`T   ` 2  & TaX ?K `  ` " Ġ? !X@ @ᬠ? "@" $  @ " Ā'@ְ 0!X"* 'J @`  `@ @ᬘ M  - * ᬒ`"  *@ "    `@ @ᬘ ^  @* ᬒ`"  *@ "   @ @  * `" ᬐ  @ ^"c b    W 0X  0Ua$b@aP "   ?5 0G? ? 0B"` "! @ 4@ 9 !$b # $aa! @l!Ѐ " ߀   0%"`L!Ѐ`s`c`C @Ԑ   @2@aԀ @+@    @   @!$b 㿘 ""U?# a         #""b#b #" @$a@?    .       㿘 "X "X 2< "` !a` @ ɰ 0! ?#!"` &` ?"  * !``  ?"` `?#   #`@>#`  "2!!  "a" @>x !` `" "` "`$ !`@ , !   "  @>]!  "@" " "# "!~" a   "! C !x.  €o  "`"#,  " ! "  a  *" J!Ѐ s c C  aԐ?@I@  E a@ ϒ ? J A`! @  5 !!  ?@ +?!* # b`"  ` "  @=!`  "` !*@b  "!` ` "`  ""#, 㿘  %@  @@" @  @ @I }! 28"  2@ "`2@!!#a"@` @=!   a!# # #a@= @?* : `y !*` €@ O  `! "#0, 皐 #N` 3?  " JN`@" @ג J @:  ``""@  )e  @:"`,@`  @@:e ,@ ,@ $" "  ! b    ""`"  #  "" "    """b @ ! ` "`~"c @ a @" # N@N``c c @u !K`  ` `@f  &a?N@ c.'N` w W)!``J ? &`T   ` ! &`TK ?   ` 2    N` %  N@ c@@_N@ y@|" N@ c   a "   ""b   % # aȐ@& ᬰ? a` "? #` "    ""b % # aȐ@   ? 4  !` ?"`  ǰ? ! b     ""!! @! @!` ?"`  "   H ` ""! ?"@V  ""$" "     """bv#" "    """c @} a "d"! "# b@.@ "$bW$"! "# b@!"@ "$b"J$"! ` "    ""bN` 2 @ 6  4B?  ᬘ!  @ `* `? "` "      #"""! `V   "   ""@ "#@  @t ""! ` "? ! "``  `*  H`ᬐ "`y `H    " ?"ᬀ #(#0  8ᬰ @8 $ !!    "   @""b  @!`@ !!   "    ""b  @#!`@"!`""`!"!"# b ! @I" " ""r$b  " @  ?" "!N@ ""#(  "#(  ?N@`?`N% `?'  @Wؠ   Z?@@ 0T""$@$? &L? dJ   & T*`: ?   ` 2J  J  J ; ?8 & T J  ?   `   `T* : ?   ` 2J  J * J  ?2J$ '   * " L '    " & TJ?   ` 2  J  "  J 逢?ᬐ   b   " & T J  ?   `   @ǔ 2 ?@  ?   ` ?#` p"b! ` g% &#    ) %' %a  J@ @ T@ `  `  $b#H  <* HT `@ `  `  $b#H 8*  R (a` `??"`a# !! z *!(" a@U  J AJ B`"?@  @   "` !` @" 㿘@?* :  `t  #Г*` €!`?@ !`?@  a   ?@Q  a   ?@+ !` &հ 0N@ ""#$N` "! "#$ ǀ f Fc$ c$ a  N@ , `?a̔ @   2 0' `?`   '  `@ 6? `  4 0 a   |?@ x a   n?@A j!  ? b & T J?   ` S  OJ! ` 4 2C?0A!` < :!` ` `@_J@  $  ` ᬰ ` ??  @GJ@`"`耤``4 0?㿘 ?! %# "` a@`? ? ?!` ?"`$" 㿘&@ ` "!! !Ȓ@@8 ["  { ( ) 0"  } ]  0   0 ???㿘#a!  "P@7a"P`  ,"P㿘 bP! bP "@7" 㿘%`?  `;$` @4  $` $`  $`$@㿘`` @4 ` & `& @@&㿘 !`I `F 㿐! " ""`c#!"""`#c "`" "`   " "@ ?!    ""0#"(@  $"$#@ #@ $"$"b,$( "", "@`b?@! b! %"8 _&"@$"8"8`_"@$`"8 "@@4"8"@ @4 ( b "@     4+bH"L D#"P㿘@ 㿘`2 !@@6(? @4" !  &?@"  @7` "`  @7 `"`㿘!! " @6!&@ " "  #" ?  2 ?,? H 򀢠" ??㿘5 w??t &`T .` !`("E`T` 6A`T ("9!` & 3!.`8  &!`( `T! N 2!` 6 !` (@"N!`T`  N 2` ??2 㿘3a [??X &T? J`H 2? :` @(?,. `(2?% ,# @(2 ᬺ``TN 2  ?,  `(@"N  ??2?㿘 @gd ? &`@ a  ? TN a`@&Na @7@ (@ᬶ  `@6) (2` ᬲ`   T8 2`@6 . @. @ 2`㿘3a 6??3 &`T` `T I !`T` N 2` ??2I 2/ &T ? a H  2?a T & H  "?  2ڐ?㿘 @I??E &`@6  `?TN " `@&N @@`@6` TN 2`@&N@??2IJ`㿘` " @40?@  (""` c`P ?%@1$  "   @4 "`""㿘`"E? b ?@"=?"`N ^  Ĕ  `   "P@ !?` 0?I3a@1a$  " a @41a"`㿘 "D b8*@  @@1h t t @"  "(   "b$*H㿘  "L""L@ # @2bD $ 8* +  @rbD$$bD㿘      !  @O ! `  "4   㿘!`      / 4$@2  : a @" a ` 4$@2  : $!! @ 42`@:`$@ !"㿘 `@k@ 㿘! b4    / ) c7  `a  M - ^  (@` `   ,b4`@, `2,(`b4N`  b4,b4`@ , ` `b4@ `  2 ,,4`@ `@, `   b4@(@b4@ a a  4(@4@6   ,4`@   ,4(LN@@ "$@3sjL"$ %"$ ``a`  +` <  >NH 4( @ sG"$.H %"$"$@㿘 "$ + "@s. @  "(.$b$N@s"`"$ @$"$#$b$$b$s b$?@&b$$b$ "(" @  $b$N@s`"$ @$"$$b$㿀  )! "#,  !! a %!\$#,! "%!!#\#``` ` vu줒 @b?0Aj  " %!",9"`5 / + -  3 @  ""  2?@,`@@/w耢 `?!  " ``"`b  %%&&a 㿀 )! "#,  !  @  $#, !! "#,  !! a   %!$#, `'%!`  !#`#\ ``` u覒 `@ܰ?0G@@԰?s]v} 0s ',`@ v @+9 7 / 5 -  . @vt @8   ,`@+9 7 / 5 - @.ߐ @v+  " ",`?9 7 / 5 - a%!^ca"w& 2`  " "#,J?`/  ""  v  &&'"%3 㿀  #\  #`uX蠒  rѰ u 0@<?   H@     ` 㿘J @`  q#   q} ^ @qz㿘   "0  ",S 㿘@qe q]㿘! "  "`Yn`$"$`$`㿘@  %!'#!%+ $-/ i  $#@$c8 $c8$#@@@m? fc* & @ @@ǐ . @%<?@  <   $`@`@Y@@^?@$#@c@?2 @-ڐM / /-`?< @ /@u 2L ?`? ` L /"?* L /2? @- #@@[  @0>@  2  Ȳ@  %!X '@JP ϐ##8`y@>ʒ s#@` @>   %"c@-n0`#<`)@>  $@Ȁ 2  @Il8@Dn @D OA 9#  %"cؘ@-B#\` `/ % a`? "`@   $ `  %! ? $ @  $耢` 2 `y`Y2g @ _ @` @S `<  H@ @Zѐ ? @G H  @  @Z 0/ @IȀ `<   @5r  `@N  P@̰ !`<  @@Ԓ! @͌ `㿈 @"   #&@"! 6 #@@7 @p "@v @ sc0 )H @($0  %#4@x  #@s0+@[ʔc4@0 #4#@^@א  h@V@6@6f @6"@3",  x@A 3 &#8`2 @4@  @*@"L@ " @ `-L  @ #$@6''(#,@6''@3r耢  @@6i # @p   h@ 㿐'D@'H 2!DH` @y #@Ւ @ @ ? !@ɒ`G  !@Y`> 2  !84`@f 2!D`p @H!h#@!h@ @ ? !@ah  !@Yfah  2   !8ah@YY 㿘! # % ax@+gb b@+ba@А 㿘@ǔ t < \ 㿘@'  2"  @X "㿘@'   @ &  @X  &㿘 @' @'2   ."@, J-`?` J  &T*8  + J (J? `2 "@ 㿐  ’ 2  @'a $$ 㿐  a@#? @Xz  & &㿘 2  `?J@   ɐ "   㿘cH   8"cL ."cHL`*L   =!@ "#"#LL  `<" `>`! 0 0  "cL  "cL  "cL. "cD"L㿘a@; 㿘!#L   #D @#L  0` %a 'cL M) VT`@ZE "  @4!!@;Y  @^  Ѐ  *@ "    !ƐĐ@e%cL  @ʼ!㿘#L//    b@; 2` @2`& ` b@: @4 & @f & L Ҁ Ѐ 㿘#L     b@:Ɛ  ` `" & QL ဤ 㿐Ң cL sĐ D -? (?` X!!x*` € -@@J H @D B  /@1 3 `^?` -!!@*` €  @/0 $! 0 @/)82  @/#2   @/ 4 0  @/`? @/@ ֐ԐL      㿘wcL ; m    cL 㿘cL   cL 㿘a@g `@ ̒b0 "``"#H #L`"%  @"80 @"@@㿘@h   `N"#0#@X@gې`M`>䀤<  & ?'Ȑ ̖Ș @*n b`@U ` @$'̠ bx@9u  @(̐ 0''Ȑ Ș @*N b@UӐ @'  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @b Oـ  %"@`Oؔ?"`` "@*  #"@@WE "@`@ ` %@`?"`@ * "@@W*  㿘   %b@'"@ 㿘@㾐 %! '#' $) @6@gb耢? s* & @ @'@ " @'o@@ b@U/ @ㅒ! c@U&  #@ { . 2*#@@ǐ 㿘   %c @'O"@ǽ 㿘 I@ 8@ @o@6  "?%" " " " " "  ` %!'#@ @5 )   @k  2@ @!@v >Ԓ?@o@Vm!, @!,!,O@1r @א#P㹈 %!'@耢  `n @ < @ @ `0#$@U/@&  ДȒ$@O@&? @@@&? a ,@`; @TQ @ !X@``@&?,@ X` @3  @, e`e@  ` @@0 @0. :`@ z` `!@TI   #!<*` J@    @8!8㿘@`a@ ??@g @g @g  $ @0 㿐2&@$? "!H!P@ 9 / @.!`@A5 a#\XhP$@ƛ# P@ P&@ ?"`"? @`5phP@x$# @P P&@ ?"㿈   ?'  @' ?㿈a@某!x ~ c@%4- @ ƒ # 2,L@ S! @q Ja@  " @c L 0a@hٔ ` a   @K ` !a @떔x@   aȐ@$ a@) @Ԓ J *@! 쀥 @!А@ 㻐 %!'@%)c( @% ?":a!@ a #@ @`ax @9@;R O %@`Hb@$z,@uO  bx@ 0 %;9 ?-!+@ b0 @ "8 ,@D$# @" Дax@0@uҐ ޠ @t %! @Ś"@㿘N      - ) & T*`: ?   ` "N N  (*`:  - +s? 2Np  N -"* +*:  G D & T*`: ?   ` *.4:  .`M $ ?Ѐ`5`- @-`B2*@ *@B `5-@-B2*@ *@B  N   8@ @~ N #o>@s @o @k @g  #!a  K@  ` %#8*`@ R` 2O N  ? &`T   ` , @@< #?@ @  @  @`    @{    E>  (K@@ ""?㿐    2`` #!@3` + @0;   #4  #@h? ""! #a ? @3` + @; ,2& !, @@   @ @ `ʨ 4`,  ,`@B2`*  *`bC eC (0  8  `   &`F F?   bP@$ 9  4 ?`c ?! # ! 4 2  #` &`F F? #!JX@j  !J#``#\@\   %!'"p @Д "@<P  @Qې@Qה @QӔ!@@R!,!,@ H@- @z"㿈   ?'  @$ ?   @* J@ " 㿐'D'H   "-'N] `.`?: -@L2 Ǖ< 2 $ '    ?L@ "'`.`: L@@  @:  ?'  ``@ 2@u @! .`   &D@v  Y-: U R@ NHN D..`  L   <,@ L`  2,@L "),@L  $>   < "; "   2 "  ,@ `  ,@L Ȣ`,@@!H 2" %!p'@"#P @ " 2L b /$@ " @ " 'J  Ȑ@$#($@А@x$ $@*@o$$@O` J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @ .?'l@l l l@.$@ : ?L 2,? l  l%cP ?@??  @͐"㿐cP@x ?㿘cP :@t@ 㿈 cP///@t찒  $@@@ @&@  T 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 X 8 8 8 t 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 D 8 8 8 8 8 8 8 <㿘#X 1#*#N%Nۀ`M +#*` €``,`` !`c#ސ@+) d 0,@ dcР @+  0,#Ɛ@  0, "\ZN@ N R@P N @``` !#`#)'!#`"#@[ `` 񀥠#:1,¬ ``#:w1,@* * @  `` ?$@* $@Nf X$ @$@Ԕ:T1㿘 z N?  &`T   `  & TN,  N*  ?А   ` , ."*  N? &`T   `  &N?Р & TN?   ` 2 N * @( *` ƀ: N  c* 2  * #!: *`2`:`@: @*+ 1N#ƀ? N#㿈?@4 !? #b @ 聠"#c @< !"# 聠"#P? '?''   DD"# !8    "#m  ƅā"#\: 'Ԁ 7 Ԓ?'2` @'* ''  * '̒ 'Ԑ`̐" 'Ԑ ̐" 2@@'̑* 'Ԓ<'  'Ԑ `  2 @ @' 'ԓ: ' 2 @ @' ''''''Ȁ )Ȑ ' Ȑ 'А" 'Ȑ ' 2 @ @' 'ȓ2 ''Ȁ SȐ ''  1 *Ȑ ' 䀢   ܒ 'А" 'Ā ?'Đ" 'Ȑ ' 2 @ @' 'ȓ2 ' =c @?c-c @D??'ؒ 'c?ؒ ' ' `@'ؑ:` '2 'ؐ `  'ԑ*`@'''?聠"# t L $ Ť ƴ    $ Ԥ L \ t ؤ ټ ۴ ܜ ݄ d 0 t L T                                                           t L $ Ť ƴ    $ Ԥ L \ t ؤ ټ ۴ ܜ ݄ d 0 t L Th??'T %b@@??T  *`/D  'T cc0c8'c(? #b`@ !"Ȑ @ !  #b` @ @K@{ !"  'T ccXc`'c(? #b`@^ !"Ȑ @   #b` h @K@E !" ??ؐ 'T ccc'c(? #b`@$ !"Ȑ @   #b`  @K@  !" j 'T ccc' #b`b? %a? #b`@ "" Ȑ @ o @ "" 4 'T ccc' #b`b? %a? #b`@ "" Ȑ @ 9 @ "" 'T ccc' #b`b? %a? #b`@v "" Ȑ @  @i "" 'T ccc'c(? #b`@L "" Ȑ @ @? "" 'T ccc' #b`b? %a#? #b`@ !"Ȑ @  #b`  @Jp@ !"Z 'T ccc' #b`b? %a#? #b`@ !"Ȑ @]  #b`  @J,@ !" 'T c``' #b`b? %a#? #b`@ !"Ȑ @  #b`  @I@s !" 'T c``' #b`b? %a#? #b`@H !"Ȑ @  #b`  @I@/ !" 'T c`(`0' #b`b? %a#? #b`@ !"Ȑ @  #b` 8 @I`@ !"J 'T c`(`0' #b`b? %a#? #b`@ !"Ȑ @M  #b` 8 @I@ !" 'T c`P`X' #b`b? %a? #b`@~ "" Ȑ @  @q "" 'T c`P`X' #b`b? %a? #b`@H !"Ȑ @  #b` ` @H@/ !" 'T c`x`' #b`b? %a#? #b`@ ""Ȑ @  #b`  @H`@ !"J 'T c`x`' #b`b? %a#? #b`@ !"Ȑ @M  #b`  @H@ !" 'T c``' #b`b? %a#? #b`@| ""Ȑ @   #b` Ȕ @G@c !" 'T c``' #b`b? %a#? #b`@8 !"Ȑ @  #b`  @G@ !"~ 'T c`a'c(? #b`b?Ȑ @    @Gd@ !"N 'T c`a' #b`$b?cD?c(@l !聨Db?$ %a?cD?c(@J !聨D %a#? #b`@ "" Ȑ @ @ "" 'T c`a'c(? #b`@b "" Ȑ @ @U "" 'T c`a' #b`c(? %a#? #b`@* !"Ȑ @  #b`   @F@ !"p 'T c`a' #b`c(? c((@? #b`@~ !"Ȑ @q  #b` @ @F@@~ !"* 'T cahap' #b`c("? %ac(  ? #b`@~ "" Ȑ @ @~ "" 'T caxa' #b`c(? c((@? #b`@~R !"Ȑ @  #b`  @E@~9 !" 'T caa' #b`? c((@? #b`@~ !"Ȑ @  #b`  @Ej@} !"T 'T caa'c((@? #b`@} !"Ȑ @a  #b`  @E0@} !" 'T cbb'c((@? #b`@} !"Ȑ @'  #b`  @D@} !" 'T cb0b8'c((@? #b`@}` !"Ȑ @  #b` @ @D@}G !" 'T cb0b8'c(? #b`@}( !"Ȑ @  #b` X @D@} !"n 'T cbpbx' %ac(  ? #b`@| "" Ȑ @v @| ""; 'T cbpbx'#(@/ !? #b`@| "" Ȑ @G @| ""  'T cbb'c(? #b`@| ""Ȑ @  #b`  ̔ @C  @C@|r "" 'T ccc'c(? #b`@|U ""Ȑ @  #b`  ̔ @C  @C@|7 "" 'T cbb'c(? #b`@| ""Ȑ @  #b`  ̔ @Cw  @Cq@{ ""[ 'T c``'c(? #b`@{ ""Ȑ @l  #b`  ̔ @C<  @C6@{ ""  'T cbb'c(? #b`@{ ""Ȑ @1  #b`  ̔ @C  @B@{ "" 'T c`(`0'c(? #b`@{i ""Ȑ @  #b`  ̔ @B  @B@{K "" 'T cbb' #b`b? %a? #b`@{" "" Ȑ @ @{ ""t 'T cbb' #b`b? %a? #b`@z !"Ȑ @y  #b` Д @BH@z !"2 'T c`a'? #b  #b`b? Ȑ @= @z !""#x???'?'?  @  '?"#㿐'D'DD `D `??'':` ':` '|'耢 耢 d ܐ "# ܐ@'? 'ܐ ܐ 2  @ @'?'?c * $%D?c * &'??'? * '?ȁ"#0c: ' ܐ "#~2 ' ܐ 耢 ' 8  :@  '=耢 3耢$ D"#Q"#J%?2@' "#82 '  8 ܐ :  '''?c * $%D?c * &'ā"# 2@ : :*:       @    㿘    b`  ?   b`  8  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  #3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         b`㿐?  @  ?@ `㿐?  Z  ( B 07ąB' B'@    ɖ @> . 6`  `6 @3 @򅠈? $% 07ąB' B'@@ f  0  D'…B'@@ F #dd#dd`8 B B@BD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@   H4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@㿘  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  !H3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      $6 Kc@$ Kc@$ Kc@㿘` ` 2 `@ "`@um? "?` &``@ , :   @ * &@@<֒㿘 L@  .#!*#@ B@J /"J /2 L@ /c . /*c *"J /"" # 1#@ .@u  ?"` " (0 (`0" " #`@"    `  0 "! H P """  """㿠   @" &  g @㿘bH @<: x  ??''쀢'@t " ?# *@ @  '@؀ ?؁㿘@ʑ>@  $>>2   *` 㿘 )  & `&  &@G , 㿘   2?2?    `*`,  @S  ` `* ,  &?   2 ?`2? ?   2 ?  2? .2 ? 2 2 . `0 *`    2?  2 ? .`2   ?$    x l ` T H < 0 $    1@(+"X("h%""""## #8#X# # ### 㿐  ?  @  ?? % Kc@        8  h  P                     ` ``*`?`[`#?? &T 2&+` `  `  `  `? &T  +`\ @ +G` EA*` \+  n+ \+  r}+ \+  bw+ \+  aq+ \+  vk+ \+  te+ \+  f_+ \+  sY+ \+ Є 0+P + K+ ` 2 ``*`?`[`#@ ` \+0  00+ 0+ ` 0(+@` \+  M+  `? &T    ^+`  ? +`@+ -+ +  +㿘@N@:`@*``2`"*㿐N@ nl) & *?[# T@  ` 2%.    #    T@  ` "`. \  @2`*.?  `` N@"@ @ N@ 2.(&N@"&` N@N@"&㿘 N@`zN@8N@N@p "*$ Kc@㻈 %!+c'573/㨐@Ò$ @O`( b# 0@c%c )J #㨒@ & @ & @`8  @ @&  H P&  0@n찒 @+ 耢J `#@#$ 0 @V찒 @ 耢J `@ $ 0 `X@=c %cJ #"㨔`X@1 $ `X@, $  `X@'쀢 t$ $ $  `X@찒 (@۔ 耢eJ a`_#@[ $ `X@찒 @Ĕ 耢NJ J`H@F$  @B$! `@ ! p@Q * x@J #@@D `8@> "$ ``@ʔ @   h@) $ 㨀  @ O! @  㿘#`@:    1 #㿘@* " !@ # # 㿘@  ! @ڒ  # (!# 1@ɛ 0" @' Ā@<  @pn O " @T` $# @pa @㿘!# @$#p `   ''''''@Ⱀ@;''` '' @N 㿘@ȁ   2H( HJ  " H?" J  H  2*? " 2HJ$ Kc@㿘`@o? "@O 6`? -&   ,,-`@  6 @ 4ݢ2ت`k@ސ @,` @ѐ @,`  # @   @-  @,`  (5 : @@  6  @,`   @,` ڨ@ݐ $ Kc@  %!'P'L'T'X'''"`` ` @!?"77@ '' ''@NL?  *@ "& @'@n& "? @ߐ % Kc@$y Kc@㿐 @?.@ .  ?#@.   ?#. ` '@J  $Q Kc@$v Kc@㿐 #\@( %!\'D'L'@p4 @ Р L `@ ؒ  .``2 @DL@F\,`  @`  4`@ LD @@oȴ4` @  D??@ ?? '''@b ? `!#@i!D#" '@k #'  k@@n+`0?`'@n"`=" ` 9 @n /#\``! @ a(@0!% %a8@@m"@ `#\/`!` @p a(@!aP@ ` `@-` @m@E % "@Ӓa` @ @_?`@D % @m`# ! % %"@` `#"@ma@@`  @א @6?@$`@` f`@` ah@4 '@!'@ 4`* @ ^ @ vp @@f @4א@_ @ @m[@ %"@Xax0<@*6 *   +6`*`% `+ @m?%"@   @S : @m*`  %@m$@ߒ %"@!a0"@a@ @ @m @x %"@a@'   #\  @n  @ @g@cɀ '@  #\  @P    %@# %@!  %"@ĒbE@LL @4*@ @4$@ @4@J  "O@l@D %@"@b@ @2   @3 O`   @ @ % @@@ @ @ ? %! @O"Pp  ? ???'bX'ܔ@fԀ ?0@W 0Ԁ   @,   2 @B?㿀! %!  ?  ?'//' @ ! @"`  %!'  "p@b `@ @gY @c`2T? #"`"M?@* G $@v@C@b@Ŀ@`1@   ""<  "T`@ "؀` @" # "#@? @#0㿀! %!  ?  ?'//'@  ! @f#@㾈! %!'@N!?쀢`# =` ;` 9` 8 & %J? `T  J   + : `T `@ `   + :  8*  R  * J   р?ȐJ  7 *  J " "  J    & TJ?  J     J   퀢?*J  @ِ L + -L   @ 56 @Ғ -   @0(& L   @ ?@    @0  @T @OL@ + -L`  @`0 # ` @/L`  @ `` @/ @淐  ?@氐`?  ?  4  @ 2L? @;#P` %! '#\ /! @ 2;    ?ؐ ???''ԐbX'̔@>̀  &a@.! ̀  /  !#\ @ 2  @N   2/@̰ a @#`` %! `'#\*`Ф /! @` 2S  #\ ! @S 2F    ??ؘ ??''АbX''̔@ז̀  0@+̀ ̲ /  !#\ @& 2  @   2/ "cp@ @̰  @t#㻐 %!\' # @    @  *`@ а? @" ɰ?  7`4` @]#.``2 ##@H @Q# " @? @d .`2"@ː@- s@R   0: < @ 8 22``2`*`        ?#@2` 2`  2`   `? ? `MK``2H? 2@>" =?@ѐ !@Ӑ#@G@ΐ#``@@ (@ ?@ߔ "?  @   a@ ? a @#㼐 %!' @" (?@|`@@䠔 `@!   ? @ %@.*`  @A 㿘 ? ?  ? ? 󀦠  @J " @6 @ʒ  ?㿘 @@ƒ 2 `"   @Y    @w&㿘!Ք!Ѐ  !Ё㿐@[    􀢠 `" ` 2`22  @ @ī@g"h`'X 'X@%   %"`(@? @`H  @Ej  2 @Ed  2@ڰ?0&   @   X@x  p@ᖰ?0@ @@ܒ  @@֒  @ა | @[ @z s o @.  "@gd@  %"@``] @㝒`H !X@㗒 X J@ 2'X 'XX@m / "X`'`'X''@j0Y@T  X@m֒ / "X`'`'X''''@jw0@X#`@8 2@X'X@z.X ` a@   "a&a@k 2J@@'X@@m / "`'@ &&&X&&@j7@f@I %X"@גaԐ @ P@? x؀ N  @'$ aȐ ''@c@$$  !В $:$$    !Ā!(* 㿘? @h 㿘@ 㾐 %!'@R!`` 0 /@fk? .+",  @-Ȕ 6!?4@c44@ @h  @fP`0 4@, @L?2@@Đ?$ @&"㿈 ''@/  ($΄ Kc@㿘@f" @Ȓ ?2 @f`2?  @gs ? ? 4 ?㿘 %"@@0$= Kc@$i Kc@㿘 @g @eٰ? "$: Kc@$) Kc@x" '" "  @؀ ?  '?ch?#ض  @ ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @ ?`?D '#\   @2@2  x?@c? "@Ȑ a` , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@ɐ 2 `?$  ` , `4  ` ,  "J 2L Т` 8@j `?@0#@*SF ӄF @   "  ?b %!' 4 @/ 4    i ΐ d?cH @C ]@=آ   #\   @?@c F ؐ @ 06*` *      @ `( ( @c @*1  @+   @Ɣ@K?#\  @??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @޾ " L _2;`  @޴ 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @*" @ %@)z %! @"㿘 #" ?  , @€? 㿘  ?@g㿘@%$S Kc@㿐`w@ ?㿀@' ''''`0   `a ?"a@)㿈' `1 `#\ `!(@9 !㿘  0 @ @2@a  /"x %!  8 '#\@  @am  "@ݑa @M"H0 %!  '????  4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?@$'''', ?@''? ?'P ?# :/ @ 2: :[ ,2 :R ,, ,  , , @$ 8 @@$@OX $6)   @    @ :,   ",@` " @ܴ! @p"`$ Kc@㿘 N  .!*! /*@fJ /"  J/!*! *`@" J /2"  #1!@̔.@`?  ?"㿘q@hbm `9 1 *$㿘 #"( # (% Kc@㿀'@K ?''@耢 @&$" Kc@$j Kc@$' Kc@$+ Kc@㿀! # *` *  *    *    p #\ #`  "#h#d#l@b"0"0$. Kc@㿈'H'L'P'T'X H  !"@G('& "("@ @9 !  "@.(!!  #   ?'  @  $!! #bX "" $7 Kc@$8 Kc@$  Kc@$ Kc@$ Kc@$ Kc@㿘@ .  0``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+L@ 1 0 @G  2  `@< 2  `@ &@  & ڤ   @ba 2&  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@$ Kc@$„ Kc@㿐@!_!L [@  Q" J``MJ  1`M*`k`G`K`(#!!`m`g!!! !!% $!Ȥ$!!@$"% @!@$ W !"@$ a""!("@  &&  &&@"$Ä Kc@$ Kc@$u Kc@㿘"`   @   $b" ` %@  $b8 $" 5 b* @*`@*`@" *` ' "b@Zb * @*`@*`@*` @$" $" @  $b*` *  *  " * @&b$ Kc@$b Kc@$ Kc@$ Kc@$ Kc@X %!>' 2 #@: 2%"\! "\  ` @  2` "`@ `@z 2@ 2@C @ha @%!㿘 #"\ "  @p  2 @1!$9 Kc@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 㿘@@ @ @㿘c   @ %= %@c @ Ȁ @ׯ  &c c `? "`@K @  "@ ဢ0 TL?   ` 2 *:  "Π@ #"ˠ@b("b(  @*$`L $`$`@$`L $`@"("` "`L L % &a@ɐ  L T `@ `  `` ?$` a@x  L T `@ `  ``  $` aȐ@`  L T `@ `  ``  p$` aА@H  L T `@ `  ``  X$` aؐ@0  L T `@ `  ``  @$` a@  L T `@ `  ``  ($` a@  L T `@ `  ``  $` a@  LL  =2 L@n$`@%L EL #" L #2 "( L "  " "(& L "& @ւ 2,J A"62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@3 =   㿘1#  !@b&# @ @ 㿘1#  @a8&# @ 㿘 @w  @ @w 㿘#c!@ܖ  ! @Y"  %!'@۟ P @  X@YP< @ H D " .@ .` ".`  .`  .` .` E '  ?8h8 '<'@'D'8 @H 2 LH @ "@` @  @@  @D"((@A" '@YJ+@A' "@A# `@ @@vܒ  @@`@@B> 2@Af   Kc@"` r t0 t0 t0 t0 t0 t0 t0 t0 t0 t0 t0 t0 t0 t0 r t0 t0 t0 t0 t0 t0 t0 r t0 t0 r r r r t0 r rI @Jg" `8o-"H  XJ+"F J ?`F  u2B a00 `   +  *@+  *@  *@* @* @"    @ *@"  @  㿈M N?'@ｐ @-_ @-] @ﵐ @ @8  , M? `0 &`T   ` 3 @n J`@@XV " @  `  =@/*@ڐ@X> " @Ѱ 0 M g  o a *`:  u*` : mid8` :  +  - =`=*` }  ?* : ` n["H*` €$`" `" b II -@웒 & ? ?@ <@ < ="  +` -@{ & ? ?@  X@i  -@d m& ? ?@ M<@R?2 << = ``<="  -@? H& ? ?@ @-` -@' 0& ? ?@  X@P M  ,9*` .@T`g"*`o`= -`X`+`-0>0;`u06*" -"   +* ("  %" *2 ?* "  * " +-  =  *   - +  X"`" `: J@+-X2@   `J@-+`8  X`8  `( " **   " **  "J@" ** ʐ $! Kc@㿘'L'P'T'X@L㿘  ! %b@@"`@vԐ""@bH@㿘 @&@G 2 `   @&㿘!ߒ   㿘@ "P@Kb`&@@u` &` 㿘 @&@  & @& & & 㿐@  "P@'b` &&@@@  􀢠"@L@ # J?` '@ # $'`@Ӓ` ?@혐&&` , @bh "@, L "  " @{h ,@`@ "@J 2@`#@4@& ` ` &`@A   &`@UѰ?z@U9"``2& ,*`:  # "" ` *`?2$ @m*` `* &` $ &`@ & $@%h ,  "$L  $ 㿘&c㿘2#㿘!c< ,   ,$\ Kc@$; Kc@㼐 %!?  c ئ '` $ `7 @Ғ  &㼐`` H`8" H" 3 !/@X *`  @ *  " ` 2 @ޖ & @0  Ԓ @ %@ 8 "  '@ @0 X`%` 8M`8 @" E&88   D &8/ % &T    ?  ` 2 .ဢ߀݀`2 @ې@&!` `ؘ  @bp 2@8"` 8`  "` "c  %! @w"h %!`0'!Ȗ @#Ġ@" ?А@! @i OЀ  b@Ћ  L { /-+)L f"e4i` b2f``2c`  ؒ *2#"0  $@ɔ0$@”0$@b0 #\$"@@@ )  @u@ @裐` @蛐  "& 2   22 & @} 2 ``4 L  f  @ʐ#㻀 %!`0'!Ȗ @ِ#Ġ@u ?@lF! @ O 9 b@ߔ 2 '4+ b2($@ѐ@@   @m@ @2 +@* a0@2  a4 L ΀ f a @e#㿘c @:@Y  c  c @<㿘!#@! @1   @4  @! 2  @㿘! # @c0$ @Bc"c㿘! "@ҋ$ "#㿐`   # @c0 $@ y J?` 2'#! @w, L@ #@ # 2," @ې  *  @Xc8 , L%L "  " @F8 ,@`@7  " ""`  "'$L " *`:    $@ꛐ , @8 " $,  "$L  $ 㿈L@ 0  `L@ x X2 @ ` @, `< & T:`?   `  , ?Г:`! $, : ?   `D : ?.    ` ?? ` @, `ʖ*:  . `$? &`T   ` 2$?$$:  . *  % Kc@$ Kc@% Kc@㿈 4 ''   @ ? "`!@C좒  ?  @ ? @QȰ?@_@Q"@@V @Q  "$ Kc@㿘a ! @챐!@Q@ !  $N @Q " 㿘@씐!% #( !!@K  @쉐a@Q|!$(*` @s! @ @!@xa @ta "㿘!@k!@[  #"#(@e!x@Sc@ؔ  ' %'''''"@'@耢  ?2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `㿘 ?*` * aN  2! #b @  $b@@ 2$` 1"H@X " @  㿘 ?*` * bN  2! #cЀ @  $c@ 2$` 1#ؔH@' # @̱  㿘!c  @뉐# c'  @끐#@z# #`@ "     @ " @g 㿘@^# @    @ߖc$@@K#  㿘c  @?# c'  @7#Β㿘 "@P '@P @P "㿘@# @K    @c$@k@#  㿘c  @# c'  @#Β㿘 "@O '@O @O"㿘1# "@1#,`"#(@E &#,  #P@c`&#@ 㿘@ 㿘!@Ꟑ#   "#$ @ꖐ# 㿘!#  @#c,$#`"#(@ $c,㿘!@{# @y# X %!'` u c )/+#( l#0` #0@ `%#(@ #( # R 1P'c, c,̒#\'#` #0h4@jР@c, $c,$c,$4)#04h@Ȁ @%#(#(`"%#(@ #0h@ҚȠ@%#(  @#(̒@@',#@ے$ '@ 2L##`? "`@Ο @  "@ q0 +L :`  \@p o ! Y%#(#0 #0@y Q#( @棐#0h x@5@旐#0c@^Ƞ 25#(̒@@"',@Rc&@Rc&@Rc "#(@~ J@ #(@ K&I&@ @Rhc  " @ʚ #( %#(@- @RTc  &"@ʆ #(@RFc&@RBc "#(@< @ҔJ@ 2#(8#( &Ā#(Ā  c@%& J ,  *"@`    ""@*"@ `" Ā@  '"@  %! @Ԑ#$] Kc@㿘@ȝc8% Kc@%$ Kc@㾈 %!'` @M   "` #˒  " @M "  h 'p''Ր Pѐ `͐ ɐ @Ő 0      %@X   ?????'̐ ?'•  / @ڔ  ???''????'???'` @@5@@-+ /O? &`T   `  O` %#8*`@ R`/ O` % <*`@ R`/, @j  O` ` ɀ@L,̀ c@\ @ر , p @e? p@L`p  P   `  @    0         . @M` @Na `" `` @L ?" %! @y#㿘 `8   ` %!'`''' ''''' '$'(''`  ``0 0 ```ֵ@LA? "! @&#ȁx#ؒc?' '> ''@X @L? "   @J '? @E b#  B  > ܐ@P"  @- 1 . ??܁< $ b(" c4" p ?" d ? l0 " - ?" s ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$d Kc@$K Kc@$ Kc@%% Kc@㿈 ! # #d   #\#`#0@ #0㿐L? &`T   ` 2  ' &@ @#  J@`:`T `@ `  `2 .@J`".@ .@``֠ 㿘!    H` %```#\`#`'@ #d@]@⿐ (@`8  [?@N@#U G J?` '< @) , , `@@$ @\Ā 'Ē`H@R @ @@  @8  @ @Ґ@J_? " @D Xx %!'@J (@2`8 NX?@@ɮR  J?` '؀; @ᶐؐ , , `@@$ @䀢 &`h@ߚ܀ @,耢 @ޠ@!  @@ @~ @`@I? "a @Ґ x㿘 &N    & TN?   ` 2 `@I@ @I? " o Kc@$  Kc@JJ2 @(*`*㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& 㿘 ~6 (2.?  *@`@  /2*@N @J @ @ "%  @x 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@Ւ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@   `- `*` m #$@1  㿘@@㷐  #\#`@  \`  : /6@ " ^ "$  /;< 9@(@2 @ 2  2  @ /< 62@ `$ @1  @2 `2@  /2@  / 8  6 /  #\;`@㻈\ %` d 'i @F6"@U 2` ` @Ɣ$ U?@F`€ L?` "H GD @ /`41 )"쀢 .` ." @4 ` @ ? 6#\#`, 2`  2J`` @`@@. @ 㿘`@ `@, @@@` ` P?@L&`  `` *`@,&`?$@&`  @ `"@: @@& @& "@@ ?` * $@`&@@` * $@` @   #@@F1?" ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@J?`@E & 㻐 %!'  @q$   a`@$` @` @@-a @~l 㻐 %!'@G$ ? @$€(a @~I 㻐 %!'@$$ ? @(€@ba @~&     (*@ ` 2  㿘N  @}  " @ $ ##P "#P$ @ٜ 㿘 ##P " @< 2   2 㿘 ##P` @@|`@z 2@$P㿘% !a( #"#Hܦ (J H@Ɛ    ?@H"@ܼܐ H"``HJ@ H@ܭ    ?`@H" @ܣ` " `H`"` " `""``HJ@ H@܋    ?`@H" @܁` " ``HJ@ H@s    ?`@nH" @i` " ` `HJ@ H@[   ` ?@VH" @Q`  "  a H`$# $"$㿐N@ ' !J@` :'`J@ `'@H= &@H9 & @H5 в [ @ /TJ 2 M& @H! в G @ @J 2{ 9` 9& @H  & @H в - @&J 2a #@4\ # @& @G в  @v J 2G @4D @4 & $?  & & & $@Gϒ & @G˒ &  @Gǐ #cH (&  ##L`"  2&  $  H & $ H & H  2& H  2& H `2&  ` !` #@ 0 #cT? @-$TT  a İ  !` !@ !&!!   t I a . @7 " ؚ #\% #` !a@| @a  $a &!@' $a$ a(j@ !    a @  TJ&!Ԓ@g̀ @&! "TJ T@!  ؠ @Ж@И@ #*  #cX  @Ȥ!  ؠ @cXcX@cX@j&!  $cX䀢 "RT@aNT a(@@W' a(*@! p ܀ ;T`   2`/"@  ''@Ȑ LT !  J + -J  @     "a  "a@0 "@_  #"cXT' J  @@԰ ̀` J@ I @ @ET<T P %!a  1'''/РА!@= 1 ! '' Ȕ  !    a @{!㿈% @ ##\? ) Ȁ` ̀)`2#$ !` !@ !$% !`ؔ@耢 2 $@օ  $% $\% $\ X %! a ' @ ;    "!?5 7 # J`+`-"J  # aa @g  J   @ Y!! ! @7$!~a  آ @ُ! Y !`@ $2 @ Ē@Д @`? " J  M!   @]! @%! 1 "$@$`@ $ ܤ &'   @6! @!   "P$@L$! a @ !(a !(,֐ ܀ <` ܀ $`05` `@@& Ģ ` J@  @Q @ ؐ  @4   a @&aJ&H`T  %  2/А В@͔  ''@Ȁ !  a @&aӰ %&H 1/@ش`  В@`''@АȠ ! ` a @&a   ܰ ! @y~! X %! a ' @{ = ,  0@y   "a? 5 7 # J`+`-  # aa @  y J   @ Y!! ! @$!"a !8!P@3! Y !`@ $2 @< Ē@t @? " J  !   @! @ɚ! 1 "$@ԍ$`@Ԇ $ ܤ '   @! @!   "O$@fK$! a @Ē!(a !(,z ܀ ;` ܀ %`04J ` `@@ɐ Ģ ` J@  @ @  {   `  @%D&HU  %  2/Ȑ Ȓ@r  ''@Ѐ !   @%x  &H 3/ȠȐ'@V  ''@zР ! `  @%   ܰ a @x(!`㿘! !   "a "!"@Đ ?$! #"#H 㿘 㿘! ! "!@ $!! ! `"!@Ӧ !$! #"#H㿘  #?"T"!p    1  &!!!    &! 1  Ѐ  a!@  & а 㿐 a  z # 1 `Ԁ ؒ @$`Ԁ 2 &  ؀ "& @T& $`a   " % * .`  `"  * .`   `@   `@   `@ `"   * .`  `"  * .`  `"  * .`  `" * .`   a@e  $@@[   $ 㿘@ҽ 2 a@ & & @Ҳ P &a@ 㿘  @2 *@&  2 & @&a@  * "  & 㿘`  @ .`@ @Ҩ` @*@Ң@Ҡ㿘  @: ,`@@? 2 `@* 㿘L@  @ & T `?  ` 2`L@  &`L@  @ & T  J`@ ?  ` 퀢  L   & T `?  ` 2 L   L   `L"&  ``&@ a@I @@* & 㿘@ސ  2a@3 `$ ,|  ,v   )p    "@ @@ 㿀'"( . @< @Ѧ,@?@Ծ`(''  ?0@ѽ@耢 &a@ & @B,!@Ѯ 2" 310 0!!ؤ!@@Ś䀢   㿘J`"e #J #^ " & T@  ` 2J 2  &J 2L ( &N &@a4?2  &J`  T@  ` "J "L"@ &@a@\ @@  * 2 㿈 "@j@04;. 1 *'5 #v  ? @0 d"` &dĒ㿘  ` `@  `  @u     @i   㿈  "@@ЫY ВÖ 1 L ' 耢 " ?:( @Ѓ 01 "@u  "@n  @g@e  Ð@V 0@R 㿘@  a@s N !`N@ !8@t0㿘"P "P`"P@t@㿐` @u" @o"@  㿘ږ   Ӗ  ɖ   ” $ @67"NN? ,2 N`@IX  @Ͻ  @` 逦@ϳ 㿘 ##`! #`$#d%"#d $c`@ϟ #d  "#d@Ϙ#d  @ϑ@Ϗ#dc` $#d(  @$(㿐 ##``'!"!(  "`    $!(!(  bx  1 @0@X@ a@| . ##d$`  #d  d"@d"d "d 㿐!"!('  '"`   B $!(!( @M bx 6 1 @A `@ `  `  3`  2  2 @. "  &# 㿘'L'P'T'X@L㿘@:/! %  b@-"` @Z_"b@#"@"@b@r㿘'H'L'P'T'X@H㿘  ! %b@" @Z9""@b㿘 & T @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0  m??@9ɒ  + &> @9? ""?ג  @`?`T @ `  ?ܠ?`T @ `  ?`T @ `  ??à4 `2&@X  N "q @` @ `"j N@ "f @U @('_ &'@&@ Ā  %T #p Ė ?''?'?'' ` #\ ` 1 {Ȓ ؟!$    `@&bĐ?"`h@nఒ !a$`@& & @Е*@`@p'@ ' @І@@*@a$@Ւ@0ā㿘`? "`@  "@@  ? ? @  gc" "" "  @(*`  *02 @$_ Kc@㿘@G @I` $/ Kc@$a Kc@$I Kc@$ Kc@$ Kc@㿘`0   `"`a ?"a`` `&`` 2 @@o "@@8b? %"``"  @ ? `@?&`*@``&@`  @ ? P (  8 dxxx,,,,,8,,,,,,(    " @Ϻ@$!S 4x * @`*`@$` $` $`@Bj @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@f$ D$ H@  `?$ @:   "@(  @8  @ `$ $@ O@ @ @ {4 (< DbE$ L$e& & & @ ` "`@ `㿘   @J @:  J@ | 2@  @&J@ |!` & "@ [  "@ :  " @ { "@ /   " @ m "@ !$㿘 @?ܑ* : ` X&|!* € @ @A   D`" D D  ,  " @ @J@ )} )  ,  H" @ J`)g&@ c@͔   ( "( `, T"`,@  `( "`( 0 G"0@ C@ >  `@85 @ 0@ , @ @Β  , &@:` @:,  @ & T `  @ , :`@ؐ @  @?֐ , :  ? {`  ` & T `  ` &@ , :  +"(  ? *"  , {J"@J "@+ "@> "@"@1 "@s "@# "@  @F" "@  @= $@ S@0 @J@ ,2`& ` & T `   !@@@ @m @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ޒ @ے  @ ! @?֐ , :  ? {`  ` & T `  @ 㿘 @ @ &@Ӑ *J㿘   @ J@ ^2 `&@S  `( "`( , ", @-  @  ` :J@2J`` & @+  `( "`( 0 "0 @X 㿘J@ ``\ & @ @H J &aa)|a{`." `[`*,`:`#a(),`:`! a}a9,`a1 ~b[,`:` `@p| @ؔ w@Bs@  o  D`" D D  ,  " @ @ `  J@ \J` ) \G )  ,  H" @ @ ` J@ \ J` )`,&@Ē (.` H @~ `@b@t @    "`H`2:`@ ,`:`@ɐ  @"J *  &"@i "@J "@] "@>| u s`$J \o`$J {k`$&@l @ #J@ , ` & ` & T `  !@P @C !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘 & T   . J@*`А @ "   ?  `  $   @ђ 㿘    a@  2&   a@   (@s  &@ @J@ ^2 `&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@=   o ` 1`?,'` % &@ `@ ?T  ` "?@ * :  @ `@* ` ,`?<@` @U- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @&@  @͒@@[0@y@ 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @  @  `  J@ :J` ]3`@q 0m   &@h J - ]@^ @ @ @T  @ ` J@ = J` ]`?&@> 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘 # & @ J? &`T   ` 2"#h` @  @͔ 2` @J`2`@В 0!L  @ `@* ` .`L `  `@ܒ@E L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@c . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   $`" `@@ 2`@J`"N``@   @ 0L@  &T@  `  %8*`P( &T@  `  %<*`P(*`: 㿐 &  ]&/// & &㿘 ` `8` & T `   * : Ւ0@z`   `4, "`4㿐 &  ^  ]&////͐& &㿘     .  `y|# *` € $" r&  "@L`Ԕ  "@(  @j" "@  @a $@ 0M "@( "@   "@K"@  @B $@ ` @ݐ 0% "@ "@0@Ɛ~0@t0@  "" "0" " 㿘   "    _ `& 4 Ю   @ޑ,  "`@*,  2  @` " "  ` "4 ` @Đ !"`@ 2  @` "  "  , `  :`p` @$ ` " ``%   @ @        -   F:`$   %  * --%% `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@i`  @&`@ΐ @ 2 `` "&` @&`  0"?@s&`  &8    ` "     `&8   `  "     㿘  '`8? @  Ò `4 &`4,@ @ 2  ɔ 2,@  $ @ $ @㿘  @c@ .` *  @]. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@+* "@    (@> "@㿘   @/.` 2& ے 0& 㿘 &`  @*` &` ʐ &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@i  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@9  " @3  " <@- < @'@% %!'@ (  %"@a^ @!  %a@s"0C`L $#`L& & & & & $@$ $  $ @$ @(`'H 'L'P'T'X'\@!@0H ,@I`€ $$ @ $  %a@9",``@@Ő@Ð  @í &  &@& ! @e! %!'@(!?  @/ @,   p   @ #@`b @dϐ!ȁ㿘` $  !㿀@( $` @`   @[$ @    & &   & '@$ & &  & @\ `$`@2`8  $`''``@ܖ  @/Ȑ @= ''  €@/ "  @$`$`@&$ '@/``@㿘 $@   @@ $  @@㿀 $`!@ @  @ 2 @@! @$a  `@$< Kc@$  Kc@㿘 @H 㿘&@&&  @*&"*? &&  㿘 $ $`#$" 'D@ = ?$@ѐ 5 $17 $ `"  " & N@ :!Ȓ&  ? ` @  2 @§܀ a-` `! $#`" N@ :!z  $ "# "# N@ ? :"` :0^ ?`  "# D*``"% `:`#`5` $#`" N@ :!@  $ "# "#  ??%N@Ā`: ??% $#`  $N@ :"( $"#   ?2'@ `2   "@㿘a! $#0? @"@@ $#0#0 *`:  + -"`*`:  + - $ $#`) %#$#`"#' $? $ $"c(",#Ā $J`!%# $ c,!p$$! $#(c,#("@ " $ $#($?%#($c,I?*@$$J - J 0 $@͒ - * $!p` $$ * @  %c+$`# $c(?! $#, #,?c($#,"@ " $c( $#(  $c,?2$"c,$J` "`$$J` -J ! $ #,!p$$ $#(O#,#(" "@$?%#($#,)* @$ "%JJ`-`"J`-   $$`:@X 2 G?!p$$$J  :$$ -J  -@8  -$J`"?J` $ $ $#`  $N :" $"#  ?6 W25`J` ;1`$J`! $ $#ap $$N :!xÒ W $"# N`:_ ?] :* @$$ޘ ap$$O`J@ : $J`F C$$%cJ "J`5%c :  $ $#ap $$N :!x $"# N`:  ? :* @%c` 6*  J@-+ $@ %c!p`$$$㿘  L 㿘B 㿘8 $ Kc@$t Kc@$ Kc@$P Kc@$ Kc@$ Kc@$3 Kc@$ Kc@㿘 @(? /"@㿘N0k N x XfN  a? &`T   `D U .@N H E"P# &')+`T @ ` D 4`T @ `   %#8*@ R` @"`(@x"b@ a  .@* .@ݴ`.@ N ŀ 2\[?ǀ &`T   ` `%h% &')+ #T @ `   @"` , x"b@ r*  Nް  .@`/.N T @ `  Ϡ 0q?/EN @? &`T   ` 4@3N  %% &`T   ` `h @7"`  ,`"x@N N* @ ܰ .` 0)@'&@ `       `  &@* @ & * @ &@*  .@`@ ` @& @& ("?㿘 %b@Ő"@㿘 %c@"@$R Kc@$Z Kc@㿈`  `@''''㿘w?  ? !?`#X` #`  ?" Ȓ  Ő’  $  >==>>>>>>>>=================================================================X %!'@ 2@6@* #  # .@"@ :  *  . : . ".  aLaL %" @,@ ,  ,  ,  ,  ,  ,  ,  ,   , , , @5 @ `*@ @)  @%  @,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` a @^#p xN -   c#\@ڐ7#c#\#`@ƚ#!#\#`c@!c@ @@f!0bN  ӑ* : `K`!*` €   0,@  ,@L@  @`#+ 0#"##耢 L@ `" 4   ,? @H,@?@?@!㿘`&     `   ǽ$@B? /`4 / &/ ! %!'L'P'T'X'''" ` ` @y! 7'@'c''''Đ@,gL! @]j#${ Kc@㿘*`$ #  А :`` @| 2  .2 N .2 *`  ` %!`0'#Ĕ!@H '"''Ā  ""  %  ? "c# '̀'  #c!@qؘ#@ `ȟ@Ԁ `  "@Բ @'Դ %"""""a"""a # @si* <2 @sb* 52 @s[* .2 s 2r3 0 "#ؐ@q$ ȟ Ԥ%@ Բ @'@#c! #@ @  @˒Ԑ@'%'$ؐ@qV$ &Ī` "`@#!"  @ 4` @Ԑ@'' @z @z@z`( %@ :`07`0@y3Ā Ԓc %7#c!@q #@ &t`Ԁ  m` %"#%?]`@$Բ @U'†@xԀ  ‒cԐ %@FJ @2 @ ` 䀢  ?#@  Ԑ @%Ԑ @'#  " c! '`""t@ Ȑ  'x'@ @lҔԤ'Ժ``" ̒ '̀`#c!@p#@ `ȟ@Ԁ 2   4 %'@ d  "a@   @ ##!" @   @Ԑ@%'@#c! @"#"c  % @[Y h㿘`0 !@m#Ġ@r  ?2 @G 0@ @   @ 0@ 㿈`0!Ȗ @J#Ĩ@q ?`@$&` ?     @"$"# /" """ " @9 . 2N@i֐ 2 N?  &`T   ` I-N? ."DN##$@v D!"# @!""$"a& a"& " $!@' @"#J?  &`T   `  .2 NJ ?J .#N?  &`T   `D "c  @ƒ : 2NN :2HN $N? .@##$@v !"# !@""!$"!'"& !#"& "l#`J?  &`T   `D 2 + :  : . J 逢?J .#! @kS O  `x@u  L 9 L f"( y b %2#`2 @,@@  @g@ ܖ@@ `2L ̀ fx %!`0'!Ȗ @#ĺ@p ?@`? ?@ ?@ "c߰ (`%      ?#@"             0 @  / @  "?" 耦/a   $ #\@Y)" - 7? %2@Y  @ x "t&`@%a @jh O  `x@  M Z +"aM f"F y b D2B2?@:@@ 5  @f@   @ɐ#@Ő##$& & @j"%a쀦 %`@@B  & & "#@   %M  f %! @X 㿘! $#4  @xڒ`$#4@y $"#8㿘! $#4  $#8`@K $#4㿐`0 #@ܔ!Ȩ $#4` + @x`؀ $4 ?4@xF  %c J?` 2'#4!"# @,, N #ߐ@ # 2, @z`ࠒ # , @t$   @tyc$  @c$@ '  ' ""   4 `@4"c$"aa# # # "L"L "  " ""`&" @y˒ࠒ "&$@,  "!$@L  `*`:    @$@`@yࠒ " $@,  "$@L  $@ @ $'"@U%c"㿘 0 @t   ,   @tג 2 㿘""" "      @ 㿘""bb  "" " " "#b  X " /"䀤a @y8`ࠒ Z ,%@r L  L "  " `@y  bL " , b  %b@ϒ "#@$@`ð $bL  "#*`:    @$@`@xࠒ  b,  bL  b b$@% p %a" "|"|'`  @t 2 *   #\ @V˒ #"a䀢 a@$a@%|a@܀ La䤒  "c! @V!㿐@   ""|` "|@t !" !"!耢 !@@$!|a @ `!袒  "c㿐@gє  .@?` .@`.@`@gĔ 㿘  % !   & &   @ && @ $&@@$@ `&@ 2@㿘""" " P`0 #@!Ƞ 5 ahal ad @,`@ah @al   `@   2`  0* P@ &ђ ?  +`+`@RR@ 22""蚄?2J  J@ `2J 㿘@  "@ ( `&& & & & & & & & & $`& $@$$@@ i a0@v _?48 `.  @ K@d I`D&`6`8&` $@ * 2``6`:6`:`&` &`%   צ@0@4 &"  2 : $!8  &  $ & $@ "@;@*@( @& 㿘`(`D&`$ @ @#' / @2`L`  `@q@  &`( `0&`&`& 㿘  ` @ T 8 6 @  " @  @@  $ `Ҙ   @:  $  `@ɐ@-?"@Ð 㿘 $@8 `> `4`>@ +4`:`'`:* 2  !@ * 2``94`:$ !8   $` @ 4`:$``< "4`<*2  Y`"  <$ @ 0 @" < "S  " @t$ 4 :` *$$@e $  @Ĕ? "#@ <`4 <$ `"\$` $```2`@   $$@ D$``R@ T`8 2`>$   $ $ 〢 2$`@I * 2``4`:$  !8 u  $` @U $`4`:`< 4`< 4`>` $  J /@  /*@`(`@ْ`DS$@ T`8?2 @ʐ@."$F `$* T`82 `<$ 25`w)  $ l` @ ` @ "$ $$$` `2``@@? $ $$$`   4`:$㿘 6`>@ܰ  "㿘` @@ϰ  G"@" $@2?  :  9 27   "@_@2  $& $ T 8   J`/ $ @& !8  @&  2    㿈 @'H  HH`X  @v5 :%  2 $ `  ?`  4 ''쀥'H 2 '@@g  H2 <@L%  <' @E5 <'@  ' $ J?`/  $B  / * U 8"@ '    2 `L` .2 `L` ?` ` `@`   `@ )@ `@ " @ @@@: 5 : $ @& $"ɰ "   $  '@ "4 8$  ` $ $   4 :$ 4 : 6$  쀢 " $ `  "  $ $  D $ #4 : $    ($ @K D D$ @  4 :* 2  *`2  $ &```@ 2c $`@Ő耢@Q $   2-- $H29 U 8 2   $ ϳ    @@a?  5 : $@]& $2 H   5 :@Ր@@} 5 : $ @0& $ ?C" @x( $ `@ `@6 "* @` 2&`@ T"ƒ " @&`  > h>> > > > > (> 0> 8> @> H> P> X> `9 < @ ((&`0 &`, N`D`.&`4N`E  ?`Dc  2`  `2``0"&@`R`8 6`,  @  @    㿘 ( *@`$  2 $   "$ @5$ $   "    @   `"`" 㿘`$ H@ސ   @P`$ ``6 >& & ( M ?& @@ D㿘@  㿘 a   @@@&  ?"  @&  2 &   "& @&     D" "  2 D""  P86㿘   @8   ( $ .    "? ?`0@`,@@ΰ? ""@C@"㿘@ @5g ?@` $@$`@G@@E` @C)@5V 㿘@ ( ?"? Ē <   @  ,"  ?#@ 4  $& & $"  "` @" #$ @&   & && & & @ & @ِ 㿘`  ,    ` 2 `@"#   ` @*` @.  2` ?, "`` "` @ `  "`"`"` "` 㿘`) `@$.`@"` @ @2@@ @@ :  @i @& &  @@ 2 㿘  @&   2* &   2   2    @  &   @ 2   "   & @ `"  㿘  , @4] %@" @` @4I @  @@4<  "&& 㿘  `@ `= 3%``@$@#6 $"    ,*  @$@ ֘ Т06`j`c`(q\6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =%``@$@#6 $"    ,*  @$@ ֘ Т0a͐$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  Ė%X   ` $  @@ @%: <  (  >(` :`@?? D8 >` > >> `` "`@`  @㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @[@T?@J kby@9@2?@& 2 8@@ ? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   &`T#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @t@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘 @ N * @j   ) & @ N@" `   `2  `      ,  `        `0 "  @(? `" T `@ `  ``_` T @ `  2 _` `$ T `@ `  `_{ T @ `  {_  {  @є2  @ @Ě]`& ` `㿘  0@ N * @  ) & @ N@ `   `2  `      ,  `        `0 "  @m? `" T `@ `  ``_` T @ `  2 _` `$ T `@ `  `_{ T @ `  {_  {  @2 2 @ @^`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@; #7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(`X   ` $  @@ @: <     >(` :`@?? D8 >` > >> `` "`@` "`$@`$@ 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @{@t?@j kby@Y@R?@F 2 8@0@)? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   &`T#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘  ,@ 0 ( N` @&  , @ `@+ & @ N@`@ " `   `2  `      ,  `        `0 "  @O ?  `"`T `@ `  ``_``T @ `  2 _` `$`T `@ `   `_?{ `T @ `  ?{_  ?{  @ L @ `@`@ @ߘL& L  `㿘  4@ 0 ( N` @H  , @ + & @ N@ `   `2  `      ,  `        `0 "  @~ ?  `"`T `@ `  ``_``T @ `  2 _` `$`T `@ `   `_?{ `T @ `  ?{_  ?{  @& L 2`@ @ `@9`@4@L㿘>!`+@ @( "v`M) PV~ўȄ@ d ƞ@"y@@o@耠5$@  i"@&("`8@2@ ``2@| {@v `2v@o 2p@i 4j@c `(`` ` Y@T   @ @. @@O@ I/@("F#A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  M ֒$1 Kc@b##8''@A  @Z?!`'```%59;!تШȲl'   * ` *J`|`:2 *@Ē@Ē@  @qb؀ 2`X    @fb耢 `X $`XĒ"@ : `X $`XĔ@c?"$`(@#$`0@$`,@# $`4@  $@c< 4`Ē# @? 4`(@z?2`0`,$`8Ē0@m?2`4`8$`<8@`?.4`HĒ@@V? 4`JH@L? 4`LĒP@B? 4`NX@8? $`PĒ`@.? $`Th@$?$`Ēp@?x$` @〔 @# @ @㘐@ ##̰ ` a/////@?8&|&@|& @ޔx? x & Ē@Ӕt 2 t . . Ē@Ɣp? s  . Ē@Ҕ  $@2c|.  *`:  p  ,: ?4`@+ #㔰  0Ĕ/@? l *`&:  4   aW$`@$@㿘@  @@Z "&@`@ 2@ & T `  ?   >    #@a  ΌμάΜΌμάΜ %4 4㿘 1$ Ѐ "$@$& "  @l!$`@$ ̒$` " $ " Ԑ @ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ x %!'X\'DX 'H'T' ?X #$`Ѐ @T !$ @m$ g ̐`@ ' Ĭ@^$ X      @U A'$@ @ H"D!" ” c '`+M@  `(8,L \24,, %$@B $@ 0ڤ@*M@@!$ 4Ϩ  ζ? , L " #"T@ 2ݦ`@( 2զ   U  @Ӑ`??w  ?L: ,?#\$ ?  @ %" ?2 :,??J %L  : $ " ''L?`: :, '"@  %$@$&@ '@q S@i01@$ @b@]@V?a = X $0$H"@b 2@8@ "? %@,? %D#@  %! @;r#㿈@{''`?''  ? J ? ?  &@J `?J@ J JJ|:? ?J:|?  㿘@@㿘1$ ؀ "$@& $$$" "`"܁ 㷀 %!$' ""$`؀  @Zc % 0.װ %$ -$Ѐ` $Ԁ  "P  @Zu젒  ` @@R % ؐ`%` @ZÒc % ?*?쀢`2L$" ܀?  &`T   `  $*:  : # ܔ  J?`\2# # ܐJ?`\2""ܦ + @Z"젒  ` @@ % ؒ`%*?c@s'L :2$@`' $@$" @쀤բ@ ,@c@X'@- #\?;    + @::#؁㿘 = ?@ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ #*` € * ? *? *? *? *? * ? :*???*?  2N"@`d 2  -?@i)? dN :  ^ \ N`:`2 *" ?"@m 2  ?@C?&㿘I = <?@ d 2L5? d  `"@@E d 2 `#?@?@ dL : 2*@*@`"@?"@@) 2 `?@?&㿘 # 2N@2? 0  `N@ x X `    v`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@|\.`.`   (8 J2J " #@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  㿐 '`v$O Kc@$ Kc@$$ Kc@ B Kc@"` 㿐N@ ="`@&@o "o @*/@* ,`` a "`%$  2 ‴$>@*` #  .@}$'$@" L'L  =2 $@K  –*`" (?`*`‑* : , *`: ,   =2 =,@ *`,   @* ,``  㿐"*`  "  "@ $` Kc@$# Kc@ ` (  *88 " (" $ Kc@" ( $ Kc@㿘 @? @Tw㿘  @To  $$h Kc@" $ $% Kc@㿈'HN@ r'D wHJ` -  n"@ ' g ~耢 @ 0]?` H" ?" /5@v8 / @$@#@$-``@J?`/#,.O j@v8 e@v2b 2 \*? /@ * T"@@lT$  `2L `G < ( 8  # &5 ,O /.    *? /@P * "@`L`/`#x,,@l $#o@u$rJ /"*! @2i#㿘   ` o  " $@Ґ$  @?@  J " $ Kc@$  Kc@$Ą Kc@㿘㿘'L'P'T'X@ LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLl l         <<       TTTTTT                         TTTTTT                 HTL<HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH`HHHHHHHHHHHHHHHHHHHx\H\HHHHHH4HHHHHHHHTHHlHHHHHHH|\\\(HH8HdHHHTH %!' 0 ``  ?"   @ `? & T `  " %! &  & &  4@w 2@  T@  ` 2 @2   @ z` (,  €  4@w 2 @` ?& & d`ޢ`@ h2ڢ``ע`@ l2Ӣ``Т`΢a̢`@,* ƦР V ` hQ  Mh J H @bA b>   @ h7 d2n@``f*``22`@2a2 ``= M:J"? & T `   `    b@w2 #b % & ? &  &@w  2 T@  ` 2  8@ ,  €" d  @@v& @$`@$& &@ @ Ө"?d/ J #  ?& &   4 @v  "0 L@`  ?& &  @  4 @v 0 L@`  ?&  ,&",'"?d# # &  & &`4@vo 2o `T@  ` " `?&  ,&  4@vH $  & T `  " $5,8!T@Y ?Հ`MS"ܓ*` €`@ @ @@T/,@ % @-`4R (,@  % @-`R `` 34,@@+,@@  @$@ꀤ@ ,@ , ? &  &@uא 2@ (ư @ x Xd@גd$h,@ @ `   `2``@:2a2`2``2z*v"8!t@8 ?Հ`:2!*` €,@@"',@ @ $ ,@P @@ `,@ , ? &  &@uL 2@@@ (8 @T/ e E@F @Ad$,@#. `2`":"$ ? @-# @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘 2 * $q% &&@@A@@t&$@ @8@0"@&&㿘 & T'H   ` `2 -+L  L0 L x XL )0  ) #?)  >|Ė {+   $ `%E    # &I "m B  @ @  +?"1 + }<@ !b @ @   1"?# ?}p<@ B   `T @ `  `T @ `  `T @ `  H  H"@㿘 & T   ` `2 -+M  M0 M x XM 0  >?}/? ?@+S?   ( O !@ @  l? ""? ?|В<@ B    &`T   ` `ͦ &`T   ` ` &`T   ` `  `  '㿘 0 @2@$ #$ 0" 0"`  ,< & ,`@  @ 0&"@ 0 " ?㿘?:#`2`0@,`0   `"` a ?"a` 2`0  " ` @s? H?` &` ?6` &``  6` `0@  `` & @ "@/?&@*` '&`` ` ?߀6` @@ (` 2 `` &`&@``@@&`<`0&`8"`0 "``B &`&@.`B$| Kc@㿐1"7$ i5i;$$3$$&&c&l"!h'c#ܶ  .( > @?* $%Ḗh (@ (   (. @?*? ($%($  .@/@.?$$HX$$ံ  .@/@.7$$㠶 ./$ 9, h'QhIhA,h  , "''@#  p#$@4("('%(@4(@'@(#ײ`` ʐ $peahh ]Y hh  )$! "@  @  ##(@'@('$"$  " %@p$ @  cc(@'@('` 􀤠O9$ж .$5p$h㸔 ( ( . '   (@&@$ . $(  % h$܀$ ؒ     2*`0"؁㿘 % h`2 u  3iah]il]!h6  a"Yah b6  $ d6 . @ *& 5@ *`( h5 f * 5j a, @ la !h%-@e h %n.ah @@ % @`i@%"!la(&ah @     <c @1e@%1 )22 0@ (@@ !#h2@ 1f@  ah!h 1f*#hb !h3`1g  @!hbh 1c!h3` g !h ch 3`1d !h @h@!h  `d+`hh h @ @$@ $$$   㿐'L`'P %%h' '%%('' 997A!hh3$3@3.`#( ., ;1 @(31  @5@ @1 @   . @ @ @@c$5ؖh-1hh#)>' ~!~     6 . ( 0 .`@.  @6  / 00@@ @@/%6 h?1)!h6` (o 6.h.7h38. ah@`? Ih4`4` c `+  4`, 4 * 4  #4c %/ LQ h  @   @P  㿈 % h`  / / / / / / //''.@.`.`.`.`.`.`.`㿈N@ $ %N` 1@@  h`2Z * *  " (ϐ 2 N@ _k@   N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ*    N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ* @ % ]  N  *` *"  N p 2 N !$ @j @V  9 N` z  `?ŀ Z  @ ?ˀ 9 -  ?ґ+ :  z `?ŀ Z  @?ˀ 9 -4?$* *`N` `@ `  +``  耢 B  %p3  3 .@ ? 3 `.@ `? 3 `.@ ? `.@`*  3  ? 3 .@ `? `3 .@ ? `.@ ? `.@`*3 ? 3 .@ `? `.@ ? `.@.`  㿘.`6`IN N @6 3 0(0.++N `! `<0(.7`N  `(.7` 㿘 2 a $. . @ . .@&  . @6㿀 %!'  'i,`2  `@ `*`,2  2    8  ǔ ! @&*#H %!'cX@ `N@ 2& %N``$``a2 %` `N` $ %@@   *  %`@ * @2`  %  /@  `  ?#@ @b @И ` @?@v `@r `@ ?#h#f 7  @J.```$ ?#h# @% ``??#h  `*`2 " *2 " *2 " *i!p $ 2. . .  .`@ @%)@  @@@@   @%k#x*2@ @-x @0 @(*`@ @2 @ (*`@   * @2 @ ?* @*`@ ڔ*㿘&0@2 2 c@2 . #d((33c@3. #d(( 2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( $33c@3. #d(( (2 2 c@2 . #d(( ,33c@3. #d(( 02 2 c@2 . #d(( 433c@3. #d(( 82 2 c@2 . #d(( <333. #c($@ hD@&@&㿘&0D@2 2 c@2 . #d((@33c@3. #d(( <2 2 c@2 . #d(( 833c@3. #d(( 42 2 c@2 . #d(( 033c@3. #d(( ,2 2 c@2 . #d(( (33c@3. #d(( $2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( 333. #c($@ h&@&㿘c@H*`2`  *0 : *0@`( ` 2㿈.7 6ܐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' r'k', 2`*`& `**`2 &  6 ,  2  J'C'{, 2   * *`+`&@2& ߠ / 2  ֠㿘.56㿘.6  `O *`2 `  㿘.6  ` *`2 `  㿐 3``*``*@(`@ `*`+``+ @ @  '' 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 3``*``*@(`@ `*`+``+ @ @  ''7 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 ?  @  . ( *`*@ *@ @ '** +   '..􀢀2 . ...2 . `. ƴ㿐 A*`*@ *@ @ '** +   '?..2 .  ...2 . . @  . (  Ŵ *`*@ *@ @ '** +   'x ..2 . ...2 . `. @  . (   % `? 2`*  %!# %!ia'@+$""a@U @ ⌒@$i""0/i5 )i" @  $"⌐ @*`@" @~@@~@⌔@@ߐ@~@⌔@@~@ߐ@F@~ِ   @В?    ??@~Ő  @ < @ <   ⌒ x@H@ @  @~@@ @b  ⌐@@Y   `@~@`@}  @~x@u@ܒ #@~k+ *    %" + "*   %" + "*   %" + "*   %" + "*   %""  %"" `%"*`ᴖ ?耢 ? @#؁H;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `@@}r @r &@ @l`@?@ @}]㿈 %a'`2*@`*2*2222 ///////*2@ `? @" /@ %a  %!  @#㿘Ɛ   . . 2 .  .   >`P>@>`>`>`>` >`(>`0>`8>`@>`HX< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%$ Kc@%# Kc@ $ Kc@%0 Kc@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  MMMMMMMMMMMMM㿘@`@ @5S` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  Ӑ `,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘 i  @ "  @+     @ :, @ %!H .",   @ ` :  , ,  , @ 뀤,"UccUccccccUVcVVcX,X4X4X4X4X4X4X4X4X4ccccccccccY$ZpcZpccccXcc^ccccc_ccaccccccccccXY(ZpZpZpXY(XcXc\^_$Xc_hX_ccacXzzzzzzzzzzz8zLzz`ztzzzzzzzzzzpyypyyyyyyppypqPyprTrTrTrTrTrTrTrTrTyyyyyyyyyystytyyyyryyvlyyyyyxyyxyyyyyyyyyyrstttrsyyrytvpwrywrxyyxyrܝ㿘` @&`&`&`   %!'''"`` ` @wؔ!` ` `,`$7''7'''''@ @`2 2? @`  @4`   @#`! %!'H'@'`0   `"` a ?"a` ` 2 ` @+ "` ߟ? "   HW` p' ('''''@wj 'Ȫ ' %Ȗ(@r   %'?'`$$@ ' 'L p@'` '''?/J'?`ZӐ#*` €O  / L ?Ѐ ,`L** ?Г:`  L $   H'H@s  -`' '-``'` ' +/J *?' L ? ,`L** ?Г:`  L $   H'H@)  -`'-``&g?f?Ѐ  ,`* ?ТJ?Ѐ ' $&S?R?K ,`* ?ТK ?Ѐ ' $2?' 7H'H@ۖ /,*@'J@ l2"`' `ȑ-`@`/ȶ`-`@`'';  `-`@`''-!``@ `-`@`* :  `-`@`*  : `-`@`:  6  -/`  g   G" `-`@`''ش?`"-`@`''ش?@     -/  ' @    #`#\@  g G?@$ g g E e e f'@H'܀ @`  O @  O `4  $ O Ӯ -/ ;+`@ `-`@`2 `-`@`* `-`@`" `-`@`"" `-`@:`:``-`@`"`-`@`''8  `-`@`''*``@`-`@  `-`@`  `-`@` ̐ `-`@ ` 'Ъ`  x`-`@`  (  @5 "$ /@t`-`@`''8  `-`@`''*``@`-`@  `-`@`  `-`@` T   0  '`-`@`''8  `-`@`''*``@`-`@  `-`@`  `-`@`  2/'ض$ب S "  7 F H4`,  `4 0 , 806 03, @ `0, eu  ` `0,, 4` Д ` 4  ,@s  % /Ƞ /؀''O Ԓ`'ԀԔ'Ԁ4OԢ" `.`3 %a` $$` ' 'i p`a`$$@ ' 'S pO   $$` 0/h/ih $$` ' '/ p4Ԣ" `.`/ %p $$` ' ' ep`4$p$$@ ' ' Opآ"`-`/ %p $$` ' ' 5p`4$p$$@ ' '˒ p e$$@ F  BV  h $$` ' ' p@$$` ' ' ߤp?``/ %p $$` ' 'q Ťp`4$p$$@^ ``  h $$` ' 'M p$$` ' '; p `-`/ %p $$` ' '! up`4$p$$@ ' '  _p$$@R$$ @ ' ' Bp"@`-`/ %p $$` ' 'Ӓ 'p`4$p$$@ ' ' p  p $$` $ @ ' ' p   p $$` ' ' ܤp$" $" @ t  4 R   ./h/ih $$` ' '[ p  B$?$ .@ ?`4`/ %p $$` ' '/ p`4$p$$@$$` ' ' fp$$ܐ @ ' ' Rp1Ԣ" `,`3 %a` $$` ' ' 5p`4$a`$$`'`'̒ ! & '  'Hp  'H   '` @? %  @ x8 %!Ȑ '''/*` *H*`**` * *`@pj  + %a@u  % ? ;  N `Z1Ԑ ԓ*` €N ?  L* @ L*`ДЀ @L $@ 0+N*4 N ?  L* @ L*`ДЀ @L $@  @ @H@4 *@ @;@4 *@`Ѐ NЀ   +  * ?И NЀ  $ N h2@ N l2  }{@@@4  @@@4  @@@4  @@Ӓ@4v   @@ƒ@4i  @@@4[ @ @@@4N @@@4B  @@@44 @@@4)  @@x@4  @@k@4 @ @@]@4  @@P@4  @@B@4  @@3@4֐ @@(@4ː  @@@4  @@ @4  @@@4   @@@4  @@@4 @w@@Ւ@4x @@ɒ@4l @@@4`  @@@4P  @@@4C  @@@45   @@@4(  @@w@4 @ @@j@4  @@^@4 *@`a* &#\   @n??&6? )+ "  `Ԑ p*` €`@?``@? ``@?``@?`` $  a'   @ڐ 㿐@ * #\   @mȘ?&@@Ґ#\   @m??2?@p^@(@& @  @m$@ &@㿀?"\ f#   e E    9/ -/?#\  ?@耤 g G f# fJ 02 @ ` B  '@@  B3'@   0`*@@ '`" "@ X %!'`, -,   +,  쀦`   0.x7 ` `0..    0. `0. &  @  \\tx㿘i".  ` @ " ,, @iq "`"`"`"`  i`("@ 㿘? #  v @v4`4  *  $ 2  ,   * @lS ː, " & 㿘 w  *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? cu+ @  u$4`4 444 4  $@? #u 4 4u4 @   4 $@  $'  "' 㿘`  %!*  >``#!i# ```"q$#  $@ 2^$@"`" >`U>``2@㿘>`@ *  Z `` "? * ` " * " 2@ ` " " ?& C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??ā`@='H   @ !' @ & T `  2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : + '     -*   ?4`+  *  ?Ъ`M@ /9뀥 :`E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*%@ "" 2     `H &@  ' !ЉB?   ?`* @ $'%H  !ЉBD? >'@ 2:%`"_H%`    .` ?$%% B"@ $% `*@?$&@ .`% B@?$% B   *` ?$% ?*%@P   * ?$% B?4:Џ "" %!䀢 H   x + @?$% B?: + x?,$ ?%( B?  $(#a?_]    * ?$% ?K:4   a + ?$% B?: + a@?" #!ȑ D(?)F!?()BD F?  !Ȓ ""䀢`|H 4?@?r  4'''o  0[5 # @  I ?   ?  2:?8 ?  ?!ȋ! B0&  !؏!+'   a&1'?  "  !!a !  a!B'aB &'??@?Ѐ B- %?,??? @'cD?   #D? !  aB B?f?? @D?   F#' € ?  !  b 0" ``` *@f|` ܒ `       $@  ?3 6" @   4`% & $@    4`( "w & X  ?H 2"?"쀢 #㿘 t -    `r  `1?#  o @o4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' hi"'L'P'T ?i"ܒ *@  ""i""Ȁ`6'@ '@ * ' %  T#"@̀ ?  P   """(\`N    \"8 B T "\ հb0 "  /Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@'  "@B?{͔ ? '? "H ' b`"P D X 8HFBL ' B# '  , $ȇ%)'#?    '% 'L 8'LL` 'L L "'ߐ"$* €?'? 'P'P`P 'PP' 'P``' i ` ""ܔ  ,  `"ܪi"b؀ ` Ⱥ  '   `* @<"  # Ƞ !  ?Ȁ  !x /`@ &' B<  `ȅ!?Ȳ ``* @>`$Ȁ %B? !x  /`@ $ȇ%B?ȡ<  `耢  bh 9' 쀢  bp B ?' ȀF"x?0D'@'& "  '$% ?ȅ)  P?䀢 I `* @`$ %" ȑȍB'`0-@ȍ…&' Y? "hƁ) 0 @6V?ȕ$ %"pȑ DDB?ȅ'`0.Ȱ …&' 7?ȅƁ)} 0`@4?Ȑ* `@ $ % B"pȀ@B'`0.Ȱ ? "D-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX  , "P #     b Bȁ  1-@ Ȁ@̍B'`0 L.Ȱ  ?ȉ"#B  ?ȅ$%L` 0?N 92?-@ .  "p B ?"8D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 8 } t L̀ 2'?@2 '   ''  *` s '@ `` "```@m g耢`    ٔ 쀥L  ˔ }  1Pɤ8 1-@`Ĥ``,܀'  Ը* @b      Ԁ   ' 'Ԑ  `Ԣ 06L  *f` L` ̀ `9+ 4`f.& ``L`̀ `ƒ  4`2N.`"K.``:  9E. `9` 9., ;..@   ( ` 0.@  Β 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ ߐ2. 0-@` .T"\2"+dd 0␅(# %$i %!$       $((()(*(+ (,!(-"(.#(/" %  %$"$ "` "`"$㿘` ` ` 2 @@ "@u? "`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @]` ``&@$`$`$@$`` "`*@@``@"@$`$@.@` @`@@@I\$@ 2` `` `,` $u` ` @`u`@"@$`$@`" $&`b   `  ` @! "@  `@ ` `@ @ @`;@@@I$@ +0@ `,` 0   @`!`@"@$`$@2`@H   `" $&` ` ? @4` 㿘#`2 @B 2  $ "  0`  @@" 0@\  0" &   ?6 &  6   2  " @b?@H   &  &   &  㿐@T\;`` (` `?#;```0  ?2 `2 #`    ?"J@ @"J@@ 㿘 p %  a' #@ *"@ `   #@*`# @ H @(@_̐  #P #x #h #\#` #d @S?Dz  "  @#㿘 㿘iicX# H@b  H 㿘@I4 & 8`#``? ` ,  "??, @ْ`2`Sl! %!'P'T'X'`#`ذ ''" ` ` @_2!?"77''''}P*!  @$#㿈# %a a  % ?'  @b0 ?쀢  , ,a , , 8 %! '?''Ė  '''''cȔ @^?' @^/ @%P @˒ ''' g& ǡȣ R 㿈/ / * @*`"* "@*` @[? '<   ?" "? 0" ici```` `(`0`8`@8@8`8`8`8` 8`(8`08`88`@`H8`H`P8`P `0!`0" `0     !'@^'`X?ֈ!㿘#` %@Z %"   V  X 2 $  ?6 6 && & & & & & D& H 0" 0"` 0` ` @^?!㿘@a  % " `  ` "@` 2`[ $㿘5@Fː H㿘j k 0aؤ $@$$     @^!`X!@G}! "#,8 p|$0<HT`lXdxp? 'Ѐ` "8*` € G  g\耢 ? d W  7  gL耢 v?t ,  )  C  #     : !              'A'ؐ    '9'ܐ                    $?ؐؒ ԖИ @_ ?Ԁ ?  = ?' k " ? ؔԖИ @_ ??ԁ0X\@Y    % `@]N"d! ` ? d@Y@   ` % `@]="S!@$`X  `2@< *` V`6  %#$$$`  $`  ?$` $`$``8$`$`\$`T$` $`(@^$`$ '''''`X@;I @: +``<`€$`P 6$` '  N   '! $ \ \$ @;ے  b~OG$`@9$@ $`@Ye @Y` 㿈`'' #\a %!'D'H  '`(\'L'P'T'X?'X`@'d'``$'``('d@ '7''`8&`8``€`P`X3`€H D@ € PL€ 2` &`, ``€'T@`X `U!T `Z  &`,&`0  Xd  &`,  L' L ' 'T''?/ضb@!b? `#* $, ` g$, f  " ` ?/``^``Z 'p`  't?ppt'` 'd&@>&`,ހ   "5``"`Ix x"@|'p"`'t@?pp@'ht@'l@?hhl'` 'd&`&`,o \ @`\'\ N4  ñ`"@  è`#"s`â &`,L&`0(k``X``@ 2e`@9ۖ @95 .@9`,`, XD@ `€   &`,&`0  %@@8`,D@  @  X'X @9''&`,`, %!  :  ,"@0"`4"`㿘  " 8 8@% (("$"($"(""" "  "" """   㿘   " <e < `@ 8@W@WXPHXP ,,,8  ????' $ $ $ $ $ $ $ `?"V  2z? 2v? 2r? 2n??h? "   "]?$$  $ $ $ $ $ $$ !  `  2`"    "/? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $  '  ' ' ' ' ' ' ഀ`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   n2m? g? V$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @+`` `` `     2 `?&   "&@Z&㿐`0 !@\M#Ĥ@  q @ ?  a@=W @ & O  a@=H p@\# p`* J@ %J@ f" y b  2 @ @@  `J@ ဢ f@[p`@S `  & #` "*` €???`@אx& ' #  `1 c3@ 2) @p  "$  " ``@א  $  @А $  ?@  & @` %!'&'ܦ@ܒ G @8 @ @_ 0@`,?@ $#?@  @r   ` ` ܰ &܀ !@=!  !㿐@ 2E @  2 > @<2 %   .@ $'?@T#?,@t   2 @?&`2@Tt㿘   @&` ? 㿘`@T1 &  $  $ $  $  $   $ `$  @W$ `  *`@$  $ *  ` `@W)0 㿘@ 㿐`"V    2P         D?B?@??   #@c􀢠 '0?i`""*? " $?    ! !!@Z[#@Ò@ZW#`΀`2     2  2     ` `    㿐N 2`"??@? ?@?@  ?@U &    ?@&? ?c( %!? 'D#"  ? 'L'? Ⱥ?  ? `  ``D 2 D?Dc @`#@??Dc#ج `  v"c?D@ |#@ b@   _"c`@``?@V   N"c'L? " $?#@ ??c?@@#@D @ = D" "?@@ * 2 `@ * `4 @ * 2 ` @ ```4@`(`?c@D@@ $ b@؀ " @V8ز@ 4 @:V @```@耢 ({@@Ő @@ La@< %i@``@   a %@*W@`` 2Q@`` 2K@`?@Ul ` ?䀢 ?#@"6@?@Uʐ ??###### `     ' ''' ?' c' ?''   '?cl ?@*# Ҕ & @          2  @T ?c@@`?c@#@   ?#@??c@@` ?#L?#?#" ##  %a  1" 8  ??????????''@Q@  @Q@ 2 `@Q?"cT     0! 0@ '''''''' '@''' @?''Ȑ@t @Q@Q% Ā   $ `     2$ @Qj@Qh㿘! %#   "0@b@$#@㿘! %# @<$$#?ch %! %c ' ?  "0@b@ '# c@ ?##@ v M # bH@    ,@bP ?,  L  *`:     "@P , @<  ? ?L  ?`#`#` #`#`#`#`#'''' ' #' #' '   J ? #@$@`L ?  2@?#a  "Xx  ????<  $ ` ` H  8P  ? ???)  @8 `*@ "P@\ 2*@`^\ `J@*:    `"  @C"P " `*@``"`J@  @` `'` '`'`'`'` ''' 2' @&@`  2@   $` ` Pp x   x?`??? @ pZ p t` t@O ` $`t .' @SL x bh@* !' ` @'` '`'`'`'``t?E'   $ ` ` @S  xx`t@) 2`t)   $ `` 㿈`0!Ȗ @V #Į@Od@ ?"ck?@    T"#`;?#`)@ $`` ` ` #\#`@'#d  @@ 4@   2   2   @&`@`2``"Г- €     "c@O. ? "c@O'0@O$㿘`0 !@U#Ĥ`@ '    "#p " "#N J .Jd?`2J J .`? 2 d@ "dJf2  ? @` 4[㼴   2 D 8`7"3D -D@B 4= `=4㼀 "   " `2 ``  2`""`  `" ?@ ?` $ ? $㼰?㻈 %!`0' !@T#Ġ@  `"#%? @5$$ ?L .", Q$$ "c?a  "xl퐝㻀 %!`0' !@T# &@ 5 G"#$#d#` #\  @ʚ   @$@X  )"c@ 6 "c ` 2` *` €     "c?  #"㿘`0 !@T7#Ĥ@Ӑ    "# " "#N J .Jd?`2J J .`? 2d@ ^pd2  ? @f 4a㼮   2 D ;`:"6D 0D@E 4@`=7㼀 "   " `2 ``  2`""`  `" ?@ ?` $ ? $㼰?㷀 %!`0' !@S#Ġ@" `"#'? @Ph?"N .2h@[ , #\($$a  0"ȁ㻈 %!`0' #@S@! @2x  @O"  2p l @ b褒 f@. ZJ?` '#O@O, L@  @? &`T   ` "`;,@@ ђ 0 & T`L@?   ` 2`L@ "`1pJ ? &`T   ` "*$@3 @74  @H @7* !  "H`0`d !@R#İ@L  "#?`  @ m@R6 @4 *` * $  >*` a ?$ 'F'$@]?2[?$@Ԑ@ ̰.2 @.2  @  ?4  <$@` @l @Ӑ  @ϐ @ϐ  @ǐ 4  $@` @. , @2 . @2  @ /`2 @ ` @4 &㿘`0#Ĕ!@R & @)?  )@.@?# .@2  . .`@   @u @r `   &6` 㿘.`  .2 .   ,,`6 W2 ԕ6 , 4 Wԍ6` ,`6 㿘@Ph%?'q)!$ #c4  qq2@PW2`$ q @PP2`$  2 !q 4 ! q2` 5q3 %-q7q1 %4   *  `@P0#$c4 $`  # ,,`2   , u4*  2` , 2  (` ,2`x 6 6c# @ ` ? &6#㿘!q   %c!/ q  $qtqq)q `'  WTူ?4 q q c@ *`2`35cq` % . 6 X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@ (lt ( % 0 % 4㿘`0 !@P#Ġc$h @P#,` ` ,`㿘`0#Ĕ!@P   6 M I ?#̐ @ @2  @2      ' @A  ""   0?#   @ @2 `"  @2  㻈 %!' %@ј$ $@@* `4 @* 2  ` @ ֒ "   !  Ր#?㻈 %  ! '% #? @$ @@D* `4 @?* 2  ` !  홐# X %!`0''D'H!Ȗ @O#ĨD'@A ?";?  'H"$  '  <''Ā@ '  ' @  `   @? ` *@ %#0`"  ܤDH0` *` €   )4? 0  %#  `'  % % %#(`, @ J# @ܒ   {$, $# "# V܀  % "c(J@HD ''''# E H`  7ֲ# јְ  ֲ@"@*` 7ր @ 6)Ā`& @'u @X* 2 'آ 77@"7ր# g ր  `@m@ "b* &7֑* 2 ""# F ֒"@*` 7 @  # ` % % %(  , @ " ( @1ܒ   z$,  $# r *@@  %"#$ $ 1 %  `#$ 1 %#$  D# U܀ # &#$D # @zHH#$   /'7# U <&#$"D # HCH " *s@* `'V ' 4' ''#   @@2  \#  2 *@ +  &@   e& @G  `# 0@ ='"!'а#  =gЀ -' '@#  $ (` #  (2 DH #     2   *@o@!` "@    " @`'D  `a %@Q %#4`  Dc4ܚH`1#*` €   )4'? D"ج `@'@" Ȁ`e? = "`? <"["? %!  ?#8㿘! %#  T? % % %$# "#$"(",㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@x  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ "? >*@*,2$? $     ? " ?` &T `  ` %8*`P 㿘D`4 ` "' 8?, ., \" Ȑ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*` %8(P㿘@ 㺨 %!`0' !@KX#Ĵc#$h@KP  ''    @ Ā@i %@  %c<  &Ĥ XђP?  x2&|@P %&| &2  F % B % 2 & 2 & 2 "&  5 .6. &@Gwd<*@ ' &d ap&  @, &`v#  2BX @GZ!x ;`@+!N` '&DH" \ "NN` `  .  $  ' N`` 쀢` NN    2 .$X@a ~' a@+ /c' #_@G , a@  .O N a@Д  ( Oƀ  #a`2>N "  " N 0 .`!@+} @ Ӓa 2.!'a@  2@ Oƀ  : @  ƨ N   L y b f*  ,  L y b f *  " Ӱ a@^  T Oƀ  Oa`2N "  " N  `!@+ @* 2.N` &DH \N   . " $   N    N   2 .$ 'a@ 2q Oʀ  2k `h N "  " N f d 0J ? &`T   ` "*  ?0?8  ?H?@'0'8!В  5'$|$ &$$` 2!$`/``@Eސ$ @F4!$`/``@Eϐ `" " " " `$ "@Gaؐ@   OȀ   NN "  " N   ;# ! & T `@ `  `2N N`" N@*aP 2NN`;瀢`N.@1 R / h"@    !P@* 1l.   &`T   `  * N  ; 쀢?*: .@  $@@,@{', $@@,@u',l"@  *` %@ @% @_%  @ Y / @*` "  ####Ƞ@## ̠###.   &`T   `   N  ; 쀢?*: & ./ @4 @Q  ?    4,, *,``  .a@   Oǀ   a@l@ `4& d **` &d@,N` @0  @), .  `@)/!`#`N`  &DH&H  PN  .Nd`2N @)  . $ `$w   & @DW!  @b & %!  岐" 㿐`0 #@GƔ!ȢN x#% *`:   N "  " b @  ' @4 NKK? &`T   ` @ ;+ad* < 1$ad(@Ӕ  + b0@̔   `b8@”  `$bH@  ` (bX@  2N` $`N   2 N  0 ???㿘 @Ĕ  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` @@@@ 㿈  ?'  @F ?? &0&L%%&㿐@ ?㿈 & T, : ?   `  0   N x X    & T, :  ?   `   L,  ?Г:` ":  ?   `D , :  ?*   `  : . 􀤀E $ =? &`T   ` < $:` `2#L*` €?#!耢 * #?#耢 쀢`* *`  耢 쀢`*   *` * `2&@ 㿘  0 @ @H? /"㿐N  / (  "`@' " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿀 %!' @B N :   N :"Nt L N  `E ?# "p@&  "@&  ",߮ )N`:`.`2H N ΐ ˑ4, ,   6  @2h  ,!N`   8! 4, , `$   ? % **  @A  !  "         @ ` "  @ @ @`  @ # 2 @ 㿘 @? @$㿐 ^?@*H`0@`  `@@"`0@>g `0"`0   `"T` "a"aT` $` $`@>T` 3\@* `@>  ?@> `2  `C  $`4` $`$`$@2(" $`4` $@ $` "$` $`$`@*!㿘   2 2&   21q    2& 㿘  ݔ 㿘 #Ք 㿐J"` @    "&@"`?㿘&J"` " @ ! " "& 㿈  ?'  @CP ?? 㿘`40C "@"&&@@8,   `a ?"a @” ܒ`"&&@@b&@`", 4@(Ð ހ" ,㿘 @C!@% ` @$   2 `"  @$ @D "   @(&㿘!q”   㿘@   #(@cc8&@@` &` 㿘 @'&@<  & @<& & & 㿐@    #(@?c8 &&@@@ג  􀢠"@L@ # J?` '@ # $'`@<` ?@?& &` , @c@  ,@`L@L@ "` "`cH@ ,@  J 2@`?#@8@*`2 & & ` 2` &`@̐$"@$@`P $@D@>@'% ئ&@D&@ "  `  ?2  㿐@) & {  5!! 66  667#(c|Ȗ86 6 & $& ,& (& &    @): 㿘 @\  6 "(#`(`L  ">0@";0=@'- @2P  @ ? 2 !?  0 :@ d < :@  d  " : @ DE       "2 @'* h Ȁd6#Ȁ@2 T & X 2  <   (4 А$$L4 2T X @B 2$0 @" P  @ ? 0 @ :d "0< :@ d0`" :@ D8<" @d  "@@d   @2)L4&L@@ @D 4%@2L@%@&0$$@` @@"0@: 0"  ?X4 L  :  @ @?2$$0$` @@"0@:] 0" @ ?24 @%  @ "@$$$@&  ?@?20?0` @@"0@:. 0" $ ?4 $ 㿘 ;   J H ? 2H  J  㿘 & T @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   + #H  $ $`   - &, "P %   ?"% F7" #"?F&  @`?T @ `  ?ʠ?T @ `  ?T @ `  ??` &@㿐@&    "  2 @  2  @{  "x   ?''D'''  ܘ @>      @8ܮ  ܘ @> ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @;D>  : `    * @"   ?     + "    ? 2@`2@@ + * @ ,`D "@80ɐ"* @8W @8? @;Ɛܢ @    2  1 2  ) T %` %` @;K \ . %`  T@;A T   ?@`` ?%` @;1 D`%@ h`Df / 2 ` @:"Y  T`` %`` %`%`   *  @"   ?    .  @"'   ? "%` "%`" %`  @;0@@:Δ@ Ց.%@ܨ *a @7ΐ䀥@ D%@""@7Đ 㿘@7㿘@; @7 @:0 p #P' #X' '  "#h''''''"    @8: @H԰  J  ,  ``" 4 @# # `" 4 `@` `/ '@@ "  㿘 & T'H   ` `2 -+L  L0 L x XL )0  ) #?)  >*ʖ )1   $ `%E    # &I "m B  @ @  1?"1 + +<@ !b @ @  1"?# ?+v<@ B   `T @ `  `T @ `  `T @ `  H  H"@㿘'L'P'T'X@L㿘 %c@@%㿘 %@@㿘 %@ϐ#@㿘 %@ђc@㿘'P'T'X@Ph %!'< %#@@   cx ## #ߖ#` : ' %z#` %#@@@̠ Ȗ((  (6'$@@ ̖ А@ & 6$` 2` 2`  &`` Ғ & 6$` "` پ & 6$`   :,  , *` B$- + :  %!`%N m`%@@ @fً cل & 6$@`N % `` `. . $. *` ő: .@[ & 6` $' $` '''' 1Ô `  `` @@_@@Ȗ ?`7@C@M@  @@ ?`7?@`    .  >@ $ $` ''''А1{B@@ %@x %!  > 㿘?"& B?&&   %!'2   g ?3& J ?-a  )  ? j ?/??????????? /`07@7 hBv j? B&& a   @㿘 2&& "&   &㿘Ba?&& &  `"`㿘 0 V_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_P_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_x_xVVWWxUWZWW_x_x_xX_xU_x_xYhYZ<ZhZ]4]^4^X_x_x_x_x_x_xV\VW<WW_xZV_xXDXhXXY_xY4_xYxYZLZ]$]]^^㿐@C' "@ "`2*? *H %!'Lp`%fL`z`#l*` €Y``  P*` |  "@yG``  P*` `  "@i7``   P*` 0  "@Y'``   P*`  "@J`'l  @O `   ' !8`  b@ `  b@ "` b@` nj "  b@Ͱ`  b@ݖİ` b@Ֆ` JF "  b@–` b@`  b@ "@Ô`     @ {" w#@ b@t`@'`'` '`'`'`'`'` '`$'`('@ 'ؠ  ֵ@O F!H # @vD` `?@" b@P7` "  c(@E,&@ i `'l`` +!?! 2m!! d 2n!!! 2mn!! !m!{!wt d !n!n!jg! !m!n _&?[ $?&   4` -` - 5-:  V g  b@ '   @՚ #0``` " @H   @C  b@}` c(@u l` ` '` '@fd' '`'l  @Q`'l  @H`( @r@` D`  %cd @ @c9` 5`$`6  #@ #H@Q?ܒ <?ْ <* ,  <,  cP@#  `  . L    բ#X㿀# %a' A@ a  Չ#`@ `@  (*@  㿘R dN d?w d?s d?o d> d  `d ?`    `  #hb  &  bJ ? * ``㿘q  % %#`cd"cd"x  4L ?*` # ` ` %x#d`4L *` *     *`  ``  6`x 4 '  _L@@x ",@  &L@``  x 4) T@3ؐ @# 2,` ?` %!' #X  N : /@֒ / 2  c@  2  N /@ƒ .   2N  "8?N :" N /`?%  `")?@3@3 #{$@ `($@ $@ @ . 2 D  2?)| ?X? =Ր 2?` ` `&@` &``$&``(@`, 24&` ` 04Ѱ?` )ar4ʰ?`#`24Ű? 2? 2?*@ +`*` `  @? *  $@ $ @ ?&` 6 ``, & ` `` 6`e @*` `` & @` 6` gL`& @` &  @``& ` @4l?`  `   #L@ @*`   `#L@*@ 6`!L@n&`j& @ ` ` gL" "` L@` "` 0?` ` 6`gL" "`L@` "`?` `` ? ` , + @ @ d &  !  J 0JJ Ѐ ,-+2 J *`8  J2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *@" * @&@N :   < 2@  &@㿘N -   + ’   @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` w  "$ N . `      &@` !ma 2N  / v` &`㿘 ` H d 2  B! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @  8*`@ * @*`" *" *       &@ d< d,`@*`@*`<   :@``: @.`"@͒  &`@ ,  + - @* *`  8   &+  * "*"@ *` `  @0Ӑ!'N <  >N >2D?&e&N 1ђĴ "4?   2&@N  <Z >N >2?&?&N  , ;  2N?Đ1'N 2N   N , ;i ഒ "?N ,ȴ "?N 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب ';  ĔȀ$ $@$@,`$@ ,,`$@ ,` `  d 2  ! . .*@ *`" *" * Ȩx&` 2?  `@e gP* *  ``gL   eؔgPgL@@6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &ghĒ  &`&gL &`&gP&gT&` &` ` "8?#L@@@@ 㿘! #p #p 㿘c ?"c!q  耢  /㿘!@2a#@2_#㿘 @.ѐ #۞c "@ 5@/;!@ $c"@]!L 2#qq"x "T"""P"L 4cp@K"0T`耢 L :`: `㿘!@2#@2 #㿐q ``'`  % %gP@ *`` e% %`    * 6 @* , 'L@@@~ &  cL @ d*"@ &(㿘!@1#e @1#㿘qc  ,@1 " 㿘#@1cc !x "c#@1c#Ē@>` %#`#&(㿘 ޔ㿘qc  ,@1{ " 㿘Ɣ㿘  < 9P d&9L!88㿐 D !L!P * 2.  4  *     *   @2   @   ?   @ɑ*''Ta8,`@*`" *" * &$8!n ` ?'@# ?$" * *  *  $@$@'`    d 2  ! . .@ 6Đ,`@*`" *" * ' %T ȅDB'8,`@*`" *" * $&@ T! ?"   @? Q  ? d 2  9! ,` ,`     ' d 2  !! ,` ,`& @  2u    d 2  ! ,` ,`@ Ӥ&@l8 V &ʐ?ǐ'xN  "@@ &  & &8.&֒.8 <& <ϐ&`  ƒ d 2  ! ,  ,  * `8 &*``*`&& 6& &$& 㿘&1h" "  2` "  2`㿘@ &87785Ԑ@"&@㿘@ &87785@"&@`` ` ` `@ ('PP" ' ''''' '$'('' ' < f?В < ^?  W?ܐ' N?j'l H?Ԁ )!n' _? 1؀     Ӓ d 2  ͒! ,` ,`@ `'Ԁ!n() ؀       d 2  ! ,` ,`$ 'Ԑ  Ԁ!nݤ' "@ 'Ԁ  ''ؐ  ?ؤ8*    d 2  y! ,  , * @Ԁ@ؐ8 ð?Ȁ`;'''l'4'ʒ?ŀ ?Ȑ ;''''Ȥ  ,"F8xq #`? ,`* 'PgP耢@2-?`? (, * 'LgL耢@ " '@  ĒȀ 2?耢@?전??좄Ϧ[?44  :`: @@''@4'@  ? `&' ?'`$耢` ~@  @' 2"' ?@ P "@㿘n  d 㷐   & `" v && "xq # 6 *" *?  ؖ  * `2" - #@ <  @6C?P-`@*@ * 23` 6/` ,@ *` *  @L-`?"@  && }`2 "@  " `?&& ؕ,`@ő-`?㿘!@-># nb@-6#㿘?" 㿘& ` [ 㿘& ` Rq蒂 L*` 㿘'DDD&㿐'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  㿘N@ `@)N    2N@ 2N?2J@ "J`  2J@ 㿐iA  ?&㿐 !А5%"@'"@* "@*`@*`'@,n  ! %!'''" ` ` @)<!`#`? "77''''*!  & ЁX  N "g @)) @`"` N@ "\ @) @$'O '@@ΒĀ  %F #p Ė ?'''?'''' ` #\ ` 1 1 П!     `@`Đ?"`h@2谒 a`@%C'@ ' @(Y@@*@a@ @āP\ `N "w @( @`"p N@ "l @( @$$a '$@'@@]  %V #p  ?''?'?'''' ` #\ ` 1 1 П!$     `@x`?"`h@ఒ !$`@$'@ ' @'@@*@`@$$@ $ @'@@*@$@ '@@ %!' 'D!V  ? e 0ђ ?,`#2U 2 %#t?"  ` " @@$ 2 `%b`$t&@D - @' '" D@ 4  2 2 h@$Q l   @'Ô l?& \& h  h 2A hD  (8$ f ?"0 h0c !`#  '''Ē '@*ĐĒ@ 2(& h2$l2 "̰ @$3Ȱ     ?   ??//'a'b  @" 2  @Ԑ!H" @$ #   % @" @# #p'''' #\@10# DЀ  "   % D"@'HaX `€ ?c& h @ `* @7 `/# 2 & H"W @#S   & L. H. I& P& T ` . J ` . KԔ A. L `. M `. N ` J. O6 X& h@ 1D %#p'̑2`@:`' ` ? @& \a''b H + \ & ` @A! & h \ 9j ? @!b&%b`2&@   Ǹ!㿘 ` @?& \& `㿘u 㿘"  @   2 ` @`$@$@#60 dddlld$d$dddddddd㿘1# 2#@"!&##㿈 !q `€@x !a 6!! P$@ 耢`>& <*` €@ ۔7  Ԑ@ 6 ,$@ @얒  ƿ  Ʒ  Ʈ   ƥ@ bX. @~!0 ` ƙ 㿘 % "@%bh    Ȅl* 㿘 % "@%b㿘W ,  \`   \`ې  Ԑ @0 R!  Ő  G! ,`,`㿘ː % "@%bh   * 㿘!#@8 #㿘  `"@ J@  "@ 2N@@%q  @ *@`N &*@`@!ǐ  @! d 2  % b@%T"! $ \J \$  2@ *` 26 @!Ґ@!Аy  6#$`  T &@'  /   ! $ \ \$ ?O`/K`$`$@$` $` $` `L$` $` d$` @&' ''''Đ`0 @= @ 2 `P` #`/h``€`P$`H``(@()#Ța@ %#x$@$$ `@!] @!X h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ג q $@Ӓ  $ $h 2@d   ` % $ $Y %1" L&@'`L'`''@m'耢 F@  $ "'0<Ȁ2' @L $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@X $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " P.A P `@ L@ P@ Np2   * $, ,  '7.#cR Ь"@  . cC"@'"`'ܐ@? ؖ"@ 'В"`'Ԑ@?В#* $, .c,  $ `" & $` 0?  Q ""J"G` & (& $?ޒ 2 6 & $& (?- & $& (㿘 R?&?$ $$ ( @㿀! 耦 2  < @ @ 2$ +  < ' L % L&  c&  && &  &  & @3 (@1 @. @& <  `@㿘 耢  ` (<   LXdp|㿘@   ``@ C!㿘@  㿘 @` " `    ``€ @`  @`㿘@Ւ " @   @ޒ`  @ْ`@` 㿘@̒ @` " ` 2   %` 㤒`@   㿘 &`&` 2 @ @` @`  @` @`  )*  "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &``" % %" " " "    " " "   "@   "     # d? *(#d d*`  *` *`d#@ #  #"@d 0#d*@  *` *` *` "  #㿘  " $ @ ǔ  @$  㿘 @ "@$  @   @$    "    @ " "        " "   㿘@㾀 %!'`2`!'쀢?2`^?@ ɒ     '`  ' ԰? .G"'` ' ) .`*  .@ '䰒 0"͘  )!b ! "  !"@ L쀢  "!  s"(p % o6 c?c!'''#\ab7ڐ ! / & ' `2''''' ,#\̘!l ڀ   "`\ `\`  ڀ 2  "`\ @܀?"6 *6 ځ㿘@m @h`  @c` @^`  㿘@ D  % "@ b805@@ $ <@ @n$ @  $  % "@ b8@0 $   2 $   & $ 8` & & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @1 2  & @ "㿘   4   8 2 @f 󀦠 8@> & 4"$ 4@㿘!    " 8 @ & @@$  @$ @  2  㿘   @  ?   "  , ?  "@ @  0"@ @  㿘 ܐ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @y @w㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` " @? ?"   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@ ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?p %!Ц' N  @'$` bX ''ܢ@ $@@Ր$`` "` $@:$@$`   "h㿘 )g  㿘`    `*. "  0.)B ` -. 㿘 "p@ޒ   \, @@b@  "`?@S@  " " @.㿐S  & ,x   b#\#`B ""㿐 b #\#` aP   㿘? &?  "" L @ 㿘?2 ="    6    ?@ .@ 2`@:`+  * @    @ ` @ 4@ 2  : + @ *` Ҁ6 ?6 ?@ ؒ@ ,㻐 %!' "?N @ / @w, 2   @" 2  " @"آ  "J B  ?* : `(3/#D*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ?  " - ?,6@ &$?#\   @ &}?2???#@ @Y  && ĐKP?J       (+  2 " 2+J " ?J@   J@J`  㿘@& " @  2  @`@`㿘@  `@  㿘@ޒ㿘@  @` @(` 㿘@c @㿘@\ @㿘@/  @"` @`  㿘`@ܖ$㿘@ @` 㿘`@Ɩ$㿘@㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐N@'Ȓ  .@ 㿐@'ڒ  .@ 㿐 "    0@  @ '€@€    @ &@  㿘Ȓ㿘$ "        `2      2    & `0`?㿘@l "2  2+ "   0"   @&@   % "@D`8    @̐&@㿘`–$㿘 "   @ "  2    €㿐 @   "7 @' -8+ `  ` 0!  2@G&@   % "@ג`X ,1@a&@  㿘?80@(@   3(             㿘T 2 0? 7"   `" "a"a  @ `" @  &? " 0@  0`  @@" 0@  0" D "$ @$ D$ 4 $ 㿘    ? ɚ @k  㿘 0   `a ?"a@  ? ?$  @`$㿘  @㿘#` U$  2 0  ? "  @J4 "  @_ C? $  ?4 $   4 ` @@" 0@t  0" <`$  8 '$  2 @{ 4@Z"(  $  $  ?Ȑ*@$  4 2 @ 4 4 $ ? 㿘 2 5@8 H  @ ? "㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘 %" ? T` "??`X2㿐  C & & '&@%@    C  & 6 & &@!`& & & @V  2` 6 (T  &&1L  &< А`?`&$&@(&@ $ L( (6#Ȁ@"$㿐@`P? %a  @#      @  1ᰀ 2! #\   @??  2$  $ $  &82`$ $$"8  * "  $ @Ȕ  " ᰀ @㿐@G`A %a  @#   #\   @i?? &82  $ $ $ $"8@  $ @}  @㿈 `    '?   @ ? ? ` %!'    @8@ ڒ aa    x㿘 `㿐@  (  ``  @} " f " 3  `6!3 6667#(c|Ȗ83 # $# ,# (#  # 㿘T w  P > B< P ?Đ*@4 㿘 ! V  @-  ?Ē* 6 V E'㿘T   @?  2  ?Đ*@4   4 < P㿘 V 㿐 <  ??#\  ǔ@  * 㿘N r   w a  0 0       & "}[  "N + b @ N  +@   @ &@ (`` }@  "@ !ܠ ?$! $! K?$!}+ ' !/W   Ā@`@  ` @ K0 & " &$!  <$! !!?!|q2o O!a@2i O ?   !  €  @ " Z O (Ր @ʐ 2[   D* !8  *@ :@ *`$!@   `@.$!0@*@$!0  ! @ ?$!$$!4@ $  8| @ܐ|%"9899:9 cЖ4"bHȆ & & & & & & & &  & !@|" 㿘 ?@ @ 㿘 " ? !?|e? "( & <` ! @$ $ $ $ $ $ 4$! $ 8$  D @/  Ē @+ @`  :  @Z$ $ - " @P *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$ |   "$ @  㿘 4  & @  *  D# *#  * ,& $& `@ " ?!.`2 ? & ,& < & 0& (@ , @4& @㿘!4@C   {!؀ !!ؐ?* &! @K!??&!@D!@X 2!{! 6!!8, @ "!@-! , ! "!@"! "!@!?@ {u?"㿘` {l "?"? !4  @ܔ  2 ?@  2?&!0 㿘!4 4aa!  $ $   $ @!! @Z ?! ?  {3? O{0"$!,!8 đ. ` . @ @l  2?  .  㿘 @F {  "&!,?㿘  "!z  !  z "&!,?  @㿘 z !  @  z "&!,?㿐 @ @ ?P ` ` -` G`   % 2  `@ @j G`   @ "s ``݀@̘ +2 `'@ * 2 `@Ζ "W ``  T?` ` @_ F?F ` `C `! ``+00 `6 `,@  @  & "@&@ 2 `@*  `?@  ?0 @ ?? ` ?-`㿘  " !$z "$!,?!$   $!($!$$!  ! 2!$ $!( ( @C "o?$! @ "  ($!$?$!$a !(*  `2@ *@ @% $! $!(`  @ `!$$!  $!$"! @ "! !**`     @5  ,?0+! `@   &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @ޒ !ؓ,` "  ?!! `&!&! (@m    D*` + "&  ,  & ,& 0@㿘@   @ɔ&@  @ $㿘! € , (  0㿘 @   $!؀`$!  @.@   x?2x"   *** !ؐ"@  㿘`*  m* 2 *`*  4`$ , 2 @d  +  +  42*`4$ 2+ * 2 4 @8`|%0+   &@2 @ ,$@,`4 2 @*4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 @ +  +  42*`4$@ 2@*  2 +  4 @ 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`@W @ː`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`@ @ 8 ?$ 8㿘`,  " *`2 (  `$*, 2 @k & @ $@``" *2   **2  ?,  @G ??㿘 @+  ? @Ɛ "    +  @  `+ &@  㿘`.  `2.*  ? @ "t?`  .  `*  ? @ ^` ?* @   2  "?@n -,`E?  &" !&  * !$  &!(&!$&!  ?@Q )&!  &!(`@ 2# !$&!  &!$ ,`2 @?&  !@r ! &v "?㿘`   "@(`! @ S@ " A&!, &!( * ?@ 0&!  `,!$&!  &!$* @ Ĕ $?,` 2 @ ! `@@ 0vw "?㿘@  ?&! &?㿘```? * 2 "@ ` ! @ @  0$!  ,&?@* @ ΐ ,` 2 @ !``@@ 0v "?㿈\'P 2d?@ P* 2`` 4 P@S $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`@=P  ?6P"$ $ 㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?@-  ,$ ! " "@!&& $! "㿘!! @ @!`"@`"@!$@$`&!`"!!   ` ! @2`@      @ @  $`@   @  ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` @L 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     @ 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   @ 2?`"  "  @ ? @  " @"!2  @"``"` *` @`"!"`!"@! ` " @ ` ?  2  `t`7 ``22`@(* * * * * * * * ؔ   (  H 'T & @y T 0.?T2 7耦(7耢 2: " 4`444`4`4`ؑ45 'ē45 5 5  `A'? 7' `C`s`*  9s`*  /s`*  %T` s~T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', Đs  'A. 2, @ ( ?#   ?#/@..  ?$'$$66`% @"6``4@  *. ?  @26`@4@Ā2T`#@  " . @?* 2@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 0 2 + ( 2㿘  ?%rt   "@ײ @ L Dh0hhdhhhhhhhhh h(hhhhhDh\hhhhhhXhhhhthhhhhhhhhhh8hT㿘!͐!`` 2 "[&@! `` 2 "Q&@ < `": 2 ` 2 &@&@@` 2 (````"2@` 2 8&@`"*@'&@`"%@` 2 8 @&@``"@` 2 (&@@ &@``"@` 2 (&@@ 2`  ? p  ! 'Р @  al''@  ''@ '@ ' `' 'Д '  &\ H"!4"\@p & H `ː !8`  '@ n al'Ԑ @ h'''@ d'@ `'' ` '' s 㿈! & L. % #\   @ 7?8  L 5 4 ` `` @ V !ߐېad"!"ad %  #\  .  @ ? 8{$q   m"􀤀` 2 $ 2`  -  2  @אa,  '$ " `""` ``"`$`   " 􀤀` "` pВ` $@ $` ` pƠ $`  @ "! "`'􀥀- &8 *` H! %!'p %!` @ +      ? } ,r   2v @ #kfLđ* : `>UB *` € &`D* R"`D &`D2 M"`D &J" H & F"`HC"!@ ?"a@ &<" L &8"`L5"!L 1"aL."!X *"aX'"!8 #"a8 "!H "aH"!< "a<"!P "aP %aT  %aT! & H  $ H$ HL  maT  "aX#\   @ט? "! 1!o  "'"c #a"  &D # # # `  "DD* o"D"  ! 㿐# &?`L !    3 @"3 $  H$  `'` 2 : ``"'` 2 *`'` ` 2   ͐!0o{  " $ ' L * ` ' "` "@L`& !@`@ n `6 `T5`   @ -"! "@oB *  $;. 9 o4  '@o**  $L o  '@o*  $a`!D@L'a`!X '!D@ے Ѐ ah "ah@T㿐? (    +?>   >  `a,`    2 2 * `  *,  @Ր ``   6 6   : 6 * 2 2@6 6 & @  6 @@Z 2@*6 6 6 6 &  4  ` ' ?2 * #@ `" 6   2*  (   # `  ( 2*` (*#  #@ ?6 6 ` + "! $nO* $a @&"@aP a`  "    ,` & L`"@n&  $,`   2? $ *` 4 a"@$?aX": *   ,  @А㿘!` D!4`!@!h  $!h!H`  1m   "Ӑ & H`2  2 !P!T` @ `1#㿐!4`@!`2 Ԑ!h!H`c c 5 `ܰ   . .  .  . @ϐ0ˡ5   !!  !0 "! "!mQ* @ \? !آ mB )   ' !4 Ր2' )/!`m$    ' 4 2'  !m * @`< H@F?@B!X`v%@͒ M 1  * ? +!?-4@ 4`*   `2@ ` " a<* 2 @2 @ !X`D%@  "0. 0Ȑ   ` @+0@&@㿐!` !h0!4`!H`# #@"& 6    "2f "0!   "2Z "0B! "! %! lc* `@C%`  *@?.  2 !2`*  2@  `  "%wh!X` ,`@  Е,  *@$ ` ` `4` ` !*` !` `2 ``%@ " ` : `" @ "  * $@5"@2%@2"`2  ! "`"! %!`2 akې *  $` 2``@ `'%h А $h㿘 2  "&#\"\ %!`@k "㿘# %a !@!\  c "l $!\Ӱ 0!\$!\a @!P`  #0kl "㿘 # %a !@!\  c@"l $!\,!\$!\a @n㿘 %!`@b\ #P "al"\ 0! Fa\$a\! @C!P`  d#0k "㿐   "P0 ~"h0? w!0ѐ!!j*  $!`j     ' 4 '79; &jِ*  $@jВ    ' 4 d'  @j* `aX ,  @`!D"`L&`"@  '!Dj@*  $`LL : a@ @ h  h  m"ahh"`"` "`!  ! "`"@ 'a Y"!h @ `` @ 2@@ ah"`" $` "@5"h` @@%@ *$` @& $` $@" 2@@$`$`$` %@   c"j "ah" "$@"ah!` @ "! "! & D`"@ "@ `1`  D`"`6` ` $`  ! 6   2 :'! `   ' 2   m 2 hDiȒ* ` i* $` ?"` i 逤` '2` " ``" `" "``0''    .4 `` '2 " ``" `" "``0' 2`!d@* "$!d` Jah "``a @1"h 2)@! ! 2 "!d 2  Z ?'!i** `* $!d&!@h "@@'a 2" ! "ah"'! i㿐#?' @+  &`P   `     ` @"Pij    @ ij А @2@  0 Kc@2" cȐ?? 4  / "#8*"@ J=2""  J JJ 2 J=ې    㿐ƒY V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*(㿈'XX#d#h#\#` @4 Ł J " 㿘'L'P'T'X1L㿐#\#`  @ 㿐#\#`  @ 㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘(` g  "L 2 $?g  "h<L`XH  0, p ? L X `L X`?#@ gk 4GA,? `L X`  ``%<' L/2?, e,  `g4 ]"8L`*D!  &@O , A, a,g` ? "! "7 g `/ ǒ  f` #`? a &L` `Z" , T `@ `  `*:  z  %!  % p'?h'd hd @ g{ "bx? .` `.   | @.  ` , ,  . @?a" "b|  h㿘!p` t *@? #!p**t㿘!p` atat? *at ` `,  ,@, ` - - ,㿘b|? "b|!p` fbxtt (t   ` + *  *t  (t ,   ` + *  *t  (t +` +  *  *t (t ( + *  *   *  *  + @+ `  <:    2 "-  ?`#N#(*` €#?###    (",&  &eh "?Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*$2 Kc@$ Kc@ $ʄ Kc@$x Kc@$J Kc@$Ƅ Kc@㿘,` ``$, @2 `^,`2`6 $, 2 S`,`2`,``2 6**`@6$ 2`2`㿘`. `}C"?. "  ,"* *`@`2 `" @ @4.`22@22*   @4 248?$8``.`㿈      2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'2%* "@ , 2 $ @ @ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\ 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2` c  @V   l  i,`,`2  ' %@ '`' `# 'C`2#  * @  `@  @Ӑ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ے 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?3 "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  Ҕ`鲒 "`?@Ԕ`  .` 8` & 8 (|` 4 $  ?㿘 4@@ `2  & 4 & 4``@W.`,`2 `칖  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  <M?*  D@ 6  *@  <?  ; ?*  D@  @>  ? K?  `a? OB"6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.`.@@  `@?7 .@.`` 㿐!? @ 2h?  ဢ@,! "@ :  $'++ + +    @ 7 **  <헐?*  D@ 6  *@  <  텐 ?*  D@  @> o? aJ O"?㿘 !!<   , &!  " ?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?=@ 1 8. @@f Ā2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$  % *` ,$   ?$   * ?2% ``m , Y  2m ` g $Z % * ,$  , ?$   :** %  * @% , ;V  :**$   * @%  *` $ ?%$  D D .  4  ?* D@$@ g . .  6 ` 1' `1 " 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @  :**$   * *# 뵒㻈# %a 'a 2 p   ! $z?' ?&!ed!  Y   ! ?a  !㿘,``$4, @2 `K`$ 6, 2 B64`4`` *`$ @2`* 2 㿘!@6  .`!8$ .`     7  2   *@  2@* *@ 㿠%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmv-shshkshsedmkdirejectmtrmmount_mfsnewfsinitfsck_ffschownchgrpchmodgzcatgunzipgzipcpedmount_ffshaltrebootdhclientftprouteinstallbootmknodfsckmount_udfumountfgrepegrepgrepmount_nfsmorelessping6rtsollsifconfigcatpingcpiotarpaxdisklabellnsttysyncmountdfmount_cd9660dd!Y !Y <!X P!X X!X @@!X !X !X !X !X @@!X 4skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qdconv option disabled%s%s: illegal numeric value%s: %s%sstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out %zu odd length swab %s blockblocks%zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryA.%sskip reached end of input!]!]!]!]!]x!]h!]`!]X!]P!]H!]@!]8updaterdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rrealpath %scd9660%s: Filesystem not supported by kernel%s on %smainusage: mount_cd9660 [-egjR] [-o options] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list %lld %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s A@Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fssoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rswt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountdmain,/usr/sbin/sbin/statfs %s%s on %s type %.*s: %s already mountedexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmaxmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemdirexeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-ousage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s!i!i !i!i!i!i!i!i!i!i!i !i!i !i!i !ix !ip!ihwerasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard!j8!j0!j(rprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP!oH!o@!o8!o0!o(!o !o!o!o!o!n !n !n#!n3!n#!n3!n2!n3!n3!n#!n@!n@!n@!n@!n!n!nx!nh!n`!nX-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5!r!r!q!q!q!q!q!q!q!q!q !q !q@!q@!q!q!q!q!qx!qp!qh!q`!qX!qP!qH!q@!q8!q0!q(!q !q!q!q !p -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk!vp!vh!v`!vX!vH!v8!v0!v(!v !v!v!v!v!u!u!u!u!u!u!u!u@!u@!u@!u@!ux !uh !uX !uH !u@!u8!u0!u(!u !u!u@!u@!u!t!t !t !tC$!tC!tC$!tC!t!t!t!t!t!tx-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho!x!x!x!w!w!w!w !w !w!w!w!w!w@!w@!w!w!w!w!w!wx-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostoposttablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s print%s: %s %s %s%d-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.14 2006/04/25 04:38:26 deraadt Exp $Ffhns.%s%s/%slinkitusage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.98 2006/07/01 16:50:33 krw Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsBEf:NRWb:cdenp:rs:tvwbckmg%srioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:A?P>> %c: %13u %13u %c: %12.*f%c %12.*f%c %7.7s%7d %5u %5u %4.4s %5u %5u %4hu %19.19s# %s# Cyl %5u-%6udevice: %s # %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u total bytes: %.*f%c free sectors: %u free bytes: %.*f%c rpm: %hu interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %hu partitions: # %13.13s %13.13s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cEDITOR/usr/bin/vi%s %sfailed to start editorfork/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)usageRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%swunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) editorNo space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. editor_addpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and sizepartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk %s: [%s] %s: [%u] %dRounding to nearest cylinder: %u getuint@YAA? Error, partitions %c and %c overlap: # %13.13s %13.13s fstype [fsize bsize cpg] sizeoffsetDisable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.edit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd!x!H!!H!!(!!!!`!!`!!0!!!!!!0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help./dev/%s%s%s%c %s %s rw 1 %d mpsaveStarting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. \{sƑOJ˻qKIc%*d'`wX\+5/`IIljwt9{~q߽x'yt^d(1<;A9`J;?~]8 PMhumn;^^mMy۶4>dN>`6bh,{sV'2:^ ̋Uo`U;|ب^La5þz( ,:jT^L f`FCn,/sKi;Lun٘n0[fjO/iܺ-X|2g, kJ O Vz+Wm];G)# ĬWm;ءWL1UָjK8F(6.- v0<$L+Ȝto׽ڒ4fxu !0c2b;kOi'єuVkGQN \JDE3v%nNZK6Ap>o`NGLcS̰xR[e9"-פ,<(G~^7f*tN,m0W hHkTz$s2{|c( ڞf>_v~j8󫳫eJՒvg3vK $vT/\Pa e0v S8%jFS0 ~ YiPhla % / *JtW/庹3}lPTotwf$7ш1&jahVKŗ'9c7CQN6$aێ57 J&Z9X\p$w6oُI I ބ䃫U5:jvPAjBb00&b9zen)` ̫THy(5`, \0Vf`@dQ>6k-Lwƚ^ո^邻ZmӸ"}m -cKVbm85-퓔w#(b?yצ)unnWrekRZ8¸Ť8z:pSԃI<|4 2谁-Xdv;n5TZb&3CC_6WE!QPt!N'G9 (Bc i՝/..CEe@Vld3h-By,g-L y.[כOyY-V(LUTXo>Q/^o);vhR0S#KdezaH rX7?($Q3OQKCC悯 ijnB06lMaLQnUEHGHxR6X.4grozYΡ}i$ppuJA`y@ ĘS gY_.N" $&WmjЧOVg0H:@lP7ÐTG<4E _kOҏh) /"X?14]d`SzlXq[rV|N|%!N9e`"GP| Cjڶ`E35b%Gp.FiS^cI6۵Gc]~.qt8!”KCq4 nWLjNٯ ]Ȉ16{e`f|*(b~M0B^hq"k[0*Xk9ނ6&7\n=LFh&9` Nv J/񚄦7`KflC+XsgT*fn=RjXu'3k_Y Yz<ߎǖ sZ5.fK3 q:n8;'909^`0.0BJ3u"Eoh ۍ >}X,UAox>Ks#qB$ms ?0ױQ^2RO+h:I<=!4m-,=az Ugv(PO)pf- Ԥ:Мu$OaC&PAZPSKh`%g7Qt=NHXh~HC2p(: 2d#.5c$a毜TN gKxz hM°B!,~s8G{ WqC @[YNߎ oQU@_Bֵm\mq[ynhZ*Pu`Ѽ6:eb=@SjȍܬiX7,\=9[3|eN8z.geT 2?p -yzn~pIY8Qp3lfhc0P+̹|qx޷9> EKH{0`9DN;ye M7vfFqAH]F9"^~ }9[OQ6͕$fq;7`gAFZ"vXA3Ҳ䰉@Kz@0zpFji~8 _n40O*SDS,.h4SH"r4KlXxP@>Ռ8JSovtHW!\j)&t]* pQ)ynr6oF V;{( 4IU8Dт:Q=Zz#e@vפ~J.l)%驨WϷ=aLx\ɞB̨QڝlL nK~6bD%D»- +ކQmD״'oX_)b:U#N;Wj1WEF!AK550`8l*+s2 7~&堘p`^c t7RXz'*l'OnUjGM.WF}l>L\5d҂Dav&Bw|5>hIm`ޥGy)UOJcqd@W&,T#E`|Za@T8"W(:ds#ŻB]@܂)-Oti E˼áZ\:[(bC rUynvn#y.j g:э~< 6IV*TzJ󐯳s-v'v6)Jqul|$ Lj ID[.pr :sYo`~NGeݠ*9i쯒8^r8L܀jM-On&kN*K:&/Ĩ, H ",4*8 &~D?(S3Z%> S=w殽Z4&NYcڲ*udާR}.&I3#v̿MAL@/4l9 MbcGl$ZQ^ϜH[:B:_NBhvӎuIcCL# 0}1n1^h/XC?\g+0&I=.,0)]^˥5s{& S"1Z5eK>Sc]KGBr#>s{i[cv nb ~؇3{u9("tvݙ77è//D8^2Cp [T41A#l}vyi>ȵROP’dZ{lǓ|SN4n}t~\ơJU/T.A*ukT@!,A \KWIM(c׸ߞ=W1)Xkʱu[`ށGEy!Jv*inW+ޙA[y v&ѩNi3&#OɤPYp,§cN0uBhdUށj݈uqZ͢l7?k"7cN/Mgh$Vz؂@iAKrcNtraMmK>4 iiVpm *4 TQݵI=.p {gZR6]m )|;Ze{i|o"c(}zzu.KФ\}ьܬsf8(7un.=.C.)q7S9R]z,)-_4a\:u_&܊ CUY XxetHHjMcV# rL4zZCB4߈>)>Z0>P| $'QdlMBpq I#I1R$~shɂOPcdẸÖ /e q{PWܱ=(_JquWߙf3y_π-=1Ny8RL $s0O:ُz`-OƯpeXn|ʡKZ8= :9Sp|J J3X `c֝W0rK1kS;kqA EI4ݤI~}{]|}'DS=O|:VJc'mO&4|3KqnK]}fљB™l髹 o΄"Q#C w]a4YjUВkgi@>Gś[~/LYoMvpӊ=&p VG}N/PsyՐbA> [*XS+ϼޣY>1hݍf挒6<̡(]k MO,jrs/\2=n?X$o)yI>ڒ }Gn3d60YmP- 7k5؋&z:5G:k b֋ QtϠ@澌 ejڱ5.L"ޡy4 ӪŔuNCsPvG7xw< /ch8]!OHx`t@,;>8jPF< >S4FiS{FGr7;,U Qxm(M!E^QjLHA ;Kfz2{o"-x,u}7JRa%qWlm[L/ %>,C?Юεrhf L䩏rz@2γiؑ똂Mo[ JÊ^ ,0Omz >#@nZ2.{&;)䴔Kx`#p2$77@\rT]ZnܺbCyJ]qQZ5 &o?p%ϥ[v=///߇^b0~ĝa]g\̜pNY۠ž.YD7t8K(5}k#,vRbh1?ߟO([ CFTa2J-s uE::gϾ*(?t!5IܪCyʒtG'pbBB3ނa_>&Hݱd2!${HCb32/uQo̊kI"IxP${W&NܨUv[7Ad`UlG*=<29C%%`=WB$er9U;xGty9n&+g(6{t$"<-yv=noѱ=!/VL>Bb!nWe]c-,RjD([p0'l.jӺC京9(}Ѹ߻~Ӷ9NXU3|@,[é6vOъ ͳ5rEm[Dt!=<tgh&K^O'#١e1؜?9iPf$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec$OpenBSD: ar_subs.c,v 1.30 2006/07/21 22:56:58 ray Exp $listCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%lu$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $TRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wr$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $Unable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crc$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %s$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => ls_list%s%s %s ls_tty$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $%s: unknown option %c %s: %c argument missing $OpenBSD: options.c,v 1.64 2006/04/09 03:35:34 jaredy Exp $ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Invalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578Unable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-I-rUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPE/%sabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list $OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handler$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %s$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $ustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wrUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00nobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wr$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $/dev/ttywrFatal error, cannot open %s%s: : %s@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.77 2006/04/13 00:49:15 deraadt Exp $socketsetresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %stos value is %s: %sttl value is %s: %smaxwait value is %s: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summaryA@YEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host benstuvusage: %s [-benstuv] [-] [file ...] stdoutstdin-r%s%6d malloc"+(")80")%d: powersave on (%dms sleep) %ddBm%s (auto)HIDENWIDNOBRIDGEieee80211_statusBA no permission to scan SIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTBASGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %s "6 "6@"6@"6`"6"6"6"6CARPTDMIEEE802.11FDDItokenTokenRingetherEthernet"="="="=#"=#"=#"=#"=$"=$"=$"=$"=%"=%"=x%"=p%"=h&"=X&"=P'"=@'"=8("=(("= )"=)"=*"<*"<+"<+"<,"<,"<,"<-"<-"<-"<."<."</"@"@@"?@"?@"?@"?@"?`"?`"?"?"?"?"?"? "?x"?h"?`"?P"?8"?(framerelay-ituframerelay-ciscoframerelay-ansippphdlc-crc16turbomonitoribss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %s%s %s%smedia mode %s %smediaopt instance %d6 physical address inet%s %s --> %s phys_status "Bp"Bh`"B`"BP@"B`"BP"B@"Bh"Bp"Bh"B8">backupno networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: status inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0infty vltime in6_aliasprefix %s: %s%s=%o%s=%x%s: %susage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] SIOCGIFGROUPgetifgroupsall groups:getifgroups%dd%dh%dm%ds%lumalformed link-level addressSIOCSIFLLADDRCOLUMNS1ACFLRSTacdfghiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%llddisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd printlong%s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] adDFadDfFm1kernel is configured not to accept RAskernel is configured as a router, not a hostmainfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routersselect: %sifconfigfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedmake_packetlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %srtsol_check_timertimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldrtsol_timer_updateillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dusage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgmultiple interfaces foundreallocstrdupprobing %ssockopenmalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_PKTINFO: %sIPV6_HOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssendpacketsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketrtsol_inputrecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%d) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpeced IF(%s)received RA from %s on %s, state is %drtsol_inputinterface_upioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...get_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedinterface_upinterface_statusioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sinterface_statuslladdropt_fillunsupported link type(%d)get_llflagsocket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflagprobe_initmalloc failedsocket: %sshutdown: %sdefrouter_probelo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)defrouter_probesendprobeprobe a router %s on %ssendmsg on %s: %ssendprobea:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dtoo many intermediate hops%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)setresuid-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_PKTINFO)setsockopt(IPV6_HOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> %s pollrecvmsgnew path MTU (%d) is notified main?A.@@sendmsgping6: wrote %s %d chars, ret=%d .%c\%03odnsdecodeinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOP???%s%s, (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lupr_pack@@ HbH Options: Dst Options: Routing: -%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap truncated no address ? %s(TTL=infty)(TTL=%u)pr_nodeaddr --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1lf%% packet loss round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms summary@YIPv4 addressDNS labelIPv6 addressUnknownRefusedSuccessNo Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Host Unreachable Destination Port Unreachable Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirect Destination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %dpr_icmphVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESP TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ... patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host LESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+! [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%s/HOMEbin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbers! /dev/ttySHELL%s %s %ssh (press RETURN)Invalid mark letterCannot seek to end of fileMark not setMark not in current filelLine number is required after -l/%sless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-fileNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/tty"~p"~`"~X"~P"~H"~8"~0"~("~ "~"~"~"~"}"}"}"}"}"} "}@"}"}"}"}"} "}@"}x"}h"}X"}H"}8acdirmaxacdirminacregmaxacregminacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgsyncupdateforcerdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -I value -- %sconflicting version optionsillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %srealpath %snfs%s: Filesystem not supported by kernel%smainhostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCfork/can't access %s: %susage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'bin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextline-bufferedmmaphelpbinary-files%s[[:<:]]%s%.*s%s[[:>:]]%s^(\()\)$r%scontext out of rangegrep version %u.%u without-matchUnknown binary-files option%s: %s(standard input)r%s%s:%u %s Binary file %s matches -- [[:<:]][[:>:]]mallocrealloc%d%lldaFfh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]"h"X"P"H"@"0"(" """rdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotausage: %s special node openo:realpath %sudfmountmain,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'$OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $Can't get resource limit to max data sizeCan't get resource limit for data sizedvpfnyb:l:T:t:-b %smalloc failedonly one -t option may be specified./dev/%s: unknown special file or file system.rorwrq%s has unknown file system type./usr/sbin/sbinufsffsfsck_%sstart %s %swait %sno %s fork%s/fsck_%sexec %s for %sexec %swaitpid%s: %scheckfsInvalid option stringempty type list,%s,%s-ousage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] $OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s SUNEXPECTED INCONSISTENCY:%s: %s (%s)%s, disk %s: %s %s in fstab more than once!mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect blockxresolvestaticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlennostaticnojumbonetmasknetmtumpathmonitorlockrestlockllinfolinklabeljumboipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpireencapdstdeletecloningchangeblackholeaddbotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullsocketmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) write to routing socketgot only %d for rlen %-20.20s done king bula sez: set_metric with invalid key0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway netmask missing%s %s %s: gateway %s (%s) not in tableentry in userouting table overflow: %s 64128inet6_makenetandmaskinternal errordefault%s: bad value%s: resolved to multiple values%s: not a network%s: bad address%d: bad address familyprefixlen is not supported with af %dactual retrieval of interface tablereadgot message of size %d on %smonitorso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelwriting to routing socketread from routing socketRTM_IFANNOUNCE: iface arrival/departureRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routeunknownrouting message version %d not understood%s: len %d, table %u, if# %d, name: %s, downuplink: %s, flags:metric %d, flags:if# %d, name %s, what: arrivaldeparture#%dpid: %ld, seq %d, errno %d, flags:print_rtmsg route to: %s message length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s flags: label: %s %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: inet %s; %s: inet6 %s; %s: ipx %s; sodumplabel too longinvalid table id: %sUGHRBD M@dmCXLS1@2 3cJroute-sysctl-estimatesysctl of routing tableRouting tables spd-sysctl-estimatesysctl of spd Encap: %-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-6.6s %6d %8ld %6ld %6s - %.16sp_rtentry InternetInternet6IPXEncapAppleTalk %s: Protocol Family %d: %s%-*s %-5u %-*.*s %-5u %-6unone/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-*.*s p_flagsdefault(%d) %sroutenameinvalid%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%dillegal prefixlen%s/%dnetname6af %d: %s0123456789abcdef*.**.0x%XHany*%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%slink#%d/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files Continue withmput%s: not foundmputr+wwusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetmgetonoffConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdusage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. userPWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmore|%sCan't allocate memory for $PAGER?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. domacroExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sCan't allocate memory for transfer bufferWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpGET /%s HTTP/1.0 Host: Can't allocate memory.[%s]80:%s %s Writing HTTP requestReceiving HTTP replyreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}cdRetrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopthookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %lldr+w%s %snetoutsendrequest receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR abort_remote@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46AadEegimno:pP:r:tvV--r requires numeric argumentRetrying... mainftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$%sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sruserpassstringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initftp_loginsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! confirm%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. .Unable to determine real path of `%s'fileindir KMGTP %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d ptransferA.>?P/etc/dhclient.confking bula sez: len mismatchFAILalias_routehandlerc:dl:quifi callocifi->client callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up . got link /dev/nullcannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"nobodyno such user: nobodypipecan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chroot/chdir("/")setresgidsetgroupssetresuid%susage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease. No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.wcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbininterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %d\%03odhcp option too largecannot fork%s [priv]poll errorrCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting string.option data buffer %soverflowoption data buffer overflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementgetifaddrs failedno space to remember ifp%s: not foundCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %minterface_statusCan't allocate timeout structure!can't allocate protocol struct for %sinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcScoption %s (%d) %s.larger than bufferMany bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal buffer""""""x"p"`"X"P%"@"0" " "" "&""""#"""$""""""p"h "X "H!"@"0 token-ringtimeoutsupersedeserver-namesendselect-timeoutscriptretryrequirerequestrenewrejectrebootrebindprependoptionmediummedialink-timeoutleaseinterfaceinitial-intervalhardwarefixed-addressfilenamefddiexpireethernetdenydefaultbootpbackoff-cutoffappendalias%s exiting.exiting. %s line %d: %s%s^subnet_numberbroadcast_addr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets########x#h#x#P#x#8#x#(#x##x##x##x##x#########x##h##X##H#@# #@#############p#@#X##@#@#0#@##@######@####@###x##`#@#P##@#x#0#x####x##x######x##x#p##`##H##0################h##X##H##8##(#x######x##x##x##x##x##x##x#p#x#H#x#8##(###############x#######x##h##X##H##8##(######################x##h##X##H##8##(#####"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#"#"#"#"#"#"#"#"#"#"#"x#"h#"X#"H#"8#"(#""eoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversXvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-namemerit-dumpSboot-sizethost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadsemicolon expected.filename must be a stringno memory for string %s.expecting a network hardware typeexpecting semicolon.Expecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message received%mreceived unknown message, code %ddispatch_imsghaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainusage: %s [-dn%sq] p############x@#p#h#`#X#Psoftdepforcereloadupdatesyncasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sffsmount table fullfilesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsck%s on %s: %smainusage: mount_ffs [-o options] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'cannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read filecbc_decodeinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%lu newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid addressinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown commandno matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.huphandle_hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read%soverwrite %s? readlink: %sunlink: %ssymlink: %scopy_linkmkfifo: %smknod: %sutimes: %schown: %schflags: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory #X#P#H'.t0()8.gzdeflatezcatzipcompressunknown program nameGZIP GZIP is too long123456789ab:cdfghlLnNOo:qrS:tvVoption -a is ignored on this systemillegal bit count -- %s-o argument is too long--o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignoredstdin%s%s%s: %s%s not a regular file%s: unchanged%s already has %s suffix -- unchangedstdout%s: unknown suffix: ignored%s%s: name too long%s: input: %smaincompression not supported%s%s: won't read compressed data from terminal%s: unrecognized file formatrcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %soverwrite %s? .-_taztgzzgzZmethod crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) @YOK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out @Yusage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_header `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@#,#+#+#+#+#+#+#+#+x#+incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.2.3@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_readuser is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-fh] [-R [-H | -L | -P]] %s file ... [owner][:group]group$OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $lost+foundwrong type to dirscan %d dirscanDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEfileerrorUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTmkentryUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u linkupmakeentryNO SPACE LEFT IN %s (EXPANDED) EXPANDexpanddir$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS ckinodePARTIALLY TRUNCATED INODE I=%uiblockblk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%u BAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.27 2006/04/17 09:34:16 moritz Exp $dfpnNyYb:c:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... -%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** checkfilesys$OpenBSD: pass1.c,v 1.20 2006/03/22 20:24:32 deraadt Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlink convert symlink %d(%s) of size %llu bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.13 2006/03/22 20:24:32 deraadt Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.25 2006/03/22 20:24:32 deraadt Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d pass2check$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.15 2006/03/22 20:24:32 deraadt Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d $OpenBSD: pass5.c,v 1.24 2006/04/27 02:40:03 pedro Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5$OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: setup.c,v 1.24 2006/04/17 19:18:08 deraadt Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.30 2006/04/17 19:33:54 deraadt Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [Fyn?] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY CANNOT %s: BLK %dProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfo?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/asprintf%s %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'updateasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dP:T:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelNumber of cylinders restricts cylinders per group to %d. stat %smfs:%dstatfs %swaitpid%s: mount: %sabnormal termination/mainioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk label-z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-P src populate mfs filesystem-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s forkchdir%s%s: exitedcannot stat %s%s: not a dir or a block devicepax-rw-pe.rmdir %sunmount %smount %s %s/bin/paxcopy %s to %s failed%s: mount (update, rdonly)copy/mntTMPDIR/tmp/tmp mountpoint %s busytmp mountpoint %s too longtmp mount point too longmntXXXXXXXXXXmkdtemp %sgettmpmnt%s: initializing cg %ld/%d siginfocallocmmappreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dno block size to support this diskWith a block size of %d %s %ld minimum bytes per inode isMinimum bytes per inode is %ld With %d bytes per inode, minimum cylinders per group is %ld With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %ld cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)%s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedfilesystem must have at least %d sectorsWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary%s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %sfsinit failedmkfs>panic: cylinder group too bigcg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 cg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d COLUMNSdfiPRr%s: %s%sfts_read%s: is a directory%s (inode %u): not overwritten due to multiple links%s: mallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRr] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejecttf:TAPE/dev/rst0%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGET76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d) density: %d (%d) %s=%o%s=%xusage: %s [-t] device usage: %s [-f device] command [count] strdupLost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sO%s %d rmtopencloseC statusS I%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pinvalid file mode: %s%s/%s: %susage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %scompile_re123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthcompile_trcompile_textunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %sr%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $%s %s: %s%lu \%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx#h#`-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process IDs%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm# # # # # # L# #  # # # # # #x #h #` p#X  #P  #H Tbind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskc_umask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)#x#p-setfv%s%*ld.%02ld%s%s%*ldm%ld.%02lds%s real real user user sys system :ptime: -%s unknown optiontime: -%s requires an argumentm:invalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p#@ #8 #0 )L#( l# (# l# |# &# H# # H# # # #  # D# # )L# # 88# # #x '(mknod*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator#####)(!-a-o1%s: %s%s#Ht#8f# c#d#s#l#m#n#pprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %sCOLUMNSLINESx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`\ ph# dh# zh# z# z#x Z(#` \h#H Z#0 \# it# j0# d# d4# z# fP# p# d# Xd# X# m# x#x z#h z#X m#P m#@ m#0 op# a# j# \# i# b<# \# c# d# f# z`# d#p #` b#@ cT#  f# x# q# p# l# y# yX# n# z# {# #x |#h h#X #P x#Hcommentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not setunable to allocate memory%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s###REPLY-rreadPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]history functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrink%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX4###xargument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sj_printremove_job: job not found (%s)no closing quote yylexhere document `%s' unclosed \$PS1PS2\%c%a %b %d%d%T%l:%M:%S%r%RPWDHOME/~/%s%cdoppromptmissing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-iHOMEPATHSHELL-xKSH_VERSION-rtypesetksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shSH_VERSIONPWD.$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV###X##`USERroot?include: %dshell: %dUse `exit' to leave ksh @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF#ha#X#Pc#@#8#(# e###i#k#l#X#m#C#n#f###b#u##x#hp#Xr#P#Hs#8h#0v#(# ####xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacs-usemetaemacscsh-historybgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %sgetoptionso:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad numbergmatch*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argument%s'\''%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)shf_vfprintftoo many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name ###### # # #  # #####x#p#h{#`}#X#P#H#@#8#0#(# newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!()#####]]<>ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s4#8 #0#(# ### # # # #######LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript %ld out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzstr_val%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%seval5non-numeric argumentdivision by zero--%d %s _msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: %s [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] /var/run/utmplogoutRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelreadlabelfsr%s%s%s%c/dev/%s%s%s/etc/fbtabr /dev/%o%s: bad entry: %s(null):%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...login_protect0B%lld%c%lld.%1lld%c/var/log/wtmplogwtmp\\#TERMCAP/usr/share/misc/termcapTERMPATHHOME%s/%s.termcap /usr/share/misc/termcaptgetentOOPS?nYacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error G??C00=A@Alongjmp botch. no errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error : xxswufsswap ,rwrqrofstabscan/etc/fstabrfstab: : asprintfRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s rcmd_af0iruserok/etc/hosts.equivr%s/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owneriruserok_sa__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopudptcp%ugetnameinfoip6_parsenumeric/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh rcmdsh: execvp %s failed: %s #Ѩ#ј#x#`#@No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver errorrresvport_af__elf_fdnlist%u.%u.%u.%u%u.%u.%u.%uinet_ntop4%xinet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u%s: %s# #############Ӹ#Ӱ#Ө#Ӡ#Ә#Ӑ#ӈ#Ӏ#x#p#h#`#X#P#H#@#8#0#(USR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0#Ո#x#p#`#X#H#8#(######noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xregerror0%doffonsecurelocalrtsctssoftcarmdmbufwindow/etc/ttysr/dev//var/run/dev.db__ttyname_r_basic%s: /etc/protocolsr IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbyname/etc/networksr %u/etc/grouprgroup.byname%ugroup.bygid: grscan/dev/tty readpassphrasetcsetattrsh-c/bin/sh%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrether_ntohostethers.bynameether_hostton HOMEglob3.g_opendirg_lstatg_stat: master.passwd.bynamepasswd.byname__YP!+__has_yppwgetpwnam%umaster.passwd.byuidpasswd.byuidgetpwuid/etc/spwd.db/etc/pwd.db%s: %m*netgroup: %mnetgroup: db getnetgroupnetgroup.byusernetgroup.byhostnetgroup: Syntax error `%s'netgroup: Cycle in group `%s'%s.%s(%s,%s,%s) ,/etc/netgroup.db+%s: : %s %s: yp_first: clnt_call0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]authunix_create: out of memory authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problem########x#X#P#@#(##########p#X#H#0#######User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0########x#X#P#@#(##########p#X#H#0#######option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cinet_net_pton_ipv4n >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" //dev/nullipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dsscanfgethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpagethostbyaddr/etc/hostsr %u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname...RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx%s.dbtcgetentr:\|:cgetnext/bin/shsh-cexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvpxdr_array: out of memory %s: : %s   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~...realpathvfscanf:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy$1$%s%.*s$md5cryptMD5Pad__sbprintfInfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.vfprintf__find_argumentsexponent?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5InfInfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$ $ $ $ $ $ $ $ $ $ .SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%Y%.3s %.3s%3d %02.2d:%02.2d:%02.2d %-4s %.3s %.3s%3d %02.2d:%02.2d:%02.2d %s asctime3snprintfstack overflow in function %s__stack_smash_handlerclntudp_create: out of memory clntudp_call$ 8$ P$ 0$ H$ $ $ $ $ $ tcpudpfbfexplore_numericgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswer/etc/hostsr# _gethtenthosts.bynameipnodes.byname%s.%sres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASESr__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conffLOCALDOMAINrbf;#domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenv_res_initndots:debuginet6insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$$$$$ANYHESIODHSCHAOSIN$$$$$$$$$$$$p$h$`$X$@ $8$( $ $ $$ $$ $$$$$$x$p$h$`$H$@$($ $$$$$$$$$$$$$$$x$p$H$@$0$($$$$$ $$!$$x"$p$P$H$($ $$$$$d$$e$$xf$p$X#$P$8$$0"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%d/etc/servicesr ,/invalidtoo smalltoo largesyslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%ld]Error %d /dev/console vsyslog_r/dev/logconnectlog_r$$$$$$$$x$p$h$`$X$P$@$8$0$$($ $$$$$$$$$$$$$$$$$p$h$X$H$8$($ $$%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%e-%b-%Y-+%04d_fmt_conv-0GMTabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page../etc/localtime/usr/share/zoneinfo/tzloadmnposixrules,M4.1.0,M10.5.0TZ?vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD_yp_dobind%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... %s$$$$$$x$$`$$H$$8$$$#$#$#$#$#h$#H$#0$#$"$"$"RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s $%$%$%$%$%x$%X$%@$% Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKclnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory : perrorlibcUnknown error: Unknown signal: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC_catopen$18$1 $1$0$0$0$0$0$0x$0`$0H$0($0$/$/$/$/$/$/$/p$/`$/P$/8$/$/$.$.$.$.$.$.$.p$.`$.8$. $-$-$-$-$-x$-`$-@$-($-$,$,$,$,$,p$,P$,@$,($,$+$+$+$+x$+`$+8$+$*$*$*$*$*$*x$*`$*H$*8$* $*$)$)$)$)$)$)`$)H$)($)$($($($($($(p$(XWrong medium typeNo medium foundIllegal byte sequenceAttribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$4($4 $4$4$3$3$3$3$3$3$3$3p$3`$3P$3@$30$3$3$2$2$2$2$2$2$2x$2`$2H$20$2$2$1$1User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0xdr_bytes: out of memory xdr_string: out of memory isatty%$sniglet^& error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONSmmap(2) failed, check limitsmalloc_init(ES): hole in directoriesallocation failedmalloc() has never been calledjunk pointer, too low to make sensejunk pointer, too high to make sensemodified (page-) pointermodified (chunk-) pointerchunk is already freeirealloc: pointer to wrong pagepage is already freefree_pages: pointer to wrong pagefreelist is destroyed(%p)ifree: junk pointer, too low to make senseifree: junk pointer, too high to make senserecursive call in malloc():out of memory in free(): in realloc(): ((((( AAAAAABBBBBB arc4_stir/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binHASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpopen_temp!Up!X!W!W$ !W5!WR!WS$!Wql!WvH!W!W!W!W!W!W(d!Wx|!Wp!Wh!W`0!WX0!WH !W@|!W8|!W0|!W(F,!WP!WUP!Wnp!Vr !V!V!V!V]T!V]T!Vb!VgP!V!V!V!V!VV!VV!VxV!Vh`(!V` !VX "@!VH "@!V@ !V8 !V0 !V( !V (!V <!V <!V <!V y!U $!U !U !U$OpenBSD: args.c,v 1.16 2006/03/22 18:08:04 dhill Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.15 2006/03/22 18:08:04 dhill Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.17 2005/04/08 20:09:36 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.44 2006/05/11 15:06:51 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.42 2006/04/08 01:41:32 ray Exp $@!b!b!b!b!b!b!bp!b!bX!b!b@!b!b8!b!b0!b0!b !b!b!b!b!b!b!b !a!b!a!a@!a!b!a!a!a!a!b!b!dH!d8@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.6 2005/02/02 19:23:17 jolan Exp $$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $!lXY!lPY!lHZ,!l@Z,!l8\!l0ZL!l(Z!lZ!lZ!l[ !l[L!k]8!k[!k]8!k\!k]t!k]!k\0!k\!k\!k\!k]!k]8$OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.12 2006/06/04 01:35:05 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $!~ !~!~!~!~!}!}!}!}!}!}!}!}!}!}!~!~!~!~!~!~!~!~!~x!~p!~ !~h!~`!~X!~P!~H!~@!~8!}!}!~0!~(!!!!!!!!!!~!!!~!!~!!!~8!!!~!~/tmp/EdDk.aXXXXXXXXXXt@$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.104 2006/07/01 16:50:33 krw Exp $!h!`!X!P!H!@!8!0!(! !!!!!!!!!!!!!!!!h!!!!!!!!!!x!p!X!X!X!X!X!X!X!P!H!@!X!X!8!X!0!X!X!!X!X!(!  abcdfiklnoprstuvwxBDEGHLPTUXYZ0!pTBUY$HY0DB20t!hLFBFHxHHDB20t!`nL BLOHODB20t!XnLDL|LOOODB20t!P(,lxlܸ20߰!H(dXܸ20t48v.? ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.17 2005/04/05 01:18:53 jaredy Exp $"="=">("> ">">">w Pww ww pw w <w $OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.28 2006/04/13 03:14:18 dhill Exp $P.4S$OpenBSD: print.c,v 1.24 2005/06/15 17:47:17 millert Exp $$OpenBSD: util.c,v 1.12 2005/03/24 22:53:15 jmc Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.Ad"\"\"\"\"\"\"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)4X4X"oa4XyNp"x"xpb4X@yN("xP"x0B4XyN8"x"wc4XyN0"w"w"w`d4XAyN`"w@"w(e4XyN"w"v"vf4XyNP"v"vF4XyN"vh"v@g4XyNH"v "u"uh4XyN"u"upHAyN@"uX"u8i4XyN H"u"u"tj4XyN"t"tJ4X!yN "t"thlHTL4XyN<"tH"t0m4XyND"t "t"tn4X"yN,"s"s"sp4XHP4X"sq4XyN"sx"sH"s0r4X"yNd"s"r"rs4X!yN"r"rhS4X!yN\"rX"rHu4X"yNx"r"q"qV4Xxw4X"yNT"q"q"qHx4X( "q8"q(X4XAyNl"q"py4XyN4"p"pz4XyNh"p"ph"4Xp"pX~4X!yN$"p0"p?4X\#4XyNt"o"o.4XAyNL"o"oyHp (press RETURN)... (interrupt to abort)"z("z"z381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $""""""xA"hB"`C"XD"HE"8F"(G" U"V"a"b"c"e"f"h"i"L"l"n"q"xq"hr"Xs"Hv"8w"(x"u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.17 2006/06/29 12:51:26 jmc Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $""@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.14 2006/04/08 23:51:33 dhill Exp $"""""""""""" "x "p "h "` "P"H"8"0"(" """"""""""""" "!"""#"$"x%"h&"`'"X("P)"H*"8+"0," -"."/""x"X"0"""""p"P"0"""""` pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL"`""""""""x"p"hyѰ"h"`"4g"4g"4g"4g"4g"x4gH"p4gϬ"h4g"`4g"X4g"P4g 0"H4gP"@4g"84g"04g8"(4g" 4g"4g"4gx"4g"4gX"4g"4g`"4g"4g"4g"4gD"4gL"4gϬ"4g"4g"4g$"4g"4gx"4g"4gh"x4g"p4g"h4gh"`4g$"X4gH"P4g"H4gҼ"@4gҼ"84gD"04g"(4gP" 4g"4g"4g"4g "4g"4g"4g"4gX"4g"4g"4g"4g`"4g`"4g<"4g"4g"4g "4g"4g"x4g"p4g "h4g"X4g"P4g"H4g|"@4gl"84gЌ"04g "(4g`" 4g"4g"4g"4g"4g"4gP"4gDS"0"`"X"H"@"8"0 "("/sbin/dhclient-script( 0(EHC P E(  0(EHDHC ;Zx0N@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.28 2006/06/01 17:22:14 dhill Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $$OpenBSD: buf.c,v 1.17 2006/04/25 15:41:07 deraadt Exp $z`$OpenBSD: cbc.c,v 1.14 2006/04/25 15:41:07 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $#$OpenBSD: main.c,v 1.30 2006/04/25 15:41:07 deraadt Exp $#(#0H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.32 2006/04/25 15:41:07 deraadt Exp $4v#0$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $######.p ... ...#Dx#Dp#Dh#D`#DX#DP#DH#D@#D8#D0#D(#D #D#D#D#E(#E #E#E#D#D#D#D#D#D#Dx#D#D#D#D#D#D#D#D #D#D#D#Eh#Eh#Eh#Eh#Eh#Eh#Eh#E`#EX#EP#Eh#Eh#EH#Eh#E@#Eh#Eh#D#Eh#Eh#E8#E0#O#P#P#P#Q@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.39 2006/06/22 00:25:22 deraadt Exp $ $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.52 2006/03/09 13:35:02 pedro Exp $#Zp#Z`#ZX#ZP#ZH#Z8#Z0#Z(#Z #Z#Z#Z@#Z@@ @%s: can't read disk label; disk type must be specified#d #c#c#c#c#c#c#cp#c@#c#c#b#b#b#b#bh#bH#b#a#a#a#a#ax#a`#a@#a($OpenBSD: mkfs.c,v 1.50 2006/03/09 13:35:02 pedro Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.20 2006/03/21 20:28:52 otto Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.29 2006/06/14 02:14:25 krw Exp $#r#r#r#r#q#q #q #q#q#q#q#q#q#q#q#r#r#r@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.18 2006/03/24 04:17:26 ray Exp $#u{}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. #{8||#|#| P###p##h#`#X#P##H#@##H#0#(######x#`#H#8# #################x#p#h#`#X#P#H#@#| _@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.32 2005/06/30 15:13:24 millert Exp $#H@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $###########x#p#h#`#X#x#p#`#P#H#@#0#(# ##########p#X########################BKMGTPE@5MS7)  ; ExxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuu|R#x#X#H#(######ب#ؘ#x#h#H#8# ## ## #װ#ט #׈#x #h#@#0#####֨#֠#xxx:xx:xx:xx:xx:xx# ##########X##P#@##8####߰##ߨ#H##@##############x#p#h#`#X#P#H#@#8#(# # # # # # # # # # #########x#p#h#`#X#P#H#@#8#0#(# ### #!#"###$#%#&#'#(#h)#X*#H+#@,#8-#(-# .#.#/#/#0#1#2#3#4#5#6#7#8#9#:#;#<#x=#`>#P?#@@#([#\#\#]#^#^#_#_#`#{#p{#`|#P}#8}#0~#(## #H#%?#p#########x#p#h#`#X#P#H#h#`#P#@#8#0# ############`#H#######################x#p#  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$Ȁ0123456789abcdef 0000000000000000}$ $ }48(|~p4@8(|~ 48(|~ 44ŰlŌhŸ$H 4`4` t@8lP|l|<0DW$$7`.shstrtab.init.text.fini.rodata.data.eh_frame.pltpad0.pltpad1.gotpad0.ctors.dtors.gotpad1.bss.note.openbsd.ident LL``SUXUX!UpUp%4@@XX+4XX5D\p>D\pGd\pPd\\ Wdhh^dppgtpp zl44pa  on}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 {_ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  g 1 gnobody*Unprivileged user/nonexistent/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=40 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b ttyG7gttyG8gttyG9gttyGagttyGbgttyFcfgttyF0gttyF1g ttyF2g!ttyF3g"ttyF4g#ttyF5g$ttyF6g%ttyF7g&ttyF8,'ttyF9,(ttyFa,)ttyFb,*ttyEcfg+ttyE0g,ttyE1g-ttyE2g.ttyE3g/ttyE4g0ttyE5g1ttyE6g2ttyE7g3ttyE8g4ttyE9g5ttyEag6ttyEbg7ttyDcfg8ttyD0g9ttyD1g:ttyD2g;ttyD3g<ttyD4g=ttyD5g>ttyD6g?ttyD7g@ttyD8gAttyD9gBttyDagCttyDbgDttyCcfgEttyC0gFttyC1gGttyC2gHttyC3gIttyC4gJttyC5gKttyC6gLttyC7gMttyC8gNttyC9gOttyCagPttyCbgQsound0Rmixer0Saudio0T audioctl0VrandomlWsrandom[ lkmXurandomYprandomZarandom\tty00m]cua00m^tty01m_cua01m`tty02macua02mbtty03mccua03md apmeapmctlf pfcgsystracehxd0aaceirxd0acejxd0bcekrxd0bcelxd0ccemrxd0ccenxd0dceorxd0dcepxd0eceqrxd0ecerxd0fcesrxd0fcetxd0gceurxd0gcevxd0hcewrxd0hcexxd0iceyrxd0icezxd0jce{rxd0jce|xd0kce}rxd0kce~xd0lcerxd0lcexd0mcerxd0mcexd0ncerxd0ncexd0ocerxd0ocexd0pcerxd0pcexd1acerxd1acexd1bcerxd1bcexd1ccerxd1ccexd1dcerxd1dcexd1ecerxd1ecexd1fcerxd1fcexd1gcerxd1gcexd1hcerxd1hcexd1icerxd1icexd1jrxd1jxd1krxd1kxd1lrxd1lxd1mrxd1mxd1nrxd1nxd1orxd1oxd1prxd1pxd2arxd2axd2brxd2bxd2crxd2cxd2drxd2dxd2erxd2exd2frxd2fxd2grxd2gxd2hrxd2hxd2irxd2ixd2jrxd2jxd2krxd2kxd2lrxd2lxd2mrxd2mxd2nrxd2nxd2orxd2oxd2prxd2pxd3arxd3axd3brxd3bxd3crxd3cxd3drxd3dxd3erxd3exd3frxd3fxd3grxd3gxd3hrxd3hxd3ittyG7gttyG8gttyG9gttyGagttyGbgttyFcfgttyF0gttyF1g ttyF2g!ttyF3g"ttyF4g#ttyF5g$ttyF6g%ttyF7g&ttyF8,'ttyF9,(ttyFa,)ttyFb,*ttyEcfg+ttyE0g,ttyE1g-ttyE2g.ttyE3g/ttyE4g0ttyE5g1ttyE6g2ttyE7g3ttyE8g4ttyE9g5ttyEag6ttyEbg7ttyDcfg8ttyD0g9ttyD1g:ttyD2g;ttyD3g<ttyD4g=ttyD5g>ttyD6g?ttyD7g@ttyD8gAttyD9gBttyDagCttyDbgDttyCcfgEttyC0gFttyC1gGttyC2gHttyC3gIttyC4gJttyC5gKttyC6gLttyC7gMttyC8gNttyC9gOttyCagPttyCbgQsound0Rmixer0Saudio0T audioctl0VrandomlWsrandom[ lkmXurandomYprandomZarandom\tty00m]cua00m^tty01m_cua01m`tty02macua02mbtty03mccua03md apmeapmctlf pfcgsystracehxd0aaceirxd0acejxd0bcekrxd0bcelxd0ccemrxd0ccenxd0dceorxd0dcepxd0eceqrxd0ecerxd0fcesrxd0fcetxd0gceurxd0gcevxd0hcewrxd0hcexxd0iceyrxd0icezxd0jce{rxd0jce|xd0kce}rxd0kce~xd0lcerxd0lcexd0mcerxd0mcexd0ncerxd0ncexd0ocerxd0ocexd0pcerxd0pcexd1acerxd1acexd1bcerxd1bcexd1ccerxd1ccexd1dcerxd1dcexd1ecerxd1ecexd1fcerxd1fcexd1gcerxd1gcexd1hcerxd1hcexd1icerxd1icexd1jrxd1jxd1krxd1kxd1lrxd1lxd1mrxd1mxd1nrxd1nxd1orxd1oxd1prxd1pxd2arxd2axd2brxd2bxd2crxd2cxd2drxd2dxd2erxd2exd2frxd2fxd2grxd2gxd2hrxd2hxd2irxd2ixd2jrxd2jxd2krxd2kxd2lrxd2lxd2mrxd2mxd2nrxd2nxd2orxd2oxd2prxd2pxd3arxd3axd3brxd3bxd3crxd3cxd3drxd3dxd3erxd3exd3frxd3fxd3grxd3gxd3hrxd3hxd3irxd3ixd3jrxd3jxd3krxd3kxd3lrxd3lxd3mrxd3mxd3nrxd3nxd3orxd3oxd3prxd3praid0arraid0araid0brraid0braid0crraid0craid0drraid0draid0erraid0eraid0frraid0fraid0grraid0graid0hrraid0hraid0irraid0iraid0jrraid0jraid0krraid0kraid0lrraid0lraid0mrraid0mraid0nrraid0nraid0orraid0oraid0prraid0praid1a rraid1a raid1b rraid1b raid1c rraid1craid1drraid1draid1erraid1eraid1frraid1fraid1grraid1graid1hrraid1hraid1irraid1iraid1jrraid1jraid1krraid1kraid1lrraid1l raid1m!rraid1m"raid1n#rraid1n$raid1o%rraid1o&raid1p'rraid1p(raid2a)rraid2a*raid2b4+rraid2b,raid2c-rraid2c.raid2d/rraid2d0raid2e1rraid2e2raid2f3rraid2f4raid2g5rraid2g6raid2h7rraid2h8raid2i9rraid2i:raid2j;rraid2j<raid2k=rraid2k>raid2l,?rraid2l@raid2mArraid2mBraid2nCrraid2nDraid2oErraid2oFraid2pGrraid2pHraid3aIrraid3aJraid3bKrraid3bLraid3cMrraid3cNraid3dOrraid3dPraid3eQrraid3eRraid3fSrraid3fTraid3gUrraid3gVraid3hWrraid3hXraid3iYrraid3iZraid3j[rraid3j\raid3k]rraid3k^raid3l_rraid3l`raid3marraid3mbraid3ncrraid3ndraid3oerraid3ofraid3pgrraid3phconsolei ttyj memkkmemlelnulllemzerolenstdineostdoutpstderrqksymsrdrumsklogteepromuopenpromv st0wrst0romxnst0romynrst0omzest0om{erst0om|enst0om}enrst0m~ st1rst10mnst10mnrst1mest1merst1menst1menrst1m scan0 scan1 audio mixer$ sound audioctl44`4p44444 4 l 4 4444 4444|'4-45 4E4tQ4^ 4d4i4xo4w4~ 4 44 44,4 44l444 4H4@444 4H448)45 4B4 J4 O4U4[4g4q4{ 44d4 gcc2_compiled.filestore.30bootstore.31prom0_fakesaveechopv_putcharpromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.68toppaniced.24pos.36LstdLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9putchar__maindvma_allocprom0_icloseprom_ioctlprognameallocprintfprom_sinetif_debug_udivpgshiftmemcpynbpgdevopen.udivtwiddlendevskprintnprom_bootdevicedvma_mapoutobp_strategydebug_rttbzeropgofsetcputyppromvecloadbootblock_countioprom0_strategyvprintfdvma_initdonottwiddlecloseallprom_initpanic_uremmemsetmainblock_tableprom_open.uremblock_sizedvma_mapinprom0_closeprom_boothowkdoprntexitstartdevswprom0_iopenobp_closedvma_freeprom_bootfilefreelistfree 8`@#`0 " $@``T@-!X0`@b"@H*/+,/"aT  0  "","" *,""!`,""@㿐@l- (@4!8/!\`(L@ 3((!P3(1/%//(+/).-('/5(7,9/ ;/!@ap@X $XX aP@ X#@ ͐M# 2%aP@h @ ĐL 2@ ܐ@@ː⨀`!Tadb1   @',? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?(@!1?㿘 #@(1(@!1㿘@G " ܒ㿘 @d㿘-!X` @e, "c/ !@ !X $!X㿘-aX ? "aX,@cc㿐%,@8?4/#8'@A(@^!@  2'/(/c@@T!(1/#-a#4@ 2`P 2/#4@$'(`P@@!#4'@A`P / /! 2 / 㿘/` 2/-"!\"`"`"`"` "`"`" @`  "a? /  ?/ 㿘  ; < 㿘 , @@@<   @1"&  ?  㿘,"`/@|/aT  $  /- ap"P/"!\JJ`  -2*@/!\@ (*`J@ @ *`  -a/"!PJ  *@J` )*@aT /`"!\``*J@ -& @/. *:  c` d a !XJ@ s !XJ@  !X$!X#c @ #!XJ@  @㿘@ ,"`  @W`x$` $`%//!T `( $ /aP€  #̒`$` $`$@ (P@&" 02P@ǐ $`&` 2!//,b @ p} (P@ "80 p,b @֐,bԐ @є , "c ",`# $$ 㿘#/aT`   ``*  `aT   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @+ /!T `( ( @0@ 㿘   2  @ $ ?-`$ *㿘/!T` `0`4 㿘/!T` `?`8 ? 㿘  ,`(@P"X?@ `?㿘 ,m`€s㿐/T ` !T    !TO!,"#?  `$ *T`P"`/`$*O O /O㿘㿐/!T `      O ? X/O O /O㿐/!T/  0T@㿘  㿘/!T`t€㿘@,@g@㿐/aT    !TX!T p@X,"` - !!` -   Ћ@+@ `` * * * * * *3/aT` `€ 0 (x @@aT|@㿘/!T` !,`@(@Nbذ(@b耢 (' b@ ( @b   #D`#DN@J@2J`N` " 2 㿘/!T` €( 0#@ 㿘!-!ߖ ??" !.㿘)-" ?N  @  /"!!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` (@͐#(+  " * @7 $`0 "$`4 " @P$` @ 2"&  %" (@#H 㿘#-b  @ 4 "$b & 4$b㿘,"*`@ ,(#h@# -,#        (#@k` `,"@ ,"8 <?*   آ&@  ` ,"@㿘?(-,1/\&!T H L` T ` X P d l$ p  t @- .@㿘/ ah@k 4 4 /@ a(@#G (#!h@  !h!h@ 8?@?# @!a%!h?@?# @!a!h?@?# @! a !h?@?# @ (0 `(!h@ @ѐ#Ȁ @㿐`(@Ő#@?@ %?# @! `  a `  `  @`@`쀢 )@?  ?# ! ? ?# !!(` !(@!(,@`@2,@`@#`@ƒ`Z)` #@r@ ` "`,@?`` A(`,@`#,``,``,``@Z``@`@5)@ @  -),@ ,` ,` ,`  ?`@)@) @/``? ? /"ad) @#@M& @  ` @  ! ??#2   @C :d뀤 '@`,    6`,`  ̘D  "`,= x*@`,*` /a@ ( )@ (0'@ E   2 `, "`,`@"'@`, @ 2`,)@ 8? P# 2H  C) X) `) h @    d d @ "@  @@ @X @ E   :    )"@ @Z    @@ "  @&" `,   @` %   / d"!`  "  4/a@  )@. 0`0, * @o@/a@  )@ 0/a!)  p/a!) /a!) @ k @0k`0@ `7E    @ " `("L@ 5 1) ? ))  ) h @א    d   @ @` ?$ @ @E  `0Ѡ (/)@!/a` 4 4&` &`6`*@t6`,@? /"ad)'@@! 㿐` @,0@Qฐ`@@༠@ * @ @ߒ@x` * d, `0 200@"x @Ő* @ @) ?  "? 6"?% 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@&,`& 㿐   <P @7 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @I0$  " @i  d  *  0 @i$ $  $@&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @’  " *@B<@@` ڐ2 ``@Ӑ 㻀@͐ Ц @ &`@@$`   `  @2 %\F!T@  0@@eg0   @& t,   $@  'a L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@, W(  2LL@@7 $H  E;@v%( 8@n"@4 0 K䰒 *@Q`  d*  0` @MO / ' 'ݒ L@  @   0@- @'@$ Ё㿘 &     . @ "  @0  .  "  @0 @@ а 㿐 @ @&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  "`"`"`:`8㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  p[ j/#81a"'А $  $ $ ''X@Ғ 2V?-`(??"`(4` $@!#`"#@ #\ @  !/)@Y!;?#/!a@!*`4a' @2 `)@@!@"?/'ܠ /c@,",@~܀ ?0"X/bX@t܀  ?0`@@܀ ? ?  M/#,/c@?@G 2B?@@> 29?-`(/?"`(6 "&#`a#@b#\ @    / H"a''@( ?@I ?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ z.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( )!h@     2` * @h *`  * +` **` +   h  (@ g@ g@ `-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐^  [ @4 U  @P2 *@    @ v,`  ( 6h" 1  '"@@''   b 4  @   " 'w@ P@B< 22&     ":?"   ? @ : ` :?  $"`"`"` :`8   㿘  ,  ". /.".+."&  "!"..S 0N L ?I 0F @͠L@ *L0: 07 0pؒ  @ ǐ@ s 8 'p@ t    $ #`a#\b` @  ? / H "a؀`/@   "!?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ *$` 8 @ ot$`     h #`ab`$#\ @ ? /! x 0  &,& &&& D& &(&$@ =㺈 ` ($ a b????#\#`  @ ? /! `  dh@ d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H/"!?@T@ה0 )!p@ / H"a?㿘@Ȑ -/ "a (/" (6 & 2?/a"a0 "!"0" ?㷈/!!` )@ ɐ! N  m `/2N N /" N a  0 ] @J x  <$N O  N  /  .ؔ A.0 0ᨢ" 2;@ @  $+  (@E;@AO`/ ᨀ@1 x@- x  @& x N  &`  @ x@ x㿘  "& @ x&  㿘' #/!.%)@    ? a2  # @   ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0( 4 "`8"` <"`@"`D :`8 㿐\@?<6   '?'?@ ?/⠐ '?` '?`@"⠢"?'?Đ #`#` #`#`#\ #`cH$ #@? /` @``2)"@!/ H"a?㿘!/$!@K /"@ 2?`2 ?`)` $!!@j ??"@?2// ( 2  2 2 *?/" #""/( "#"" " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !/!@f?)@" H$!8G8G8H@8H@8H(8G8H@8H8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H48H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H@8H8H@8H@8H@8H@8H@8H@8H@8H@8H8H@8H@8H@8H@8H@8H@8H@8G8G8G8G8G8Gԝ㿘`[1!*` €1)0"(1)-"@1)*"X1)'"p1)$"1)!"1)"1)"1)"1)"1)#1)#81) #P1) #h1-)#@ @#--@D@**@@"@㿘#--!-"cH$cD dP'P'T'X@W$#@cD#@ *`2*@& )@*#J?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `bd4 `4 #\" .@U )@#? /2c8 c82  c8 @ 0- ? @ -??"`8 $`㿘- H@k 5㿐@/!"!  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` - Ѐ    0`' @'ܐ@,ܖ@ژ( @?)#@:x@ް yހ( (  s?@n?2l?2` 2g? 2c?2``<`]@l 2Y? &U?``  2M?` &@ǐ  4 & ` 2>?` "6`` %)@#0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   )/ <+*`%!(?@ @`@,`4 2 !   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘-#a,@  .  @{ 0,@@ "@p  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` W+` ??㿘V  @,   -`H@%  "` ?` ?7--0h :  0 *@ `  *@`*@`-*#h" @ ` ?  2  㿘-c'H'L'P'T 'X @"c@H*@ @2㿘* H㿘0 ` , @` @ , 㿘@@n㿘@ 㿘 D " ? 2  H1/ L&!@e  $ ! `$ D?$ @ L$ ?$  @`$㿘אԐ* А* ̐?. ?$`@㿘- ؠ  , @     & &"   & T`?& & S`?   2?  ?B& @     `* ??w?2? o  e  "  D Z   D  ?& @㿘@h?7`5@ X-#. `%"   >`P>@>`>`>`>` >`(>`0>`8>`@>`H*P?@, @ `@ &`L&@Z&`H0 @ ܐ`@ X@ɐ?㿘 / "a?0 `. @ -. # @  L@@ X@㿘-#.   @?? ?2%  ?% @%   T "<   8 @a    "@"% %% %  "  @* 4 /!`% D " %   &   B @ B = = % DW  D  L!/$!@ % ! % D L%@* '% @  P@(" % P  P ?% @ @   @+  = =   @  % P @ 2   D 2   2x T  P@"  % P&㾘 / 0 `- @-@8#-  `T @?2*$`(&$`" ` /o l/k @ F`2.``)  @ ?V @ `L  <`P<@<`<`<`<` <`(<`0<`8<`@<`H*P?@ @$@$`L$`H`4 `5`@1`@ f )`' a !ɒ: @/  ]d 4 `0 ]"a??- ? * `:```? -` "`"    -?"  @ @   @ *0   @ *`㿘0.  ` @  @  / $"a2  " @      @ $/"!`/ "!?㿘0.  `@ @  / "  /  ] :@B: ]"a? ?   ` 㿐0 ` @  `  ` / D"a$@$`$` '= 8/@`` / "`J ,`)$@&$` # @  / p € ` `#  `" ` @/"!$@?㿐0.  ` @@  / ,"a" @ * 2`      / "a B< ' / "a&?8f8gT8g8hX8hX8hX8hX8hX8hX8hX8f8hX8hX8g8h 8hX8hX8gd8hX8g8hX8hX8h4㿘'H'L'P'T'X"Ē@ H㿘"Ē@8N@`N@`%` N@`|`!x*` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈* X@ @,@Ԑ  ?L?㿘- 耢` -#* `pJ@ l##j  (-!L@ - 쀢@  'h@@B`@ ` L  *$L xƒ  .א 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hb4 j4 h"$@#\ ./? hl'l*Ґ  ` `4` L4`  $L4`㿘-HQ(㿐g/-"!(2*?@ 2&?`(2"?`&2?`  @??-!L-*@ *`@ `u  ??㿘@ /`(+`&'` # `Y   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  : : *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  8~ 8888888888X88888t8888488,88l888x888 ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8 * " <" 8 㿘 N 12:?@ 5?2 (1? $ "$ ($ 0 , 2 ("$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 *,ฒ`  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4>  ( 2   $ * $ ($ 0$ ,  (&@@    4"@  ($ 0%$ , 0" @8 4   "@@   4"@ ($ 0$ , 0 ( $ 0$ 0 , (@@$ , 㿈 ɺ $ Ŧ  "? 2  2? 2  $   8< `!d*` € ` $"&  @?*``` * 4 D  y,  u,4 $  m * $  @! $& 8  $ ¢ "k&  @?*``` ?c4 4 *` , $& 8   $   & & & &$<$8  @ $& 8 $`";&   `$@4 $"0&  @?*``` $4      ,4 $  $ $!`&  $4[ `$@` 4 "&  @?*```?c4  ,$@   $@ Ā88 ܒ@%"@$@@%'@"&  @?*```  a$`4  $d4  $\4a򀢠 $$hh\@,!8 p"&  @?*``` h *@*`3 $h4\ hp0lT,!8(*`0  $h $T$L$l @   ,c!`,!`&  $ $$h`dh :pT * ?L * @@7`񀢀7  "N&  @?*``T*?L * @@7`񀢀7  @   ".&  @?*`@ ` $@4h*`3`i$h !  @   "&  @?*`@ ` $@4h` *   45 @   "&  @?*`@ ` $@4  4h @   "&  @?*`@ ` $@4  4h`d Q?? ph?*`2`?$h`dh *QT "0 $L$T$ll` pT@ ,` l*``p$P$Xd  @X y, $T * ?L * @@7`񀢀7  "t&  @?*``T*?L * @@7`񀢀7 - + 7*@* 7 2` "H&  @?*`` 2 L* @@7`7$@4$@4$@   z$ @ u$2,  $H$H @   "&  @?*`@ ` * @? @$@4 $@  $X * ?P * @@7`񀢀7  "&  @?*``X*?P * @@7`񀢀7 ` , 7*@* 7 2` "&  @?*`` 2 P* @@7`7$@4$@`@4 $D `$H$H @   "&  @?*`@ ` * D? @$D4 $@ ,D"@i $u&D"0 4($ ""@@ @&@8"$@% @?.@``@ 2 $H  C.@$` 6`8  ":&  @?*``` &@B > $@Β&@$& 8?c4 4 *` , ,!`&  b$   $ ?M?& & && $8$<(   8   ђ  $3?  '  B& @B > >   $ @z"@$& 8 <@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?  ` .?`   @. @+  ?[   $? ( @ 4"@  ( $ , 4 "$ , $   " ? $ " ? "?" "`0  @  @0#   ( @#@㿐 P?`$ 2`0J 2 < D?   h <  8 " * % <%% 8  ;*  8  <2`?% 8 % <  % h@```@ @B  " %`%@=` h?` `3  =`=`  % "? $ 2 ?   <`?㿘 `"h?`$ "d?`("`?`, 2`0Z? 0  2 4Q?   $ * `( `0 2 @`0`,€?0=@' >`> `> `0> ` > `(> (`0> 0`8> 8 L%0@ ,@zА" ?%0@$`L PzВ"@ e0@ $`P l:А" ?%0@$`l $ * 4~$`4& $ 㿘?4`c @@c@@ ? @ ? ` " ?@@`?c@? @ܒc* @! F?"P  ![@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ ϲ`##񀦀ðL(7@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ β`" !?@@`!?J#F#. @@'X'D'H'P'T /```0 TH) @ ( 6T  ?, "?8 2P @ // 70 0P&@00P T:     + "  *   /`.  b``(/`  D X 2?7   ``0@`  DH) @ (@(0@X6 0  HD ,X ',,ֲ!}',?T' P( D'      ?e ° ? 'X) '@ /67/. @/7 `/7, , /`7 @(3`0,626  ( 5@FX*`H(@ X" '@ @ + ,(& *.``@ . & 4`D, @eE P- (P(P#8z0 @//+` '7  P  /7 (3.0626 ߀P  T&@-T%, T     "@(  - ( 00? # - P0-P㿘-!P`1-#㿘`-_ !P`G8-#@6  * `@@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6  ` -#@6  * `@ 8`  `2`` 㿘  $ 㾘;;n # '  x*`"``*ߒܐ`ɐ.6 > ʐ`.6 > ޒ㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ZV>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x dvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@ 8% 8(8)8)8)8*D81x86d868888$888>8@8A8A8A8BD88 88 888 88 (88888888   8@` 0123456789abcdef/888X8X88X8X88X88\8)8p68C8N8W8xb8q8Dv88888888@8@8088x888 8"\8$8+t8+8/'8//80`888889889F8:S8<4`8<8Bm8Ey8C8Gl88Hd8Hd8@8D8H8I 8Jd8J8KH8P8R8SX8T,808h8U8U8U88V<8V88V8WT8W88`H88a8a8bl8c08d8e88i,8i\8j$8j,8oD88mH8m@U8mTd8o0x8m8mp8m8n|8n(8n8m8n8nX8nL8np8n8n8n8n8o 8o8o$8oX8o,8rp88pH8plU8pd8r\x8p8p8p8q8qT8q08q$8qH8q8qx8q8r8q8q8q8r88r,8rP 8s(,8u88t@H8sU8sd8ux8t08t8t\8u8t8t8t8t8t8t8u8u|8uX8uL8up8u8u8u8v0,8yP88wH8wLU8w`d8y<x8w8w|8w8x8x48x8x8x(8xd8xX8x|8x8x8x8x8y8y 8y0 8{,8|98hD8<D8xD8K8P[8Td8s8}88<D8hD8888(8\8v8 888@8888`H 868e 8(& 8. 8,:8D@G8(P8GlY 8 g8Hp8DT8@888U(8B8I 8 88881x 88a8Qd888}\ 8884)8p/8+98@C8blJ8R 80Y8a`8e8|m88$y8p 848T,88 88h8l88<8RX 888-l8h 8@ 8P888P&8 3 898G8dM8]S8X8L`8uf8(p8x8<8 88(8 8T 8`8.8{8>8$8 8A8A#8 28B;8<C8K8VR8P \8fd8O m8Xw88$8V<8=8 8c0 88oX8t8BD8z\888[ 8@8888 8+t#8-87 8?8)H8Q 8`W8U] 8l8KHt8y8U8st8/H8 8p8)8i,88k8% 8 08QP8A 8H 8M 86d 8 8o %8V -8 88. J8h U8l c 8X q8 {8st 8v 8 8/ 8  8 8 8 8 8X 8*p 88 8SX 8\ 8 x 8f( 8V, 8l # 8d (8) 28 @8 F8 V8H [8i\ e8*D n8h w8 8, 8o 8Y 8T 8rx 8h 8 8 8 8 ( 8z 8T 8Z 8\ 8H  8 8x ,8 58D G8a Lgcc2_compiled.open_countnetif_promfilestore.30bootstore.31prom0_fakesaveechopv_putcharsun4_idprom.86dtabstringbuf.96promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.109elf_execaout_execelf_seekread_inodeblock_mapbuf_read_filesearch_directorypnmatchdirmatchnfs_getrootfhnfs_lookupfhnfs_readlinknfs_readdatarpc_getportrecvrpcebuf.24sputcharsbufsbuf_endsbuf_lenrarpsendrarprecvbuf.39numberdigitsetherbuf.30paniced.24gz_magicget_bytegetLongcheck_headersstoppos.36arpsendarprecvLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9Lmul_shortwayLstdfixedtablesupdatewindowsyncsearchLetextcrc_table_emptyfirst.24make_crc_tablecrc_tablegf2_matrix_timesgf2_matrix_squareputchardvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopyloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrnoocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.remrpc_pmap_numxdr_inaddr_decodeobp_recvdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumgetpropprom0_xmitkdoprntexit_divesymufs_writegetpropstringstartfile_system_nfsbceaarpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulhdrinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree04 `@# ` "" $@` `T@  p b@"@H*/+  "b   0  "# "# * "#!` "#@㿐@#  a"a @ "  "8@c@  @   " @@㿐 c@T    "P@c# @ D ?#c' / - + ,`2 h@k㨒   # #@^㨒@a#@`b@S@?@2 @a aa @F`#@Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @"1?㿘 #@(1 @"1㿘@ʐ " ܒ㿘 @  㿘 #` @ "  `  "  ` ""J  *@J` )*@㿘@  #` @ "  `  €b  $€b 2$   " @ɐ"0   $  $`$` 㿘# b `   ``*  `b    '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "   @@ 0(@  㿘  @ $ ? `$ *㿐 " /  0T@㿘  㿘 " `t€㿘) ! ?N  @  "!Т!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ "+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @# 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #0@ \   #         #H@y` ` #@  #8 <?*  ` آ&@  `  #`@㿘?( ,1 \&" H L` T ` X P d l$ p  t @  .@ dd ? * `:```?  `h "`h"     d?"  d㿘 a'H'L'P'T 'X "a@/H @#h㿘 #p4 (4 4444444444 444p4444 44444̝㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #x@ @,@  ?L?㿘  l`  !  cJ@ #! @ @   @ *0   @ *` ( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx44,44444444   444p4p44444p 4-4 D84A4L4Z4 He4r4\4`44 4h4 44 l444@4p44444444*4034:4A4xH4lO4V4]4d4k4Pr4,y4 4D44t44044,4@44|4\*434h:4A4H4O4V4D]48d4\k4r4y4444ELF@4,bd4 ( @@,a 0 0P xHP rHP nHP jH`HzHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H  H  H H H H H H H H HP @HP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H0P  HP  rHP  nHP  jH`HzHP  ^HP  RHP  HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H H H   H  H   H H H  H  H  H  H  H  HP qHP  HP ! HP " HP # HP $ HP % HP & HP ' ޡHP ( ڡHP ) ֡HP * ҡHP + ΡHP , ʡHP - ơHP . ¡HP / HP 0 HP 1 HP 2 HP 3 HP 4 HP 5 HP 6 HP 7 HP 8 HP 9 HP : HP ; HP < HP = HP > HP ? ~HP @ zHP A vHP B rHP C nHP D jHP E fHP F bHP G ^HP H ZHP I VHP J RHP K NHP L JHP M FHP N BHP O >HP P :HP Q 6HP R 2HP S .HP T *HP U &HP V "HP W HP X HP Y HP Z HP [ HP \ HP ] HP ^ HP _ HP ` HP a HP b HP c HP d HP e HP f HP g ޡHP h ڡHP i ֡HP j ҡHP k ΡHP l ʡHP m ơHP n ¡HP o HP p HP q HP r HP s HP t HP u HP v HP w HP x HP y HP z HP { HP | HP } HP ~ HP  ~H ġHP  vHP  rHP  nHP  jHP  fHP  bHP  ^H H HP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~HP  zHP  vHP  rHP  nHP  jHP  fHP  bHP  ^HP  ZHP  VHP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 0P  HP  rHP  nHP  jH `H zHP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H  H  H  H  H  H  H  H  H  H  H  H  H  H  ޡHP  HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H > h;8;;;;; ;(;0H )@`  > h!  > h;8!5 > 0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; > h 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> h %)> ڨ %"+/> -> h+cP> #`"##t@> 2";x ;"`;" @@ǗҊ@@2 @ 0P -@ @ @"P/> P-> h %)> ڨ %"+/> -> h+cP> #`"##t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @?t x ``-`ׁ @3 tx ΁ )>!4@! P-> h %)> ڨ %"+/> -> h+cP> #`"##t@;x;;>!<!@ ;`#h#l;;;;@m``htx ;`#h#l;;;;@J``htxm )>)"@)>)" P -@ @ @"P/> P-> h %)> ڨ %"+/> -> h+cP ;`@;h#t;x;;;;;`@;`htx' /> ʀ-> h+cPۜP -@ @ @"P/> P-> h %)> ڨ %"+/> -> h+cP ;`@;h#t;x;;;`;;@;`htx -?P -@-P -@ @ @"/> /> /> ʀ6PP-> h %)> ڨ %"/> /> /> ʜP;x> #$`"#$@;,/,;@ ;`,;h)> "8#pH  p@  "`@`E <0x  +?P`-@-?P- %0P -@ @ @"/> /> /> ʀ6PP-> h %)> ڨ %"/> /> /> ʜP;x> #$`"#$@;,/,;@ ;`,;h)> "8#pH  p@  "`@  0@@_`x) `E <P -@ @ @"/> /> /> ʀ6PP-> h %)> ڨ %"/> /> /> ʜP> #$`"#$?P * * ;`@;h09P -@ @ @"/> /> /> ʀ6PP-> h %)> ڨ %"/> /> /> ʜP> #$`"#$?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@`h ?P `*  P -@ @ @"/> /> /> ʀ6PP-> h %)> ڨ %"/> /> /> ʜP> #$`"#$?p " ?P "  ;`@;h@ `h ?p " m @/>  @̀-> h $)> ڨ %-> h+cP-> ڬ VP @ H ,@`#> `h$` (08 @̀;)>  0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> h%- +cP ;`@;h #t;x;`;;;;@;`htx -> h& 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%> h $!>  h`8 (0 @̀@ @̀  H ,@`#> `h$` (08@̀x2>?@ @̀;'> 0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> `h $`!>  h`8 (0@̀ -> ڬ  @wP-> h"/> 4ΐ  ! H,@` !X (08@HP @̀> ږܒ `?* `"" * `@"> ږ  * `@&* *  ֊@* "``'1@'0@ )>+>%@#' $ (   ڒ` ڔx  ڔx  c  mt@ >   >  @@   >  @@ #>%>;  a @%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c@> " l *> " !`> " H(  /  > |==> ٜH > " > (! > ;b @ i"@!> $"tH``> "b` !>%#!>'"$ $ >& 2> " > " > "!> "!<>#"">#"">#"#D>#"#l>$"" >$""H>$"">$"">)"">)""0>+" ԁ@<@d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    "%> > > "  "> >@ >   h>&c#  h>&c# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * > ځ >@ *> ځ h>' p@5" > h" > h"   > h4``6 > ʊ`h > ڎ  !h!`> Ҝ @> "p`""p> #(`"#( >  > > !l`h2$j0>'@^f!h>'@^c!r>'@^`!switch rqswitch wchanswitch SRUN> > h: H> l" (o!l`jh>*L"2J "2 J    "2 J  J " > b+  @ #@"   *@ * hH1  (1> "#P `!l"I"j > #`"#j ` *@  ( !h> !d` (08 2㿠@م> `l` Ъ@@>`€"Т@: H" H*/  dh> h>(`" `2 `2`2" " ?" ?@>(`" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*> `h>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >*L "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a> a """"""""""""""""@2?# * 2  ac  @ a> ?(( @ 3 > !0 c@  Њb@&""""  > `Ԕ@ @> b` ``44: " longjmp botch@" `&"`㿠>+@Z;!6 0㿘``@`€Ð  ``€  `€ <`㿘``€  *`,`€ ``€  `€ >怎㿘 ͖  Ȗ Ö   ``€e ```€ ] ``€W @€` ```€ J ``€D    .@€` 2```€ 1 ``€+ 耤 ``€"   㿘M e  ` [ V  Q L ``€ 0DXl ,8DPPDp|t4D|<h4t4444..`.....5d5d.//$/0/L5d1X2P223 3d1X5d5d5d5d5d5d5d5d5d1105d5d5d5d5d5d5d5d5d5d5d5d5d5d3111004$5d5d5d5d5d5d5d5d5d1(6666666666666666|666666666666666@7877::;l< <<>(>PC$C$>??$?L?h???@AC$C$C$C$C$C$AABBx!> ! a@.!̀B !h!  €* 2 aS 2!h!h`€ * 2 ` 2!h!h`€ * 2  "!!h `@  7@$h @2 !6!v6!x6!z!@ &!!h`  !~ /     6!6!6! 6!  6!6!6!6!!h `@!~ ` : ` ">  0  > !h @ >  !h!H!P> !X!`!h`  !h`! !h`  !h`( !h`  . `!l <.!  ">  "ah  d!l .!> !  >  ! > !2> > !!!h `v€a id+ &> @2"+ @> > $p!@> > $p ! @> > $p!А @8Y  !~> 3  @8P !~    !h av€a  ̀id+ '> @#+ @> > $p! @> > $p!  @> > $p!А > 3  @8 x !h`!l€  `*`>,! €> @7 >   (">   (" >   <"(>   < "0>   <"8>   <"@.!~.!!h `v€! >  @7ŔH *@$!h ` €!* 2``2   >  @7`  $ <.! *@$!h*`"  !@ +.!  !h>!>!`"!~@!~ !h`  Q d!h!   " !h B   !h`  ; d!h!    !h @  !h`  ` ## d?< !~!h > €bx0!~  !h`€  " !~0!h`€  !~  !h`  !h`  !h% @ d!h`  !~ 5 !h`( `€ * 2 `  ! !h`€  * 2 ` !h @`€ * 2 ` @!h .!h!h 0!~  /( !h!h @!h `@ !h `"!~@!~ /  # d? X> !h`€* 2   7@!ؔ J!~ @7/b <)!777777@! 耢.7" @/"?#@! )!@" !h> #`#\@6R 0!h`$  ! "!~ !~ /#( 3``$ &!`$ 6!6!77`$ @!m7  !> "@6!  77@!Y 耢@> Ŕ!  &!!* > &! @6 @ 77@!> Ґ!!~  !` ` 477@!-  7@!' @!2  ` ꀥ   %6!p6!r6!t6!p6!r6!t !> #x> #!p> !r8#\!t #`#d@5!~ "D@!p!r* *`!t  !l 2 > 2 @5 !h`€  > @5 !v> !x   !x!z@5  7@ Ô 5> 6!|*` @5v2@"!h @ > !!~  .!̀`     !l `  &!@5M 0&!㿘@"Œ !~   2!~@" !~ @ɐ0@㿀!~!l   2! !2 @2   !h `. 27 ` 7 `  7 7  @ B7ߐ 67@2` `72 7@ 0 耤ΐ 57@2`2` `@ 722   7@  耢 3> @3`2 23`#\(   `@4Œ  37 `7 7@ 耤 > ` `@4 0 17`7 7@ 耢@ !~   2!~@y !~? # S" " @7777777@ ^ R"6!"!7777777"  " @77777@ > "6!"!77777@ 耢,6!!6!!~ J? 7耢 7 7!~?  7ꀤ @n @> @4$ !͐  .!́㿀.`* !l *  07.`  7 @J @>   71@3 ,*  2``d ! 2   `.`,  8@77ꀌ 77  2 * @7> 2 #\#`В @3Ș@ ' 8@7777@ 耢$*  72!   977 7 7@ٔ @2! , *  @2  !͑2 !͐ *  `@.!!!͐  `@.!0` 㾨'D!l> '| @'@'|D 0"ᄓ2` ` @ \ `D  !~` / ! |?# @3DD@!p!r* *`!t  ||@ 7@|@|!D2ᄑ2 `2?#| @3|1 * 2 '@ 1 > D' @3$$1 | *`  1  > D'@@2  1 |`  1 `> D'h@2  1 | `) |D  ~) 1  /2DD  ! 1   @   D @ 0 @  1 @D ~ /D @ሐ ` 1 @`  D D  1 DD!p!r* !t*`  '  8 77'77@ה D !~ `/ ) Dh ` !'D h `!D !h `!Dh`ᒟ D!l ?h }?p zpp/`'\t*`l'Lh2 7 'X'/`Xt\2'H'dHpt*L3 h'<'8l'T+8'$<*`3 2 'D p@ $ 3 '4    37`p7 ',  3'`7 7`p p7 7`  'P'@'0'( 1 g> ) W) G) ) ) /) ) ) ) ) ) ) lt#\4w) 7 ) o) ) D@1' D>  '@1? *@1 D!b @b> bb 1 (1 $ 1 & @1 2 D1 *1 01 ,1 .1 41 6D @1'|  @ ) )( (a2    0?# @2 *`@0D2    0?# @2 *`@0Dᄑ2    0?# @2 *`@0D!2    0?# @2 *`@0   ) ) (  ((  0 * D!2    0?# @2 *`@0   ) ) ( ( * Da2    0 ?# @2 *`@0 Da2   " 0"?# @2 *`@0"D2   $ 0$?# @2 *`@0$Dᄑ2   & ??# @2 *`@?#0&(  D!2   3 @2 *`@3 ?#0  Da2   3 @2 *`@3 Da2   8 08?# @2 *`@08 : ;) ;) :(: ;(;D2   < 0<?# @2 *`@0<Dᄑ2   @ 0@?# @2 *`@0@ B C) C) B(B C(CD!2  " D D?# @2 *`@0D| ` 7 77  7D7777@͔ @;> D7!!7!7!!͐  /!!͒ `` /!;> `@ > @5"㿈!l c7! 7   7` 77@7@ ?  " @@ *  `@.@!l (? (㿈!l d7.`# 7`7 777@k @`?@%P 㿈.` j7耦  7`7@N @5  3 /`*`-5*0  0    5`- @   -4`, @ @ -`,` @ 6@   @ >  @al 'd'`>'h-B5> @'\\@`d 2  @\@ d2`@ `\ @/xd \2 d@2   x@'\x"@|'p\"'t沐"'p'tp*" * " *  * " * "@*`@ t*` @ :`Dx**" "@ * *`" "@ * *` @ * *`" "@ * *`##@ + +` @ + |+`  @> h'\#\#`@/I \А"?@hb@@ b?'h a8 a0?` a0a( a0H 0 '\\a4 e6a8 2@ H /d * % a0   a0 a(H 0 e6@ ?D 8a4;ʀ@8a4'\@ [#\a4  a8  a0?` a0a( a0H 0  '\\a4 @ha8 <hH /d * % a0   a0) a(H 0 "h h#;ʀ('\he6@ ?D 'h;ʀ@h#'\@ [)h\@'hhʐd2   2? 7'\@ @\?d*a~  /d 8 d *  @#@ ?"@d d ?# + #a~ 22apCar* *`at  %        '\ ~ \a~ ~`'ld@ ? "@* *`  *`d "- ,`+`(  l5`   @ 5-  @-`6`. .- .`d/   (  ?`+`(  ,`5- @ 6`.  @-5`- .`-`    ?`d 03  @ " **  '`l/`d#d "@+'\\@ \d ?#d@k ?d ""d?c !"a~`/ ]7'\7@ \ d>  @-ld   #\d> a 2`  `#\@> *  @pd#`  @-N'\d@3 \ ` *`  d*  (#7+ d *` d*  (@``@2@d` @2@ald@2@@2 @  @2@$$ d@ '@d  'h'\@+Zh\d `/`d'`al?`al ?`a2 "@" @@" @@ ?@ ?  ?  '@@`'@d  'h@+%h >  @ > @1X"Ё >,* > "> "> #> #>  # >  #0> #8> #@> #X㾰> 'D!l @''2     ?2`   2`  @D ?@ 0g` "@ 0(" ? ((!  ` @*<  '!D '@* @ U `@  !   2     ! '| '||*, ' @* *` (`(@@ ?'"@*` *  *  *  : ?'t`v'  @r 'x @l ` 2`D' `ǔ  'l?h,`'\'T( -'d'<T'4?P ', ?`\?0<'L l?Xd?8'D'$- L  , @ ?h?H?(-`4 D 0 ?@0 h, L?`H, (2 T*`P$@?h+` 3 ? @-T5 `,@.`D @$@ *32?`.`` @h?`, @?h.`h 4L@?hD*``.`h-`?`@`   ?`@ $ `-   0@3 ?h5?`* *`   @2+ 2' @2# `2 d22` 2`2t`!2 > D' @+% @ /'`?`8`  q2`D' `Ք $ q7  *`D7'7@B7> #*` ** * :  @*D ?o!@ og`S?%* *  *  *  : ' ~) x5 R`~ o7  *`x7D'77@ /'`G?@` 2>,!*` €+ &'> &@* +  + +    D'H; @*  !  ) > 'Dx@* !'  ~`~2 ) D6'  >   D@*i  /'`  >  D'P@*W * *`   >   02  !-,`+`(  5   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @#9   @" * *  *  *    !: 'D' @('D'@)Œ > ?! 3 D' @)  q7 *7D 7@7 /'`5 | *  (@ q?  0(#!>  @ > @.#`> 'D @!l'2        ~_ [ pe' ('@ RΒ+ '@̖ * * `( '  D'' 4 ?`2   *`` @ $D?`2   ``@  ?`'D'  2    ?2   @ 'u`> Dp@)  ? +`(,`  5-   6`.   @-5`-   .`-`    ?`+`(  ,`5-  6`. @  -5`- .`-`    ?` 02  @' * *`  '`/` 8' ' (!)  **@ *` `(*"`( *  * ) *  ( " ( ' /''8+  * @`@   @' 8*` *  ` +` *  @x!  t )  ,#\> #`,'D@(0  (*` * *@ *` *"`, * * )+  *  (+ `" ( * *  * ( ` ?  :"(, *  ;> +  *  @2    2 D `'@'* * ( ?"( ( % (  ۬  @t'6+  *  ,> )HD'@' t 8+ @ *`     @ 8@ @`@@2`@2 '> D'@' M'0*` * * )+  *+`@  * :+`* * @ *` 0 ;+`+  * (  * ( ? "(+`*` * , +` +   *# , (D`"(' @% '*  (@ "ؒ"@*` *  *  *   @ 2```@ < 'D @%r@ P `@   0&'>  @ > @+#㿀>  @'@? @ ";!l!l2`  2@ p""@@28?``>,!*` €> #> #> #>  >   (>   8> X@G͒ > `@&Ò ?@2`  ?2`   ?`@ > @+= p> 'D @!l'@` p$'@  ( p#@'@@ O  "7@@ `!q#4 @ !c2`4  D4 4 4 4 4 $ a2  @  @@?# @2 *`@3D2    3 ?# @2 *`@3 Dᄑ2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 D2    3 ?# @2 *`@3 Dᄑ2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 D2    3 ?# @2 *`@3 Dᄑ2  "  ?# ? ** @2@ 2@ # Da2  "  ?# ?*  *@2@ 2@ #  n7Ȓ ! 7ʐ @@7 D777ր " @@2`  i p"f'@2   ? ( @ @'x't#D@ڔ'x $  +@ t* @ ``@   @"    `" D> >  `@%\#\p@@ `??'''p'h'''l'd@ N <*pd* t ''d l*` h* @ @ '@ N  7` a7 `@ !7!2  7'777@ @D n  77ʘ @ 7`D777ր   '@2`   p"'@@2    @ Da@4'|  *      >  >  #\D   +` ( ,`     5-   6`.   @- -5`  .` -`    ?@ N  3@  a3` `@ !2 !3` 3`3`3`3`  #`D@ @ n  77ʖ@ 7 D77l7ր " @@2`  . p"+'@2   &@aD@|  *   ` >  >  #\D@$C @2   BdU?   +` ( ,`     5-    6`.  @  -5`- .`-`     ?dx @ ( 7'D @"Qdx `$ 2@> D@# @ 0$'@>  @ > @(o @> !l @'@ M; <  7@  a4 @ "!2 4 4 4 4 4 ` !4 ! ` 2 4 4  @  ?# @2 *`@?#0   !2   2 @2 *`@2?!2    ??# @2 *`@?#0   !2  2 @ 2 *`@2? n  77 @@7 777@ @@> @#V @ > @'ސ 8> `@   *'& & ,`02   ͑2   > @#1   ~  ,4 2   >   @# n  ``t l2   `7   } U& , O2`  }J 2`    & ,2  e h   o"2`0  2 h2`  2 h2`  2`   -% 2Ұ h /(`2Ͱ h-*  (` `2 2`> P@" @ & , e  ;  :  ̀ @T@ > ~x ̀ Ԣ ~       @Ų`?# ͑2  : @ Kڒ @   -`,`,@4` ,` @2  "` `?  **` 2 2 $ 2   `, ` , ,  ` , 2  ` 4 @2 *`@4 2  ` 4 @2 *`@4 2  `4  @2 *`@4 2  `4  @2 *`@4  ` `$   * ? # '? ?   2  "@ @ *  *@ 2 @ 2 @ 2   @@ *  *@ 2 @ 2 @#$?ؚ`h` 4 ͕*2   ͔* * `@ ,͐@ > `@A@ K @ ,` ~   ,@   ,@,@ ~ "    2  J`   dl̑-*  h"    4`   d,` ~ "l    4`  `  4` ,` `7  @ I#* `4`   4`| ږ    "   *@`22 ?*"@0|" 4ڐ > $`h`@`g" `.|@** &"@@!  & , f& , > J@ $  2   #` @@ #\h` g4ΐ 4@ > @%z!㿈 >,!* €> @ ْ ?!~ 7耊`7!l `7 7!~   7 7 !͐ 2* !͐ *  `@.!͐@  @2ΰ?>  @  ư ?# :..`@  777@ ϔ @2?> H @ !͐ *2!͐ *  `@.!   !|  !*@ * +  2 > p@ W {? !~2 ` `7!l `.`7777.`  7.* @ 777; @ R !~ L ND!~ > k8!~ "3?/!~ "*?b&!~   b7 @ 5@? !~  w @   ?p>  @'  . Z?.!!͒`B 2.>!!̠ !2@    < !h`€4  `! "!,@ N  @!, &!,@א!,!͐ .!!~.> 2@  !~2`@p d @!~ . 2` @@2"!h!͑2   2!h!͑2   $.`> 25 @j !h! €!* 2  !h `@!h`  + @!~ /!h`€!!ԓ* 2`  7> !Ԕ@; !~!7!~  02/!h! 8+!h !h`€!!h`€!* 2 -`2 @ #$!h@!h `@> @  @`€!-`2@ 6!2H!h 2E!h!~ /(!hĐ d!h`€!!h` ` €-`2@' !~ /!h`€ !h`€ .!.``B >!,`> #\@23  @4 !h6! `@!h`  !؀ | @4  6!؀ L?# * !"  ?2` 7`  ``"@!2  " ? *` * 2 2 !2  &` @2 *`@!2  6`  @2 *`@!2  6`   @2 *`@!2  6`  @2 *`@!2  6` @2 *`@!2  6` @2 *`@!2  6` ?  **` 2 2 &` ` ` *   *  `Fp@-r  , r !?2  ct* @2 *`@3@ r rt*2@r  rt, @ @&r, r!ʀ *6!@Ζ !@!2  " ? *` * 2 2 !2  &` @2 *`@!2  6`  @2 *`@!2  6`   @2 *`@!2  6`  @2 *`@!2  6` @2 *`@!2  6` @2 *`@!2  6` ?  **` 2 2 &` ` ` *   * @5>  #\@! ! %> #h> @  /'> %>  ` @ @>   @2` @ @/@ F_ @ ` , >  x@a!h > @ ` > @ْ ` > @В `> А@ǒ !|`  2`@ F" @`> @ `@)!h  (! *  ?`"*` @ F @@  > `(@  !h > `P@ !h`!02 ` *2 @!* "@`  $`,` !2` `$``!͓*  .!̀ $`,!~ " ` `"`  6` ` @"@` ,`X@> @`, 2 !~ `X 2!~ $`,!~ >`$`(` "` `X 2`"``, 2` $`,` `4 ` "J> `   d!l̑* *  @ " ` ! d  !͐  .!-> `@2 $`(` , "$`(`$`(` @> `X 2`$`""`$`, 2` $`,` `4 ݢ`  6` > `$x`@Ȓ @"`$`  (,`X $`,`, 2 `$> @  $`,`$ $`(@ `, 2`$ $`,`$ " !!h `! 2` 0`, 2` `X (` @" `X `6   W 0  . ?` ( 8 >  2 `$#\`( #` `X #d#h`,#l@f!΀ "-!ΐ?6!Γ-" @ D @@ -`2  !h`!!h`€!!6!Ѐ@&6! 6!6!؀ @, `!B@g>! ,  @ > @ 㿀!~   2 '!h ` €* 2 '.`4 >  @@?ߐ#@`?>,"<*` €!͐ 2*  !͐ *  `@.!͐ @: @4 @  @. ?> )> &(!h`€!> H@ƒ 0v> x@ 0o> @ > => > @ !h `€@h!> d0.`D> @@.`> @ !l *#!l* "!l 1"(@{ !l  "!l* #!l* "> H@f !l *@"!l "!l* "> h2@P !͐ 2* !͐ *  `@.!'!#'!N '!'!'!'I >  @,!`B  >!!h `€!l2` !l "!l pa"!͔ .! @^ !l@2    !|  !*@ "!|" ,!|&!> @ !͐ !l.! "!l pa"1 !͐ !l.! "!l p"  !͐ !l.! "!l pr" !͐ ``!l.! d" @ !l pbW" @ |!l@  ?  "@F!͒  !l.!  ?"!l @#> Ȑ@v Y!h `€%.`2 `,>,"(*` €> > @X # >  > H@N  @ @" @ Z?> `@=  > @6   @!͒ `!l`.! ?"!l@ 0!"@> 4 @ 䀊!-   :  !h`€.`4 ``` `$!%> @a @ !ʀ&6!!`B >!㿘`>,#<*` €> @ْ  !`B >! @" "!  2  "> @  > `  `@+'>,#* €` b2  > ``2 ` @ , `@ *` 2` 2  > #\@  > ``2 `p @>  @9` a>  @9y` ">  @9p` $> Ȑ @9g` (> ؐ @9^` @>  @9T` @>  @9J` @>  @9@>  @9:``> ( @91` > 8 @9(` > H @9` > X @9` > h @9 ` > x @9` @>  @8` >  @8>  @ > ``2 `#\ږ  >   2   @Җ  !2  d  !͓*  .!,``@  >   2   @  !2  d  !͓*  .!,` >  ( 2   @ !~ ` @", `*!l * @`(  !"`(, `@Ӑ `>  &(``2 `Hk  > ``2 `pa  > ``2 `W  > ``2 `M  > ``2 `C  > ``2 `(9  > ``2 `P/  > ``2 `%  > ``2 `  > ``2 `  > ``2 `  > ``2 ` @ R, > ``2 `H  > ``2 `h !~ ``2 " $@(,   #\>  >  #`> $˔,&( > miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#96:\ :ts=3500:\ :pa#12288:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#12288:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#4:nc#544:\ :pa#4352:oa#0:ta=4.2BSD:ba#8192:fa#1024:\ :pc#4352:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx``2 `p  > ``3` ` > ``2 ` > @ , > ``2 `X #\@  (.X&, > ``2 `H  > ``2 `{  >  ( 3`   `@s !~ "(, `$!l `?ȑ*` *  *@ 2  `* *  @ "  ! d  !͐  .!, "&,`@ >  P 3`   `@9 !~ ", `$!l `?đ*` *  *@ 2  `* *  @ "  ! d  !͐  .!c, > ``3` `x `@ V,` (  >  @  !l>  Ȑ@ !l@2    b700@Ӕ !͐ !l.! pb" @' ,`+`@'  >  @ǒ , `@  >  @ , `@  > `  @ , `@ &,`@ > @0"@㿘.`6``=!|@ !.` ?` **> X2@ 0'2  + 2 !* "@`$&`(  .`X!h 2!΀ "!!ΐ?6!!B@>!㿈!쀢   = !@"!h6!5? `@!h`  !쀢 !  0 0! 76!7 !2!`6!7!&!! 7?6!@ 㿘!~ >  > "@!~,  2  ? ,  `  `? `  !ܠ --!h`2`45`` 2!h6!.!!͐ .!!h `@ٚ#h> !~ @ `'`>   > " ^@  > 6@&!~-   ``2  ?  `  ? !܀ > 6@@  @   +-!h`@@4@4  `6!.!! !h.!`@!   <!4 ,`!8 2 "@*`" * *  @̒Οʀ  ΐe!͑2    !!!͑2  2!h!͑2  )> !0@# 0"&!,!,'> %> ,l X@И !, `",`# !> .!!h&!,@ !͑2  !͐ .! @   *" @ 2@  `} | @!~ > #> !-  `2 @> Ж@4Ԓ @`@1 4`@ "R ``DE> @G`@=> @". ``@`@/> @` @!'> )> ' $> "!> !> !(> !@> !X  >  !p> !@4y  > @l  @ > @!ȁ㿈!~  i!l7 @ *  @$㿘!͠    < @,`x!͐ !͗* `!~*@  .!̀ .`*  !l* ??c#    2` 2` @ > $ ؐ @ m`  2` (7 $ 9'䀊 _ 87 ?!a @4  @7@7@2 7 2 * @7 ? * (@4 > 2 #\#` @Θ   $ '.`,` 7 䀢  !͑2 !͐@ *  `@.!`2,  *@ * .`$ @4 ' @``  *  2` 2`  `!!͐  `@.!0` p!~ a.`* * "!l*  H $!    k$, 4 4 , , , !@! < !@4< ! !4?* 4! @  @  ! @&!`!#&!!" > !@ !D8@7 !l!@!l :!!> !@ !DX@% !@!l: !l : .`*  !l* @@` @* @ *@*  $@!~ <*$* $@!   4`,`,` 4`,` ,`   *` `  "` ` ! @21@@ ! @2(@ %7 @@  $@`* @2  *@ * $@ 2  * * @$@@!> 3` #\ ` 3`#` ` > #d ` @#h@ `2 #l  @ @> 3` #\@3`2` `#``3`#d`#h   @ `???ì#c !)>  4  $ , 4 4 !~  )  $ ``2! 2    ` 2!` !? : @2       * 0 *   , $ , #\ 2  #` #d  Ȗ@. 㿘Đ!͑2   > x@ !|!2 "!|ː!͑2   !͐  0.!!͑2   > @ !|6!΀5 ,`2   (! *  ? 2`"  $!|@!* "@ $ " $ (!h 2 $$ ( $ ,@ `*`!|2  Ϣ 㾐!~>  @ '!       @  `!S@2! P=`!2  2p?> @ > @ a?  @b `    @ ` > @i @?> @_ 6?!~  @$!~ 2) @ # `  @Ē    ` @@   @ @H @ > @#㿘!h    !h`   !~ `  `@`!2  2 ` f 8`?`f a `&&6* 2 <   !h  Ը !h`  ԰ !h  Ԩ <<6 *`6!h  Ԙ !h`€   6ԋ !h`  ԃ <!h`  x ?# @ `*`2 @6㿀` !l2 ` @ ` * * $@!(2 ``2 * * @$@`?,` `c,` `,` ` @ * @ @$@!~  2`  4 ` @ $   @  $@` @2  * * @$@` 2  *@ * $@` 2  * * @$@` 2 *@ * $@` ,`` * ` *` 4``!> `*@ 4``> * @3`$@ `#\ ` 3`#` ` @#d ` `#h@ 2 #l!@ @!3` #\@3`2` `#``3`#d`#h>   ` @ %> ` 2  * * @$ `, ` `*` 0 $ `, !~  `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d Ȗ@  <2*  *  @$ , 4 ``` 㿀.`*  !l* 2` `**` $!( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3`#d #h> 2 #l@ ` @ !> 3` #\3`2` `#`3`#d!#h  `@ Ғ  +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `Ȗ@ F <2*  *  @$ , 4  `i 㿀.`*  !l* 2` `**` $!( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3`#d #h> 2 #l@ ` @ !> 3` #\3`2` `#`3`#d!#h  `@   +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `Ȗ@  <2*  *  @$ , 4  `i 㿈` `/``+``(` `  `-   5`@ 5- @@@-`4,- @ ,` @ @  @l >  '(@ 7   @ > ~  /E<?` `/`` +``"(`! `#  `$-   5` 5- @@ @ -`4,-@,`% @ @   @  >  'H@ ^7    @ #?@ >@  $@2 > @2  $@" >@"/`  $@)    2`2  <?#?  >   2`   2`2` @  > ` > ` *` `+ `@ ` #\'@ h` ` * @6ሀ$2`` ` * @6`.`.ሀ(2`.@2``.`6!0@ 2?0(2 ` * `*  +     +     +    +  !0` 2?0(2!0` 2?0(2 ` * `!*!!0`" 2"?0(2"!0`$ 2$?0(2$!0`& 2&?0(2&!0`( 2(?0(2(!0`* 2*?0(2*!0`, 2,?0(2,!0`. 2.?0(2.!0`0 20?0(20!0`2 22?0(22 `4*4 `5*5!0`6 26?0(26!0`8 28?0(28!0`: 2:?0(2:!0`< 2<?0(2<!0`> 2>?0(2>!0`@ 2@?0(2@!0`B 2B?0(2B!0`D 2D?0(2D!0`F 2F?0(2F!0`H 2H?0(2H!0`J 2J?0(2J!0`L 2L?0(2L!0`N 2N?0(2N!0`P 2P?0(2P!0`R 2R?0(2R!0`T?0(2T\(T|d㿐!h !€6!!7!7*  7! &  `6` 6@ !0 @* `* `* ` ** `* `* `*!0 @* `* `* ` ** `* `* `* @* `* `* `* `* `* `* `*!0` (?0((02!0"` ` ?0((02 ` * ` * `* `*!0  ?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0  2 ?0(2 !0  2 ?0(2 !0 2?0(2!0 2?0(2!0 2?0(2!0"? @? @*`(2 2` "!0"? @? @*`(2 2` "㿐!>  0>_.!͒b &! 0&!L&!H!$`,$`$$`0!|! 4 4`!~>_#( ``&!!)4`!l 4`  4`!~ *@6!@  2!~ !"$","0` 22$ `22 ̒  *@6!B!~ "A!l'H /d * % !0  &!0&!(H 0  t!~   2 !0`' e!0?` &!0!(&!0H 0 B!g!>  !H /d * % !0  &!0&!(H 0 !~&%"`*' , 2$!l@2`  22`    2  2 !2   2`  2!02`  4 !0?` &!0!(&!0H 0 4`!> (@ɖ !~   `p (@ 㿘 <?#@@& <@א㿘 0 !~  > !$`I>`!8  #!C#!82 (@*`@!l*` @ 5(!@: .> !$`<!8 ?#!8 a `;# `?Ȗ*`2 (* @ @ " 2  !͔  !͑*  `@+!* 3@㿐 >a 0ch@ a   $,4 H /d * % a0  $a0$a(H 0  a͑2   4Ka8ah`  ݐ a͑2   & a~  ah`   a0ah   a0?` $a0a($a0H 0  $, e a a~  0,à` ah`   a8ah   a8 ; a0?` $a0a($a0H 0  2a8@a8 aH "$aHaL"$aL$a0?` $a0a($a0H 0 > P@   !2` /a8$a8@a0 `a8 *` ? $a8w$a0a($a0H 0 0m8 f"0a8 g e"U Ta0 h"9 Na0  h@ -#> ,ɷ @̐ $aa$ 67a0a> $a$aΔh@R -a0> `  @$a8@F aH "$aHaL"$aL$ >    @5h>ccP@> !, @ $a0?` $a0a($a0H 0 㿐ɐ f  g e 0  h 0    "`5 "  `!h@  ` 2 ɷ#蠄?2!h`2!h` 2   "`,`,   &`,㿘 @  *&    0@V h *@&  @>  `0@  * & @}̐!8 `  $!8> @ @͐@>   @'0H o*@ e a0  $a0$a(H 0   a| 6 a*@ * * 2  "ia  >  @Ua0?`o$a0a($a0H 0 f @@ >   @<a0?`V$a0a($a0H 0 M @ & ah@ D   >  H@ @*@-& '->    $` > ah > p @ "  a|8 a* "@ *  & ,& a0@ْ  @* &   h@ +#> , @3  &  " a0?`$a0a($a0H 0  @@& @ - @ , /  4  ` , a2  "?# ? ** @2@ 2@ $ a2   , , ,  , a2    4 ?# @2 *`@4 a2    4 ?# @2 *`@4 a2   4 ?# @2 *`@4 a2   4 ?# @2 *`@4   $   * ?# ?1?`   a2  "  *  *` 2  2 #a2     *  *` 2  2  $`?؆ah`a4a a0/> @ a0?` $a0a($a0H 0  @ > @j!؁㿘H /d * % !0  &!0&!(H 0 !h`  !0?` &!0!(&!0H 0 㿘  0H /d * % a0  $a0$a(H 0 B f)>  g e"P ,Ua0 h"2 Oa0 >    @t  B h>ac@ϐ @ *#> ,Ƶ '@^ a8 ` ?aH $a8aL"$aH$aL &>  >  @  @E h>ccP@> !,@  &   & ,la0?` $a0a($a0H 0 㿘H /d * % !0  &!0&!(H 0 !8!H `'&!8 $ !0?&!0` &!H!(&!0H 0  C"@!H "` > P@ݒ 0!0?` &!0!(&!0H 0 㿘!8 !H  &!H "@!H "` > P@ 㿀`>]!.` €!~ r!/m?>@ .`*   !l.* @*` @( `&  "# 2  ` ` 4*`` " P` ` ` *`0  (  ! *`@ )#  @  " >  ( >  " >  ""h> "x> "`.*  > `#\#`Ȗf> _ > @) 0%!8> ` ? &!8Q8!8!P ? @` &!8>dat@u!8 &!8@t > :H!~ 2!/-> .!l*  (a8 @ > #\2P` > #> ##`#d#h #l #p@Ԓ 0Ѐ> @͒ 0 '!l ">   > )"> %"">  > "> ">   (>  8>   H>   X h>  x D$ > @ !2  @2     !  &* *  (  ( @2`@2 `@2`  @"    M  (* *  (``@2 2> @7 03<.@ @ *@ &@ >`>`&@"&`!h `€!~     !h ` €* * , > ȗ23 @  㿘'P'T`'X! /@ >  @ !@ ڒP> @ !|XXX$$XXǤLxĀƼ,tPߴߴ8(hhh޼޴    2     2 㿘>| 0c@$ 2%  @( &$% 2$  @ &%$ > % 2%$> @ >!0L > > !@ 6 0D!d* % > %@ -!% @ 'x  `. ʐ . %*"@ *`"  ʑ*  , @ 'g* %$ . . ʀ`   &  ` & @.$%"  6 `6 N6 b> H(& t& l& x@) > a, 0*"@ @*`㿘  @!> !H!> ! @!'  .$`  !H! > !@Ҕ!( .$   Ԑ!%$` W> >f"H*` €   ɐ  ` ȟ %(` &%(  %(` &%(   %(    &%(. .     .     ` ğ  ` ʟ  `   ` ˟ %$ @m! ` ğ  ` ʟ  `   ` ˟ %$  ` ȟ 㿘 @> "(@A > aH!> ! @8!o  .$`  㿐> !H`> $"@@#!> !L 2$> (> !bX#\ L  @=  $!L$ 2 ܐ & & & ܐ @ '$  D "@ `@0< .$6$ "`, @  -* #   $ ,  "`, @    @ $@" ,@ِ`,   2  ב*А ! &$耢 &$  :  %,   ; `!`*%/*** @`! .$H!> ! @!  .$   %$  a0 Iˆ#0…"0 .$@㿐` `,  ` > !H` > `/"`I`J@] .$`` 2%$`А"@ > ڐ @ %#> ,!,ː @ %# @ݐ`%$ 2 !H!> ! @3"r  .$`        Ɣ     * % @ %_ ,`"* %@ %W* &`%(  %$  2`   `2 %("?%(  %(          ` "r`I%( Y`/`@ &%&%`'%% @ `  `  ŀ @2 %$  ` %$  `  %$ !H!> ! @"  .$`  !H!> ! @"  .$`    @0`@@`/!H!> ! A@m" A .$`  A0۠  %( "    `  ` `@`I.`,`,*`J *`@  `..`.%( p 2o  &%&%' %% @ `  `  ŀ @2 %$  ` %$  `  !H!> ! @"  .$   `!$ @6$.$!Ha> ! @"ʐ  .$`   !H!> ! @۔"̐  .$`   @0E @g !H > @Ð"!H!> ! C@"ݐ C .$`  C0)`!$ @6$.$!Ha> ! F@" F .$`  F0!H!> ! B@" B .$`  B㿘H /d * % > (!@F&` H 0㿘> "l` `@? `H / * % > (@!H 0` L@ $>|`a@ߔ`  &`  㿘  `0!> !H `> @2"!H >   " @(``*    @,`   4$  @  2@ $$ > !L<$ H /d * % ` $ ` "` $`` $ ,` " H 0n 2$ N  $  $ @ $  $ D  /  $ @ $ < $$ D, HH /d * % $`$ `"@%`  $ d`@OH 02  @ " @̐ @   @Ð 㿘> !H`> @#"" !>  @ "`@ ֐` "$  aH @d#@ k#贆2  㿘> !H`> @Q#8$`" > @#P``` `*     ` @  ` "`  @  !H /d* % ,       &> $  @   H 0@@ #$  <$  "` $$ , " > !L$   "$  `      `  H 0w@=,`I  2 H 0h@ *`  *`2    *`22 > @ #x,  , *# ,`JH 0      , @``&   H @``"`& `@"` $` & 0 "@> `#@Z`@`2`㿘``/  *  > aH  > @D#@ "ޒ  .`/  *`,`,``  4   #&`@&`<&`D&` &` $,        2, @ , $  ܀@2 Ԑ0 &@ " & & Ԑ &`` `&` $ 㿘` *  ,      m> aH  >  ,@֐#@``H (2  , `> *`4#2@ǒ  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (Z0Q$ ( aH `$  (`" ,> @  ,`2> > 4@ (@ 8@7 ܀@2  ,$ & ܐ .$* , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@  ڒ`@q%㿘`  `*  ` 2,``  ,`  2 ̒ > > >  H@2`I*"`I `J*`  "">  @ ?*`  ?&` @``"`& @`"㿘!> !H > @ !H!> ! @$  .$   $耢   㿘``> 0%&%%%@@B  @€ %$` * ,`  '>  @€ , &  π % `   @€ , @ € %  '>  @€ , & %@&%H  > ` > !> !%@ H "%% @ > !> %!@q %`@ *%> @i! %㿘!> !H > !(@]!H   > #> @@Ra &@> @K!   `@ %$ 2   `   & 㿘e$   de   d* * > !8@`!> & ? `*   `@*``       `` `    ,dݰ `.@  > !x@`!> ,d$` ````+`eZ`@ ! . "* e@ * & e(e$  ` 2`` "?e(  `  `  `    !> !H > !Ȓ @%h!H!> ! @%h` ,d`   dd @ ` @!H > !Ȓ @n%j!H!> ! @f%j` ,d`   dd @` ,d4d< $dD>$d!H > !Ȓ @J%s!H! > !@B%s` ,d`   dd`@ !H > !Ȓ @-%w!H!> ! @%%w` ,d`   dd`@ 4d,d 㿘> !H`> %@ !% 2$> "@ 0!H$ >  @"8$&% `.$!H > % @"p$ !H!> ! @%  .$`  %%> @Ґ"0%` > !Ȓ @ǔ%!H!> ! @%  .$`  $$ 6$`A3.$$ % %  ` ` `  ( ` ` ` `    `  @`?`!H!H!> ! @w%Ր  .$`  0"> "@g $ &%  > !@>  ` % *  @ "N>f"p* €!H"> @B"$䀢 6  @p` $> "@6 &$ ! $䀊 $D" ( .$!H"> $@!"$ @"{ !H$L!2$> ` "@  !Hb> @# !H! > !@&   .$`     ,`    *  2  l  I   J*` ",J" ?*,J,I *U"> ` #8@Ò $ `.$  ,  %(`     `   `  0$> ` #`@  , `$,!H" > @#$!H"> #@ $!H"> @#  $$䀢`.$ !$ !H"> @o#$$<$$D!H"> @d#<&$D&$!H"> % @W#% `  " `G!H"> ` `@F#% ` O!H `,%   `,,%, "  " `|("%@o` > @' $`2  , `,!H > !Ȓ @&n!H!Y> ! S&nc @ X , "* %@ P* & , "* %@ F* ,@oP`  @ >@ 9!, @*`@*`" > @ $`21  %,@6 %/,   ,  `,!H > !Ȓ @Ŕ&!H!> ! &@  .$`  $$ @`.$6$ ,$ .$  `+ %# @  ,`"* %@ * &`%(%$    2  "? %(           $>  @\ @% ` 2L,  @, +@ % @  ,`"* %@ * &`%(%$    2 `` "? %(              ,@nd` > @ X!H!H""> @ @nU` > @ !H > !Ȓ @&!H!> ! @&  .$`  $$ @a`% 2> $`2 >   S$%  > !@ !H6$  @$!@@ !H > !Ȓ @&!H!> ! @&  .$`  $$ @` > !Ȓ @&!H!> ! @&  .$`  $$ @` .$6$$ !H!> ! @l&  .$`  !H!> ! @\&  .$`  $ .$&%㿐> !H`> $!x@C$$ @$쀢 "=%!H!> ! @4'  .$   6$)&% "> !H > $!@' !H!> ! @'   .$`  $$ @$.$@ 6$! @'% 2%$$ $    * 6$6$6$&%@"$$є ǀ"$$"s  $” "$$ ܖ   $ *$*`* $`* $*  $* $`&%  , ƀ  , %/ @  ,`"* %@ * &`%(    2 %$  %$  `"?`%(  `         ]$    `$* *$*`$*  $* I&%$ > !ؒ @P'4 ` $ 9*@ > !ؒ @A'= ܖ  I$* J$* (&% $ .$*@ ` *    ` , , *@   $  *@ *@  $.$*@$&%%$ 2% %%!H!> ! @'~  .$`  0U%0@8 % '% @ `  `  ŀ @2 %$  ` %$  `  !H!> ! @'  .$`  !H! > !@'  .$`    @x> !H`> $@! @ 2 w  € . @€ %$ ` .  @€ .  @€  . `$`" ̟@ ̀ 2! ͐ &$H >  ̐"h  @X  ̀, @€  H! > !@F'  .$   G $ >  @5"\  ܀  > "0@  0@Y  ̀ @( @€  H! > !@'  .$    $  2  "`,  @"-$$  .$ݰ $> $ $"P@$ @€   H! > !@ڔ'  .$   ې $ ` .$ € "A  @?2 >  @" @ 2  ̀2* $ "& $쀢 2$$耢 > % ̐" Ζ #\ @  ̀ 2  ̖  Β ?D#\> $@" ̀ B>  @#H$쀢`H > !Ȓ @t(QH!> ! @l(Q  .$`  $$ @` > !Ȓ @X(SH!> ! @P(S  .$`  $$ @`.$6$ ̀` "$6$H >  ͐#h @4 ` @€  H!> ! @%([  .$`  H!> ! D@(b  D.$`  D$?`q>f#4*` € ",`  *  ` 2  2 4 `8*`` " `"  "`  "@ @h `2$ "> @j$` > @Đ#` $*  `.$ ` ,`$ 2>  @# `> @#ѐ> @#@vN  T"`,W& $?`h>f#*` €>  @#t $耢  > @ (> @| HX$$耢   € >  @l ` ?#>   € @`` ?  ܀ $6$ 6$6$.$H > @I @ Ԁ $ " & & Ԑ $ `$ & $ `.$>  @, (SI   $%%$ "% >  ͔ ΐ $#\@ : .$H > !@ ` "%($`.$H!> ! @)%  .$`   $ " $%$ 2$$ .$$ >  ̒ @ڐ! 練 0  2;> 2> @ =!@`   Α*  `$>f"*` €H!> ! @)O  .$`   ! ` 2 $ I 2$> U!X > P!p ` H > !Ȓ @@)^H!> ! @)^  .$`  $$ @`@.$6$ ` D %/,`,`$ .$ I`H > !Ȓ!@e)fH!> ! @])f  .$`  $$ @:a > !Ȓ @I)hH!> ! @A)h  .$`  $$ @`H > !Ȓ!@,)kH!> ! @$)k  .$`  $$ @a.$6$ t&$%( " % @€  f @€  Θ  >  !  #`#\@  Ha> ! @ )  .$`  H > !Ȓ @ ݔ)H!> ! @ Ք)  .$`  $$`@ 6$.$H!> ! @ )  .$`  !%( !% >   ΐ!  ` #\#`@  !&$< &$D.$u&$ ͐" Δ @  Ha > !@ )  .$    $ W  ̒ `.$>  ͐"x @ o  %> "@ e %% ?,H%%@H @ > "@ T >  ! $䀊 $D" ( .$"@ @ &%H!> ! @ 7)ܐ  .$`  0> # @ ) ߐ $ 2> 2$> @ # H  "0 @z @ >  0H! >  0>  0H @> @ #0&$H @" > @ #H ̀/%$ H π 2$H!> ! @ ڔ)  .$`  $` .$H! > !@ ǔ*  .$`  $ > $ 2 $>  ͐#` Δ @  $$$@ ߀ .$Ȓ`?   ͐# Δ @   ]&$> /#@ @ @€  H!> ! @ *%  .$`  %( W/@ &%&%`'%% @ `  `  ŀ @2 %$  ` %$  `  H!> ! @ A*4  .$`  H! > !@ 1*7  .$`    @ @/H!> ! @ *;  .$`   &$H @> $@ #H!> ! @ *A  .$   $%0@8 $ '$ @)&$> @  %$ 2$H!> ! @ Ք*J .$   $%0@8 $' $ @ &$ ~$     `  ŀ @2 %$  ` %$  `  H!> ! @ *W  .$`  H! > `!  @ |*a   .$   `   @S  @> @ b $`.$H!> ! @ W*g  .$   &$@ K rR0  .$* @15%@  2В@@@ '"@  ? @ 2 @1@ @$  $  㿘` 'А @&`&`  ܀@ ;$ !'!> !H > !Ȓ @ *!H!> ! @ *  .$`  $$`@ 6$.$А"@@ #@ 0'> d, > !,^'@ %#`@p0 tp  ``0*``@e   €  @ >  X>  h $> #\ ܐ p#`#d$ #h$#l$#p$#t$ H#x #|@  DH /d4 * % @  > @  W 0!> @ ! $,h ܀  $耊 @dɐ> @ i!`  `*  $ H 0㿘> !L}H /d * %   @4 0*`  `"( 6 2  2 4 `8*` " `"  "`  "@ @  @ё*`H 0> !,*"@ @륓*`㿘 @€  . @€ %$ ` .  @€ .  @€  . `$`" ̟@ ̀ 2! ͐ &$> !H`>  ϐ"h  @  ΁D44Lhhh㿘"d6" L "h( 4"" +> .`4 @ ͐`, 2 .* 2. 0 +> @@ b8"@"> > @ "H@ "P ?%#4"d @( "h%2  ?# @2 *`@"d(`"h!.`2 2g"."g >  "X#@> "X ." ."2@ F'0> 4bp@ٔ  "&@:@??@ # @2 *`@&@:@?@ 4 (, >>>?#c"$$$4T$ $@@"d(`"h "$>>$̒ 3 @"k>>>""c&"@&"X&"\&"`" > @""?`6*`>}! €"@(@i"d(`"h 2"@???@R "H   " @"5 @"T " "d@"P  "d@"d@8"d! (@"h!2 "d &""h ( 2 @  "d X"h2`@  㿘"@ L"$?@SA?"$@"ђ?@#@k 㿘"d "$ "h ( 4  ?# @2 *`@>  !3> />  @  @!ɖ " @Sb @P   &"l@ 7 +  ?4 @ ,     ?# @2 *`@ 2`, > (* > @"">  , @!㿘"d "$"h (#2  ?# @ `*`2 @"d( `"h  p5> 2 4`5  (3> />  " @b @    @!L  ` &"l,`(* `@> "耥 ,`> #> #(> @#>  @!O㿘 ?"d L"hc# %     * 2` 0   `@$@Đ"  "d(@ "h 2 4   !4 " 2 "d  ?#4 "d(`"h"2  " , ``$ "?   `* `$ "d# "h ( 2`@ m "d X"h2`@ b "d(@"h!2"      "&@:@??@ # @2 *`@&@:@?@ 4 " 7 ( 4   ? 2`*    ? 6 ?# @2 *`@44 4 "@"@{"d ( "h!2 6 *  x 4  6 *  p 4  ?h 4 @",@   4   H4 @ T`@ {@U5T"d  L"h (!2"d "hR`T `T!?0(R`T `T!2㿘",@I 㿘"d ( "h#4` "   @4`n# 60  @4`"d%  X"h 2`@ i"h"d (  2@ \I#   @4`㿘"d ( "h$4`  ` ?# @ `*`2 @`   ?7?# 2 , @4` ' . 4`#"@k("d@"h#2 "   `?# @ `*`2 @`  ??? # @2 *`@4`  @?# @ `*`2 @@  `?# @ `*`2 @`  `?# 2 *@ 4@ 6 ?# 2 *@4`"d(`"h!"$2@P 0"d(@"h$2 `;>}".` € "   *`   4` &"  4`0   ?# @2 *`@4` l#"  ?# @2 *`@4` ]#"  2D"d"d (@ "h#2   @?# @ `*`2 @@  `?# @ `*`2 @`.`  ?# 2 *@ 4@ 6 ?# 2 *@4`-"d (@ "h 2   `?# @ `*`2 @`?` *.`? # @2 *`@.`4`#"d(`"h!2  㿘""d  "h@P "$"T&`"Pg&`", &`" S O P> "d1 (@"h##2 `?# @ `*`2 @`"d (@ "h! p2> " * 2&`"d(@ "h$2 &`@  ` ?# @ `*`2 @` (""d`  &`&`> "#0@i ("d(`"h!2 㿘 Tbd $@ @bh!8  ! 2 !(   2 > @#` € @ @ & € ! " `e$@ t`& t!8  ! 2!(    & &!$ !?&!@Nǐz@`  ?# @ `*`2 @@ 0  b`:@??@ # @2 *` b : ? 4 T$}6 T % ?@  € #4!8  ! 2!(    & &!$ !?&! V@ b:`@??@ # @2 *` @b:`@?@ 4 < @6 H/` /b`  @ 6?# 2 ,@4@ ?<#4 b l̴> Ь"  /> ѓ2   $  ?  @ @,`H /f * ' T * 5 @WO   "% 8@  <"`< < 8"`8>  $@   ( $ 0 , @ 4 ?# @4 $ 0@H 0 2 fb> Ь"  /> ѓ2   4 `  ?,H /f * ' T * 5 @V   "% 8@  <"`< < 8"`8>  $@   ( $ 0 , @O 4 ?# @4 $ 0@H 0 2 ,2H 0 p & p@  b    b    @ ?# @2 *`@`@ː!8@  "!8@t!8㿘"d ( "h$2`  `?# @2 *`@`"d(`"h!2 2   " @A 㿘"d6"h   ,`  `@.& )"`` " `c& " %8%&"&"@""" Đ & @` H4  ;6   &""    `2"㿘?"d L"h# ) &+  @2 *`@4`  @/ T {r4T  @Ր "e!h 4`` @2 *`@`  2㿘"d L "h"   ?# @ `*`2  @"    @@2 `l g@{ 2`h`l 1$`l`< `$`h @ @  a "   ?# @ `*`2 @    @@Y0B  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0   $㿐""p* @ L"d "h-"@H /f * ' > ѐ @6  > 4 a` $ 2` $ 4 $$ $ $ H 0 2$ L ""@2" 4@j "`  ?"@&"  $4 $ @U$ $ $ `) ܑH /f * ' > ѐ @ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ 'H/` /"`  `$> Ь! B""p* @ 0"@H /f * ' > ѐ @   4  `5$ $$ 4 H 0 H 0@J 0"`  ?"@&" 쀢`+`*H /f * ' > ѐ @g $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(@8"   4 # "$   *$ $  4  2$ *@$ %@&@`[  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0   $H 0㿘H /f * '  L@   H 00ra2@a1@Sa @a@"4T] 0!5@a@"Q 0 !6@ 0JT 4T ` -@$0<"$@6Ҁ%82 \ 2.$\0,@  2T@PT ?!4T `@`[0@T@ƒ 4 T @ @  H 0㿘H o*@ g2 H 0㿘> cx @  `$ 㿘""d "h@J "$" 2 "d(`"h!2 4 4   4   @4  ?c?#     * 2` )  $  ?#c %     * 2`   "  `@$#  P4 . 4 "d ("h 2`@x "d X"h 2`@l!h 4   x4   p4    4 @㿘#.@7 ? c  . 2 @ 2  @ . 6 㿘?"d#"h c)    * 2`    ` d2`2">   #   >  #@ 0 㿘"  "Ő 2' "d` "h?# @2 *`@2  ""d ` "h? c *2`   㿘H /f * ' > "!"p,@ ( H /f * ' > ѐ @Β $@ 2   5 @"@@"@ " @2H 0@ "" ?"$ ɓ,"&" 4@ H 0㿘H /f * ' "p 4   "@G$ &"@&"H 0d h? 0* d ?0(2d h? 0* d* ?0(2"d*` 2`"h? (0 "h 㿘ʒ  ƒ  ?㿘  * ͒ @    >㿘"d "h`($2"h2` ˔  ǔ Ô  x u T o  * 2 I  c  , { *  2 8 Q 0 "d(`"h!2 㿘"d! "h@($2h t  p l h  d `   "d(@"h!2"d ( "h#2  ?(0"T" ߒ` 6 ? @0*`2"d("h!2`㿘 ?#c #  `  * 2` 0 `֐  $QxQQQQQQQQQQQQQQS\SdSlTdStS|STdTdTdS,,,, $,D<|$4T`lxdxh> `@#'!&+ؐ  0@O&<` 77€Р ""(> @P#Ԕ N@@> @B  XB ?& 0 4`T`$&%$`` "$``($`d$`a $a!"> c@ "> `@ #> ` @ )+) d<6+6+6+6+`#8& 77Ȧ 6+6+6+6+6+6+6+6+€ 2 6+?# @ `*`2 @6+ "$+  b#F^#+: @"_ &+А`&+ "e@$+А &+"D!  `@#&+#'&+#c   @+А!&++А &+# aj $+А(&+"&+И "&+А&+ !@$+А &+"ܒ$&#<!O 77€  !̀ "`,+А &+!`,#ܐ@#@  T#<aƐ 77€ " ?# @ `*`2 @`8  6+ +>>%> 3> '>  +  6+ 6++>>%> 3> '>ܖ㜐@   @ ! @ +Ѐ $ @ +Ѐ ( @ +Ѐ!" @z + #  @r ! @m +Ѐ $ @e +Ѐ ( @] +Ѐ!" @U + #  @M ! @H +Ѐ $ @@ +Ѐ ( @8 +Ѐ!" @0 + #  @( ! @# +Ѐ $ @ +Ѐ ( @ +Ѐ!" @  + (  @ ! @ +Ѐ $ @ +Ѐ ( @ +Ѐ!" @   @  @@aa$a@4a@c +Ж`&+Д @ȵb c c& €@  @ > @  (+Ѐ+2d+6 ? @0*`2+Ѐ+4h+6 ? @0*`2㿘+Ѐ  0`T #+ 2d2@ + `4`h+  ?<#2 #+ 2d2@+` + 0`@?# @2 *`@+ 0`@#+` 4 h+`67 ߐ#p2  @֐#+`4h+@  !2 @#+`4h+@  "2 7 +`#+` " D@?# @ `*`2  @#+`"D#+` 4 h+@  (2+Ȁ @  @#+`4h+` ?2 @#+`4h+@  $2 #+` 4 h+@   2#+` 2 d+`6 *   2a  @א ++*` ?(0 +*` P!# 0`€ +܀ "*` "H /f * ' > ѐ @   > 4`a``$ 2` $`4`$@$`$`$` H 0`"lH /f * ' > ѐ @ $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` #$` ``@ D ?`c *`2 @ '2%>  2  " <  >    >  ,,  <  @J 80c, D * 2`   @= h0V  (R# ` @ G$`\$`    @ D 2<l4 #?4c 2  H /f * ' > ѐ @J  > 4`a``$ 2` $`4`$@$`$`$` H 0`"lH /f * ' > ѐ @! $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` ޔ(`  $"`$`@$`+ހ =?c * 2  >@  > 2`*  @ 0 D#`< <@    <@A@ > @ l$`@$` 08 *  @@=?@9?c * 2   > 2`*  @R!0k$`$` O K  G #``  @ D )l`@@$l0u?c 2*     2`* >  ʔ $`#$`  `@ . (h $h0 , @)8 % 2$+` @B+`, @F?  > !X@ @@l ($l ?@B,@C9?+ހ 2 <@K < @f +܀ "`@@t0@ 0 T`2 T2 R t" t p" p㿘> !,*#ܒ"@ @=*` 0 Td%H /f * ' #<@  @ H 0> !@w 㿈# 0`€ * `2  @ ?a# 2 + b. t  + @ 0]`[ * 2` ?  ㄀B?,#c   +Ѐ$`5@  @ `*`2 @+` + 8p@ @2 *`@ 8p@7<@8 7@? $@ˢ`# # #@ @ &`x㿘+ؠ???## +` + @ `*`2@ @ 0 @ א#??2+   > !@  <#+`  +`6?#2 .@2#+`+`6?#2 .@2#+` +`6?#2 / @2+` +?#@2 .`@a"c?#c2?# +@  +  `0`  2 +  `0` '  @  * 2` @ 4h 2@  1 ??2+ 6   > !Ȓ @ <㿐#` +Ѐ 5 ## c?? @   @  6+> "@ 0`&+ ?c #< (777€㿘#`#++  * Р ++#*@ 㿐#`?` @@#< `(  < `# 77# @` !@ 2ذ ` @ 8 2а +@  #+` 8p@?# @ `*`2  @#+` 8p@$  #`8p?# @ `*`2  @#`8p`@  6@6``#` 8 p*?2` + 2`?@+ހ  "`@ $]6`#`X? @"`  @<*@F 0I@BD@D `?# @ `*`2 @`>" *` €         ?#  *`2 @a?# @ `*`2 @ 4` !*  2 !4 4  4`4  h`?` * 2`  "ܐ  777c ?` ఐ .<`"fc<ీ"U``77` @ `*`2 @` I>"H*` €          0* `( 77` !*  $2 +    #8   ? #+ހ "`?`?# @ `*`2 @7$ 7 < `# 77`-7 `*  *2`# ` Ȧ̐@ &   7Ȑ|$7ʒ `€ 8```[ ` @X 8 Q #+` 8 p+`@?# @2 *`@2#+`8p+` `?# @2 *`@(2@`#` 8 p*?2`+  2 # @`!!@   㿘68>       @"^ #`+* +`6?#@2 .`@2#`+, +` a?#2 .@a"?2c#, 70+`+ @  * 2`  `0 @ `C 2+` < 㿘 8  #` 8 p7 ? + ?6 㿘n 6 2 #` 6 l7 + 3 #+` 6 l+`  "42#+`6l+`6 V"x31 6 "+M @  #+` 6l?c * 2` 4 #+` 6l@"4@ #`6l?c * 2` x #`6l"x@r 㿘#@  @ >  "8@it a"?c#+` + 0`@  ( 0`@  `R 2+`6+K <`#+` " D@?# @ `*`2  @#+`"D&#+ `4`h+@  (2 o 6 4 :  $ + 6l2@2+ 0 d@ 0<` 177  T@ #`€02 T"5 T"  ,*  @ @  Ɣ `   @R dc,  7㿘`?  0@ 0@"` @"W@4@ ^ 06@"`@"`. @"`  @o@"\`  @@ 0@"X`ఐ-@"` C%@*@"` @@R 0@" ౐@%@"` @〢@"` ` `@ < "(8 0` @  `*`2+0@ `  *2+&  * 2` 6+ * 2` 6+` * 2` 6+` 2`*  6+++@  * 2` 6+` 2`*"͒ 2`* " 2`*# @j`z * 2` r6+` * 2` i6+` * 2` `6+ * 2` X6+ * 2` P6+ * 2` H6+` * 2 c4=& ` * 2 c02& ` * 2 c<'& c@ } D0   * 2` `? #8&#8 & *`2@ > "`@Z  h> "l  H o&*@g@Ѐ  0H 0l @Ֆ  0H 00\!@t A a2@a1@ @,bl  !@4ꀦ@ 2a @qa@ )aҀ@bl a@ua@G a@bblaـ@ذ  !耦@۰  0a׀@aҀ@0@ 0!@@뀦@ް a5@a@ 逤a@ a怦@ebla؀@"sذ a瀦@ Ӏ0!逦@0 !6@ ƀ0!ր@ `T 5`T ` #@@sҀ%8 `\ 2%`\`T ;P`T PԀ!Pހ 2<  !777#  Ԁ!ހ < 77#7`€U`T#@U`T @"U`T@ U`T [$@y@ 4P`T @K 4G @ٖ@ @$@$є$ 4". !8@ "D 4 ?a!7@0c#〢@@@W#@BR## T +N4@ @w DE#@֔ D= 4?# @ `*`2 @04#4` @ * &4#8  @ `*`2@  44!#` " `t * 4#`€8$@p   @^$@#$A$  ?`-_+ ` !7"+4 `~#K`% G+  ``C@`=k#`〢.c#@kec * 2` 4\ #` #<@  @ J#`€@#`:0S+ 2 ?@-Ѐ .-@Ѐ @'@%Ѐ  %@CЀ C@Ѐ(@+`  #`€ 5 `T€   @$@k$$ 쀤`T @#` @ ^ ܀Y$bl@ Ҁ  @~$@C$a$ Ā@ ϒ`T  " `4  @`$@%$<!A"44#`€  ?c  * 2   @@ !@ !  2 *@  !|@6 x  @$ !  ! l f)"  "@& \@ ʐ Ƞ  ?@ɒ &4 < `77 "*`7 "#`T`8@2bl@ ,@ &@ "bl@ے @ ޒ@ @̒ @ @ ;bl@    @$@m$<4?# @ `2 *`@4 〤`T #@؀ @$@J$<"44#`€ 2° ?# @ `*`2 @6  @e$@*$<!B"44#`€ 2  . . . . . .@O ހ `T  2#` #<@  @  @"$@$< c  4444#`€ ["">a@$!> !,@w Ѐd* !,@p * @˻!,> * "*!@ 5bl@ / ހ $  @ِ$@$"<4!4#`"  t*  4 2#`€ 2    >?# u&@q |  4`  4` `4` 4` 4` 4`  2* 4`>4`@  2,`R,`S   2* ,`  2`*  4`\  @ `2 *`@4`^ <   7 n      ,`t,`B 2 2 ```C `B + `B` `,`B 2 `B ,`x@  2 `x ,`x@0 | ` &@* "@`|@ `` | @& `2x`m@ْ j g6Ѐ(a  @$@Ԓ$<C"44#`€ 2L ?c * 2` 4 ?$  ;6bl@ 6ހ 21 VЀ(,* #4 $ $ < C477 ?# @ `2 *`@7 `€ @ @k @f H 0㻐!" `c(&#`"$ +Ѐ$2  #<"77€ 2  2  > a,"@ * @<0 " > @蓐"!"@&X+Ю 0 P'H /f4T* 'T @ @c +!?# @ `2*`@ #<777€7+ޒ 7ڐ 2`*  77+<  2`*   777+<  2`*  `777+<`  2`*  777+<  2`*  777+<  2`*   777+<  2`*  ` 77+Ѐh#4 < C @ `2 *`@777€+Ѐ @ +<`-  2`*  777€+Ѐ <+  2`*  777€#bh  ?@H &<* 4 b7j7l  n7h € "'#+ހ`"  +ꀢ `# @ ?@  &<`4 * 7B F7@z7D €!+#c  &@ ?< 4 * 7c7 \7#+?#  2 c*< 777`€#b  ?@В &< 4 *7 bΐ 7)7 € @<`77 "(    €+ހ`T!< !777`€#< 777`€ت+Ѐ e%0 !?# @# `2*`<@   777€7Ȑ< < @ `*`4 `@77 ȟ€@<`B6  #6   € , 'c!4 +!777 €+?# @ ` 2 *`@<  *777€#c + `@ ` &: > "@g &+ &: > "@Y +Ѐ@ &+̐@O  `@xH 0> !,T*@ #ܒ"@ 5T@֓*`x>  @!"ب'  "@B"Ԓ`& &  & " " ?>?c #@& @ "< 2`D2`* / //?c 2` ,   〤   ئ@.@ .`.` ?* .``> "@ 4  *   @ @8@4 4 4 .`.`.` .@@  @ > @t#p>  @'b?  @:``D`2 @* // /?c 2` ,   〤 `  ؒ@=@\ @?> "@ 4  *  @  @E  @8@4  `4  `4  `"   > #\#@E ? @ > @#`PЀ X  T$T!8 ? ! 26!( H  & &!% !?&! <@ D(7Ȁ % @ F 2`  T!2`  @T> @#x@/!8 € ֨@Ϣ Ҩ` h h   5@!"݀@2 ۔ ހ  ( 77Ȑ(Δ `ɔ #0`2# "`0`8`( 77Ȑ(   ` ސ   *?b#777 ?7` 77# @7b #@ <b8  @0!#  D @ ` @ . < @ʐ @. T d6 R6 T#@!  @ > #@ܒP+Ѐ < `@l D+̐Δ ?# @ `!#2 *`@(777 @ D`@ <@!  @ >   @㜐# 㿘@D+Ѐ #@` 0E # +` @  T4 R {4 T㿘>  @r #@ t & t㿘 @"+ɐ+Ѐ` # &+> " @ɒ 㿘@@ #<!  77€?# @> `2 #*`@ < ! #쀢@"   " @2 `#&쀊 # > &(# &)# '@뚒 #<! 77€?#  @  `*3 *2 *`3` @ 777@t # 77`€? @ ` 2 +`@  2`+  ( * ("@* *`@ *`*  2*  #777`R& #v"2I@0 &<a$ 77€ 8O @3K .0K -,K (K K*`KА Б* +`K" " (* *?А  *** +  *@  *`K ?А &&#  >  @ @D0' >  >  ## c#\#`@#dc@뮐@y d#h d@먐#l>  h@㿘+?`#`  @>"t*` €        ? ` ``" ` `"   +ꀢ " `@ 4`@ * @++@  @k6+6+  㿘+ +ހb+ +#`2` +6+ ?c "  O "+ F " +A  6+ 6+ 6+ހ  6+ 6+1 +  ``>"*` €      6+ "++ހ +耣+ꀣ@#@+`@а $ d㻐 2+ &`f&` 2:+<!D &`"77#`€ , ?# @ `*`2 @`"```  &` `  &`` &`  &`` &`` &` &` &`+ހ   < <!C"77#`€ ?# @ `*`2 @` &`㻐+Ъ  ?  c@ ݔ D?#  `   f-   * 2` 5   < #5` 5@#`€ 2U 2O?# @ `2 *` @<  77 7#`€ 23ߒ 2-?# @ `2 *`@ < 7 7#`€ 2 "   "  #@ 㿘+А@`3 0<&` > l`&`@! ?`c     ,  ` @ `*`2@  " `  㿘`6+` 6+#@ +"`+ "`㿘`2 `+@ O  2++*@&+   &+`"6 !#N2` @ 20`2- "V`    ?"@ *`:`!#*`2` 1 >@ "   "V>  @߬  㿘# >@ 0 @ "+.`#+`  @?# @2 *` @#+`  @` *`:`?" 6`+@ &`&` 㿘  .d    2` >ć*`2H"2B"2<"26"2?c 0(2 0(2  (2` I2b2?#(020b2"?(0*2b2?#(02bb2?#(02b (2 2  㿘`  ` >#*` €T""z6`?# @2 *`r@E"B"?"`?`#   2 3 ** bb 6 b6 N6 `?# @ `2 *`@*"6 "6 "6 "6 "6 "6"6"6""6"6.6" )6`?# @ `2 *`@ 6 6  `?`#   2 *b *3 b 6 6   2#`*``8*`2`@ 㿘@ @    ?@"@&@@$@㿘**`` &㿈!>  @' ` / ` * ` * ` *   Җ  @ > @ Ё㿘 # >  @ʔ@d"+ހ  4!&$ " p!"? x$" >a$@K㿘  %@> @ݥ!%8@<  6`~ "(` ~ `~ ?#2 *`@V6 㿘  '@Ӑ> @v! '8@  06!?#~l "( ~g ~c * 4 V6| 㿘 `> !@@G̀ D4̑H /f * ' @ "$'> @  `@( @ @ @ `$$+Ѐ > "h b   2?H 0㿘H /f * '  }  @w?;c#c 0 Q P$  0   @*> @͐!   4 ` "`$ "  @4 $$ "@$ > a,4@I.",  @> @ܝ!    4 ` "`$ "  @4 $$ "@$@X  @2 0  @@ H 0㿘 @H /f * ' ` "`$  "@ 6  &" $ $& "Ѐ  > a,"@を @ΐH 0㿘  4?Ϣc @ < *`a  **2 ` "`$` "@ `"  "`   "@ @ "@ @ aА?$aЁ㿘```   @k q D @  L @z D,`!ԓ;` ,`  g `;`*  `2@ `g;`* ` ?* `@ 0 6 4& & "$ `&  "` "& & !В$!А| >c@5> ",@3㿘` q`` @  *   " ` `  `` @  `?    'L  'P 7@ֶ`> @Y!0/?#  @ `*`2  @*2  ?'L'P`P` L@֓> "@4x  P`  x   "( -> ̀ ` Ѐ'  > @"@H /f * ' H 0> ڶ`{ ~m,@-`2   "+b + e``c ` 4 "(` ` W`  'P @  `  @  $@`"( `  @6@"@x$   > x"`@ڟ|2  `@`' ` @ `   "( `x   @`` @@4$@ > "@t2`` "( `   > "@e%8@ ,6!?# {[  {W  {S  @V2`. 6* 4 'L2L,`'L2`L 'Lx $  $&RX>  @ ''L'P* ?# @ ``*`2 @  'LP'PL` 'L'P Ϙ ! / Ř >   !@B`> @"!"2  "@ƒ ` ">  #@̔>  6    = >  , :, </"(     " : " : " :  < `, : , < : < `, :, <, < , :& : < @, ;`, :?  > @s#0B  4 6  :> #X#0 "      &>  # 2   > #@I   4 " > @=  > ڐ 4 ⸠ ,| @ϐ >  (@*!"8@ "V6'L#?cz  z  zL2`/` 2L.``'L2`L * 4`'L2L+'L &>  @ > @ P㿘`P    @1> @Ԑ `0㿘`6 2 ` @> @غ 0 ?3 0# 2`㿘 ?`,# @ `*`2> @ @؝ ` l 2k @> @ؕ ` @2` ` P"=>  "+>  0   > I`$ @'> C`"4>  & )> 8`- 0> 2`> @f A`@b =`@^!9`> @Y!4`@U! 0`@Q!0,`> @L!@'`@H!P#`@D!``> @?!x`@;!`?# @> 2`!@1 ` ` `2 *`@>  !@& ` ` , `< BđH /` * ! `?# @2` ``P( `` "!`0`"0`` `"0˔ 0   0  0 H 0@"㿘E "    > " ,{P @e0 㿘 @ .1 H / * !  ` > "`{(,@=`;> "( .H 0  H 0 㿘`?c * 2` !@ 0`T T@ΐ`> !@p0K` "(@    `"( `? `T 3@ҭ > @P!0+H /` * ! ` "`T > `T  @Ҍ> @/"} H 0@!ِY a,z"@`?# @ `*`2 @48H 0`  ,` 8  沐 @"V  / "6aa@a `@!$a ` $`b"&` $`&a 2" $`a$a`T d$a`@`? > > "l`@   ' @  0!Հ@ ` !Ӏ@ "| !Ҁ@F> 0!׀@ 0!ր@> 0 @z `@PvQ  zH /f * '  2    Ȕ     GH 0Q`@Pv  HH /f * '  2  7X 4 7V 67\ 87Z :v/^H 0 `@@ `@Pu  H /f * '  " а H 0`@'  H 0`@ X4 > ⸠ y},@H 0`@@ʒ `@<u  `@> ` ?@4̐<'<J  u `@Ф '`H /f4* ' & h  "@ v  47F  7H 67L 87J :d/Nuh@   h@H 0 z`@ uNr &H /f4* ' W  | Sp@  |  ' "(7"*7",7+777 47 82 // 6/7 :   // :   / , :   / , :   / ,@t |  & ||@H 0`@@"H `@ > @Ԑ"x㿘@  Xv  >>>?&% b""&!&!&!(6 & & 0!H &!H  0& @@^"` 8&"`"` @!  @ @" #> @ @@@" > @ " >     &"d&"h &"d &"h &"d&"h"`@&"@ !> @Ԯ"d> "h @Ԩ"> >"  @ &"P> @ ""d *&""h *`&"*  * &"&"&"|㿘H o*@ g@ H 0h ! 77!!+`!*!+ !@ !  77ސ 0@C7"\&"l"&"x@"d3`7&"tw[&"p?* "\@""h 3`7wP7?* "7"| "d 6"h  ", "\"@"3`: /7Ԑ7/7֒П "d f"h  0", "\"@"3` /ː7/77Βȟ "h f㿘"   㿘"   w d"$`""T@"T"  l"|"\  " , 2" 4  wِ d"   a" "€ !"?"€ !"  !B 6  @ ;6 @ 0"(> #(@Ӧ "(`@㿘 > ?"c'>  2HbH /f * ' V* 4@'  ""8@ <"`<<8"`8"($@6 $0,@4&0 6> ѐ @!H 0N@H /f * ' V* 4@':  ""8@ <"`<<8"`8"($@ $0,@4&0 6> ѐ @ԒH 02j ; <b" <㿐H /f * ' > Ѫ @%  > 4 a` $ 2` $ 4 $$ $ $ H 0 2 | @v 0w 0 $ $ $  '􀦠m> Ш! &ܑH /f * ' `@   4   `5 $ $$ 4 H 0 ˤ 쀦1H /f * ' > ѐ @ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ( ' $ 8 $ " $&@㿘%Q 2   &  l `&  @̔  0@t㿐"l; 2  > #P@  > #`@   &    > @ # ` & , "@*`  " :/77 "d " ",  "   " @&"l㿐T"p`@ ;:6  @> #@Β  @> #@Œ 0@h70L ",`"@@  &  >  #@ѥ  `&   & ``  "   &   & "h " "x?&"x"x  , " "  `"  0@m&"p"x "6 㿘"€  ?L "  "   @   & (  &  >  @D#'   >  @9  `&   $>  @, ( `&   """ A 㿘> `H @Ӕ  t`& t㿐 T $@ @ibt+> b,@b   `` Td6 Tbx@bt!8  @ !  !(€  ">$bt  & &!$ !?&! "2$bt < ",@d ,@b*`  #  6 R0 /77b b   Hbh " bx  $bx T$6 T$bt㿘H /f * '  0@*   H 00`a2@a1@5a @a@"TK 0!5@;0 !6@7 0@T 4T ` i@}@02@  2TUT ?'4T 2 @T0 @̆@ 4T @   "0 "4@ H 0㿘!㿘 T!'<6`6`6`6@! @<  @˸ 2 *2 @  *@ 6@ 2   T = 6 T T<"6 T6@6`6`6`㿐"X'p@㿐"X'pא㿐"X'@gx> #"P"T## @'2 #@ &#> t # ?`@ ." 4 @ ."& 4." H I.">>!Ԓ`>>l&"&"&"&"" ""?# ! $!&"`-&"#   ", , #\#`@$ #\#` @  *` ,@ `` pS  ,#`>ʐ"&#@ >  @?  " * @"*`  &"@ > @ ȁ h> "T # "ؐ#@!"P #'&" s$#,s  !,s# `' !2]&" `X ",  `/>  s  d  c   , ,  H,, @, #\#``@;#\#`@ `@  " I,, , #\#``@#\#`@`@ 2&"   ,&"@ > @n ؁㿐` ""T @#> ((( ( (>(  (#` d`e` " @? ` +@@`2` 0S /`D/` "=@`0  /  3@   /   2  3@  / ׀> @̱ "@> @̬!`2`  / @3@` @``>  a(@ @㿐.`2 @@ P T$@,`4 #\#`@.&. 6 #\#`@ @㿐# ? "P@ ##\"T#`@#?# @ `*`2 @6 \ "*@ 2 *` 2 *` *`; *` ` *@ 2  3@`0 ?  +@`` "\*@ @*`*` 2*` *`;`*`   *@  d2 2 0  *  `@?㿘@㿘#    "T *`qz"T *`qu?<"T"T* 㿘>> a8>" 8!x&"D&"H>>&",&"LԖ @淐Ԑ???@Z "4   " @毖 @Β "0@˒ 㿘"?@?㿘@E" 㿘@i""<&`"@&`㿘@5"㿘@l""T "T `@(㿘# > !t> !Xq㿘# > !t> !Xqݐ#"@0"T(㿘>>"c>" 8#8&"D&"H>>&",&"LԖ@3 ???@ؚ "4   " @- @L "0@I 㿘"?@h?㿘@Ð" 㿘@""<&`"@&`㿘@"㿘@"##(㿘> aq㿘> aqm㿘`M   : ,@Ӹ 4: ;?> 3`+  +`@ b * 2`*` B *2 *  `C + 3` ; 2`*  *`oŒ :@ `B :  2@  B * 2`@ , ?㿘 >  . c @ 6 > #>b  # `@ 0 2` @XJ   @XD  8 @@ʐ <@Ȑ T@Ɛ l 㿘 H /e`* &` ` @"(  ` (Ȁ @&(ȑH 0㿘>   ` A * @`;H /e4`8* &`8  @$`8H 0 p>>#ؒ`$ $ Ѐ $ l$ p@%#  c$ $ $ `  $ ` @  $ `   $ > "%$ $ $ H /e * &  ,` @G@H`l@  ``cd`$`$`$`$` @ ` . .... `. `. ` # ` $ ? ` `` .` d.o. d.o)  d ` ".0   ``,` ,` ` .,`. `  ,` 2  p`2 p @" p p $ p ?$ p`h H /e * & ` ` p   H 0M <,`. ` 7H 0> > "$ p` !@ " ` p $ p `` @fH 00 ` 2 p  @ p > H 0 h>  *` €㿘> " . @  4 8 h> `* `@€H /e4 p* & p"   > ڐ . ,`, <@*` p@ p l @$ p. H 0@U 㿘   8.  , , `   d 2 d. ,  d, n2 n/ d ,      0  ,  , , , 0,   * (㿘> " . @> 8 h*` 㿘> " . @> 8 h *` > * 8 @ 㿘> " . >  8` h`* @ @ 6@|  ]@ "h `y@"/ `x@- 0`z@`{@ 0 k@ -  j@0\@V 0sl@m@ 0k  @ , ,`c   ,  @, ,`R  *@, ,`J *   `` 2`@ 2` 2a D 2` ` 2`/&` ` `2 `2 `2  &@   2  @ 2 2 2 2 ,  㿘l> b * `(  & `$`"``(@ `  # `@!   "# ```` `2` , , ,  `$@@ %, p +>  `$ H!a@  ??$ p 2 `,,= ,,  , , , "` 2 `$`,`$d ! ,0$  ,`,`@@   2    , , @-0), `$$`($`$   @  > h`* `@€  *@, ,@ P l> >  @ b'*  H /e * & pH 2M  4I  @@"V "@ V  H 4 p & p@ H H "1 @  p & p 2  , ,`  H @   @ ,@ & @ 0 H @  H,@H 0@  , ,`H 0@ > @!H4 p( p" pH 㿐H /e4 * & &  & & H 0  > " > "(`2> > " "(#\> a@T 㿘 r l  @m l 8H /e4 * &    H 0 U l "$&  $#& & & p 2 H 0 < l@@    . *`H 0 '> > "`   "    `& ` & > !,*"@  T@ɓ*`   h @ * €@*  l@ 㿘 8   / 2  *,   `& `& > !,*"@  T@*`0 ,   @ࠀ@ . -  &  @ 1@ ` ` ` `@ .  2  h> `* `@€    *@. -    @ࠀ@ > h  *` € p  ?$p `$> @ H> h  *` €   H ` @ `H 㿘H /e * & `  'jo ` ?.@`  'j` ` ?H 0㿘H/ / .`.@: .` .`.`.` .``H 08L`t㿘 . ,   , , ,  , j d   2  "     .  . . . .  2 `,  `   ,  `2  .   `,  !,  2  ".  , ,  2  ,   Z,   `, `2  Z .  `B*`>  €> @ŷ"0< > @Ų"@7 > @ŭ"X2 > @Ũ"p-  2  &  > "> @ř"  2  &  > "@Ō `. > @Ņ"  @`. & > @#     . &  ,   T, . >b,, @>` <@> lb@(  &(ȁ㿘 L ,` ,` ,@,`,` ,` `  ',` ,@ ``  'Р'iB  `  ? i4 d `  'Р'i,  `  ? "  @@`  > #0 @& 㿘> ! > ;b > @#X0N#> (>    @`  ` `(@ 2  > ("$a%!0"aؒc@   )> (  > ;  " 0> ;!"$%!ܐ @z #> ( $a> @Ļ#0@U!a"! "" > ("@"> ("!#!؁? 0   ` > (؀   㿘#`aܒ `  > (@  !> (!aܘ@ " !a"  " @8 @ ` > (> (ܚ   ` ј ` aܰ ]^^^^n`nnnnnnnxnz@zXzx{{ L`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @H  &` &`&` &@`6$ $$@  㿘  @G &   "  20   " "  ``X"\2 XP<T"T\"< \T 2"\`P"T`P XX "`XXP2 T P""`P"X  "\"\PT"PT XX XXP2"T"P"> T" P\2P \"\"\3 2"\`T"P`T XX "`XXP2 T P""`T"X  "\"\TP"TP XX XXP2"T"P" P"X`X"\"X \ݘ  2l\`T\2P \"`\`TP"`TP X`X X`XP@2"T"P" P"`X`TP\ TTn\"k \\2`\2"\ \PT PT XX "XXP2"T"P""T X`T`\ \"`\T2 \`TP"`TP X`X X`XP@2"T"P"m P \"`\`PT"`PT X`X X`XP@2"T"P" T"`X`PP\T" \\ \ AX"T\2`\T2"\ \TP TP XX "XXP2"T"P""P X`P`\ \"`\P2 \`PT"`PT X`X X`XP@2"T"P" T"`X "\2`P2"\㿘`P2`T@`T =P "T P 2TX\"X "& P 2# T# PX" `P"P`T"T`X"X`\"\`X`"&`P2"`T"`P`P" X`T 2" X   X 2 X``X`\"X "& P2# T# P` 㿘@   @F  P T&`\&`X&`T &`P`6$ T$ P$@  㿘  @E  P T  T"  X P P P2 P0 P  X" XT" X `PT`h"l2 h`<d"dl"< ld 2"l``"d`` hh "`hh`2 d `""``"h  "l"l`d"`d hh hh`2"d"`"> d" `l2` l"l"l3 2"l`d"``d hh "`hh`2 d `""`d"h  "l"ld`"d` hh hh`2"d"`" `"h`h"l"h lݘ  2ll`dl2` l"`l`d`"`d` h`h h`h`@2"d"`" `"`h`d`l ddnl"k ll2`l2"l l`d `d hh "hh`2"d"`""d h`d`l l"`ld2 l`d`"`d` h`h h`h`@2"d"`"m ` l"`l``d"``d h`h h`h`@2"d"`" d"`h```ld" ll l Ah"dl2`ld2"l ld` d` hh "hh`2"d"`""` h```l l"`l`2 l``d"``d h`h h`h`@2"d"`" d"`h "l2``2"l㿘``2`d@`d =` "d ` 2dhl"h "& ` 2# d# `h" ``"``d"d`h"h`l"l`h`"&``2"`d"````" h`d 2" h   h 2 h``h`l"h "& `2# d# `` 㿘@   @D'  ` d&`l&`h&`d &```6$ d$ `$@  㿘  @D  ` d  d"  h ` ` `2 `0 `  h" hd" h ``d`x"|2 xp<t"t|"< |t 2"|`p"t`p xx "`xxp2 t p""`p"x  "|"|pt"pt xx xxp2"t"p"> t" p|2p |"|"|3 2"|`t"p`t xx "`xxp2 t p""`t"x  "|"|tp"tp xx xxp2"t"p" p"x`x"|"x |ݘ  2l|`t|2p |"`|`tp"`tp x`x x`xp@2"t"p" p"`x`tp| ttn|"k ||2`|2"| |pt pt xx "xxp2"t"p""t x`t`| |"`|t2 |`tp"`tp x`x x`xp@2"t"p"m p |"`|`pt"`pt x`x x`xp@2"t"p" t"`x`pp|t" || | Ax"t|2`|t2"| |tp tp xx "xxp2"t"p""p x`p`| |"`|p2 |`pt"`pt x`x x`xp@2"t"p" t"`x "|2`p2"|㿘`p2`t@`t =p "t p 2tx|"x "& p 2# t# px" `p"p`t"t`x"x`|"|`x`"&`p2"`t"`p`p" x`t 2" x   x 2 x``x`|"x "& p2# t# p` 㿘@   @BJ  p t&`|&`x&`t &`p`6$ t$ p$@  㿘  @B(  p t  t"  x p p p2 p0 p  x" xt" x `pt`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @@.  &` &`&` &@`6$ $$@  㿘  @@  &   "  20   " "  ``"2 <""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @=   &`&`&` &``6$ $ $@  㿘  @=ϒ     "     2 0   " "  ` "@0 @ ""`" `" ` " 㿘> ``> B:`%"㿘> `B :> 0  > b  ƒ > b  " 0@#㿘> ``B :` `> 0-> #`+`^ # &```> #``   &```@#Ё*` ( > L(" "" " 㿘> !L  $@ @* & Y@ $&  & #&  @ x>  @ '  \ "\*`Ԑ ``""` \ >  `B :"` ѐ ` >  `B : 2  a>    !xB` : > @#  H@  ؐ@T  `H/ `H     /`` '/`''''>  ĒL@m` "ud`> B:`";?O H H `@E J  ` @2 J@2 J@2 J @" J &` @@<@8@4@ u` Ā *N**`ʐ 2!x`>  @,!x`> @% ( * N **@ > @ې 0>  @' 2/C b\ @2'am "''> ``> B:`Ȑ!p& 2ib b`> b > "@( &> `B : _?@o b `b* xb\`@2am " 0" 0  > T!Ѐ > "` > @ H @  > @ (> @p"*?> !L"`pb`* y`0`> b "b>   !pB`"!p: Ѐ`  X > ?`B : `@ > @4 h㿘&` C (> "`R> @_ > @\ `` @`H> @U `0` @`H> @N `D`4@`H`O > @D > @A (? U +> "`"> @2 > @/ `` @`H> @( `0` @`H> @! `D`4@`H`O > @ > @ ( `?@`@!> `  >  !`>@!|B:!`&`> "S  !x`> @` @``O`> @ > @ ( d.?> b&```&``""`  !l`B ; #!l@~[ `"\`2`O`I 2`O`O  .`O 2`O @ `O .`O 㿘> >  cp +>)> '> ,bd !0@ H /* ` ! l`@Z@ 耤@ @< @S H 0,㿘 N ?  @  > > > !8aH@Δ#(  > > > !8aH@Ĕ#* a a> #p! `> aa#p> !b!쀤 @ $ VȐ @ $!> !L0! 㿘> !'? ;>  )>  X`0 t!L@+2  0> @m"  0`"b?"b 0a 2 b 2@Pf Fa> pB$p<ؐ"@Œ` > @m"䀠"  I2 X "X\ \X X`> > d> L " t䀠""X X`> > d> L " t""p 2    H  D  #` #d!#\ Ĕ 4#x#t#h#l#p#|#@y  N    > "> b     O  @  . N㿘>  "@^"Z N "  > > > !8aH@#a?  "a b 2 @O  ̀`" a?  "a b 2 @O  Ȁ` a? "a @O @H̐ @|ݒ  `"  "`> ""  "@! "> @P>  4@> l`B "l:㿘??3 > b ' " `N  `> @l" "?u > aL 8 ?@"> @lw" s"?? $"`"> "`$"> @l"㿘`$ 2 @tl&` `?㿘 $   @t&  $  2" Ȁ2" ?" 㿘.`0]> ` 2` @!.`2``Q> @!0M     * ` 2 ` " "@ $      *  %> )>    2 @O  .@I"8 @D  倢6``> @9"㿘 I ">   "> >  :"> > @#" > @"  @"(  @"0  I@"8   Hq!> @ "@ 0  Hj#> @"@ D 4 Hc bH  @  ` >  "> > "p@ `> @" H  @  `  `> "p@ג `@Ր">  "@ 㿘  > @ǐ"@  > @"  > @"  > @"  > @"  > @"  @> @" @ > @" > @"ȁxؒ"? 6" !!@"d "d@ ؀" "a" `a0'"a "a@ ܀" "h" da0'"h "h@ " "i" ha0'"i "i@ 䀢"  ," la0' , ,@@g  耢"  (" pa0' ( (@ - -@ 쀢"  \" ta0' \ \@ 0@> 0  "  X" xa0' X X@ ] ]   " |a0'!0 2k! *`   `  `"  a0"  `*`㿘 $`$@2H `B> >#*` € ` @2:  `@25  `@20 @@2+  `@2&  `@2!  `@2  `@   ` H H  ` @ @ @"а  * ( (*`00*0?# 3   +  + 2 㿀c> `@ '@_ 6@ @0R  `*   2 66@ * / `*  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2w6@ > @"㿐 ?'L*  * @' * * * LL `2 `2.  `. . .L@?L @ * 2 B6@㿀!>  @'  -@* '2 * !2 * 2 * 2 *  2 *   2 * 2 6@ @ > @I#p\> ` d @o' k``@@*`` 6@/ @24 Җ 7@@4 @̖ ` 4@* @2 Ö 4@  `#U *   2 4 @ *  2 4@* 2 1  @*  2 *  2 *  ~2 *  x2 *  r2 *  l2 *  2 e4@(``@0@Ж U* 2 O 35Р G@ґ* A2 ԑ* ;2 ֑* 52 ؑ* /2 ڑ*  )2 ܑ*  #2 * 2 4@@ > @c#X > 2 , `@?Ȭ '  Z`#\  @( 2 @[ I `  0C`E?4 $;7 `@/` /`/`/`/`/`/`/ [#@ Đ " T .@.`.`.`.`.`.`.`ϲ` $ @$ 4 @ @`@ > @# p> /ex'L|7bl'P@*g'\j' 7f  `   0``( @  "> @ t b ` *`b 2` ! 6"`  > "  "`*` "@>  Ԓ $   $ $ @f$   " `   , L4$ P@$ L ,,,MPM (` c-`  $` ,` f\4@`4`$`$` 4`  ,`,`f`M   O> a @@4` @@ /*@@ $ ,> # e` 4`4> #,e,4     \ @0> h\  '//'MP ML  4` ؒ  @ >   (@C4`  @ `,,    @wO >  @ > @#8㿘沒 @u @а # ` *`! 6"`"  "`*` "@   0 ` @m  0`@L    `0&@@```` ` `  " ``@ `? ?/>„ԇ( ( %@     `? `? @  @ @  `?@ @ `? 㿘.`.. 2`2ė2㿘     㿘     㿘 @p   㿘 @d    @    @Ғ @# 2 be " be b@"  b@2 㿘&  Ð  42 6"  㿘 ? > @#Ha01&2 "'> *  &@b@"  &  bt " & a$? &  & && a$h&@@."* @&㿘."> * b0 ** `" "  & dh&@dx@&0? & 2'&@a0& "  " 0$@*#@@*#@`*#``*#` `  *#`  ```" 0 "  " "  "" " "  '"/@0@ " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "@` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"@`` @" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"```@" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"`@ @` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "` > a8 @ @`''XP'\am L Jp /ؒ~b\ @am "''>  ``> B:`Ȓ`!В -'@ ` "( 2@`$ 2 @`( 2@`, "@` M !x`N> @#p i> @#= `$ 6 ,   "` . 5`  X`4 5  (  `  \`4 5    `( 8'\ 'X ` 5  " 5 ?X 5 `>#*` €\ @\X" @ H    @  =  9 5 ! #\X \@uX$(`?\@mX$$`?\@eX$ @?\@]$\Xݘ@\X   \Xu@ $``    `H,\X@k; < \ X; 0 (`$$ $  ?$, , \?$, ,H\X@k  2 (D 'X '\73   "       z@   > "` 5  > @Ő# & > @ ( `@ > @z# \> `'l@''f'Lj'P'T@= LP>    2 2@ < #԰'T//` 7䀦``7В  , -`4 7А  KLt 42`  7В ؔ =L d2@@,,-2`4 @$@ * 2`@7А   *`2  ?*` 47А  ?*`2  L am `'>Ð *` €LP 2   @wT@rT@mT@hT >  @ > @#ȁ㿀h> -b@"* `@? ^'L`7f''?'`' b`     a@ `0  0p`C @q:p d 2 a`'耢 "d' h`"  Z@"hv' i`" $ [@" $lk'耢    Z@!U 2S  $    Z@!H 2F  $ 2 $ Z@! ";  $ 2 $ @hQ Z "0  $ 2 $ @r Z "%  $ 2" , Z  `" ,`             8 2 ,  ,耤   - *` (2 *  `耤   ` '耤`Y `$    Z@ ؔ 2F  `$   Z@! ";  `$ 2 `$` @g Z "0  `$ 2 `$` @q Z "%  `$ 2" `, Z` `" `,` `   `  `   `Ȗ 2 `,  `, x'耤P` $   Z@  u $ 2 $ Z@ Ŕ j $ 2 $ @g Z _ $ 2 $ @qQ Z T $  ` Z ```      ` `o 1` `-  .`*`(Η2  |7'b@  L !`" [ L @i$@j: !0'b> 2'a 6a   耢  M 耢` `"J b` L 2 `"  b`    㿀h\ `dlp* 2 *` 2`#h#\#`#d  *#\#d#`#h * 2 *` 2`#h#\#`#d  #h#\#d#`Ԛ "`?`>Ð *` €#\#`!h-#d!j [ Z3`#h#lܔ > "`> !j#@!h} $x!@ `$ 2 Z Z  " ` 0k` `X f` `\ _`8#Ҕ`0W $ 2 Z Z  " 0L `X G`` 0A`\ =`8`( 07 01 Z՘ 2( !m  2 !j!@ Z!j-!h X2" "@`!h?c 8" 5!h 250 㿐`\`[?#&`&` &`" `Z?`K> #D>   `@`D `D`@`Z  *:?@*'*2`'2@aИ 2 @'@bs 2 *2@b 2 @@b 2@ ? `&`@`&`@`&` H> . @6' #\  @  Ā$ @   " ` `` 8  ` (  @& @ > @ @>  > `@. 6' 7#\ @Ϛ  Ā$       D.   (  & @ > @ߐ X>  > ` @``'` `0+ؐ@ * /"@-}  @. -,`@ *   / "  " " " @-c  (,`<  ^$@?* 2  * 8 Ր?"8,`.2 2`@8 @ * @ > @{ (㿘 & "p  H  0    И E !@`@& @`? @ D 'H'L Zl'Pd'7''''@(.'耢 ? '>   8 B: 8> "L@$'#\ ,#`#d #h#p7P#l r :'Ƞ  디#` P#7#\ ,#`#d #h#pP#l P 'Ƞ  r#` P#\ŖԐ ' bf`2'% <'̀ 5> pP`C @m :p d 2 a`' L d{' "h`  @"iho'i  lf' `$    @Ĕ 2U  $` P@ 2G  $ @ ; `$ 2 ` @c 0 `$ 2 ` @m % `$ 2# ` "2` 2 ` 2`   `   `," `-`p' " `*`(  t' `T    @P 2I  T  0@ < `T 2 `P @cX 1 `T 2 `P @m! & `T 2$ `@ "2`D 2 `H 2`L  `@ `0=   `\" `]`x'  `Z`X  |' r` \ "z0\ 2 0 m l " L0s'  2L%H LDs  ; "X` 2Lܒ%T XPq  &",` @,@7b@  L쀢 !`@d@e !0"'> 2' 6' &&@h" "c`20'    Ę d@h'''7`B > b Ԁ`"& bf "" bb Ԁ  @#L ̢ bb   #`#\P#d@p̒ b` hb\ c` L   P.3`#\#`.3`#\#`Ø Ԑ '"\` ) &` T@2  #\#`#d#h#lq H#pP#t D#| @##x``8*   2 9ϖ ` ":*  2  ";  "``2 Ld 쀢   ( B: (7 "g`2  `2  X B 2` *`&@'؀"  x`B :x ``B :`E7b\  am ؔꅖ  h B/: h` > am L   m  e  h B: h>  4@ C!  ( B: (7؀`"`X 2`t 2> ܖ!К`> apؔB?#ap;`@"؀@i`˰ `X `t > y!К`> apB?#ap;`@" @& & &  " Ȁ`" a "a ̀`"a "a` bo. M bb . L bb @. L . IL. H` . J  2 46 0,`6 D  #&6   06    46 `6 D  6 0  6 0.`2 @ & &  2&  bg !> @6 " & ﮖ  '& !>   `&  2. `*  6  * @?: 6 "   &  . . !L !L6 &!& &!. N؀`& `X "`X  Ȑ 眔& `X "`X X  @4H   ( B: (N7 X 5 0Ԓ  #\#`#d@4ܚ !!x`> @( 8@4< ̀`" a?"a Ȁ`" a?"a a?"a> .`4@"\@ P> "隒 "%@4 X`B :X7 ̀`" a?"a Ȁ`" a?"a a?"a> 4@l H "@@<0  6!  V "g`QԐ `. L  P. 3`#\#`U0 . 3`#\#`K@&  R2* 2 * 2 6    #\ #`#d#h #l#t#p#x#|n# p`B :p7  @=  H`?@D'H Zl'X'7'''@# '耢 ?  '>   8 Bs: 8> "@''#\,#`#d  77#h#pX#lO <'Ġ `qP #\#`& 7#\,#`#d  #p7#hX#l* 'Ġ `LP #\#` 힖  f  '$<'Ȁ 3> p`C @g:p d 2 a`r' dj' "h`  `@" ih^' i  lU' `$    `@ 2U  $`   `@ 2G  $ @ؒ ` ; `$ 2 ` `@^ 0 `$ 2 ` `@hd % `$ 2# `` "2` 2 ` 2`   `   `," `-`p' " `*`(  t' `T    `@, 2I  T  0@q ` < `T 2 `P `@^4 1 `T 2 `P `@g & `T 2$ ``@ "2`D 2 `H 2`L  `@ `0   `\" `]`x'  `Z r`X  |x' r`" \ hb\ " bLa0i'  2Ԓ$H LDV , "X` 2$T XPT ",` @,@-b@  Lw쀢 !0'' 20> 2' 6' &d"h" "c`2d0' }    vdh'''7``B >` b `$ f   b `X @Ț bb `   ܔ#\#`#d@k "``2="\ 8 ` ֐P*#\3`#`   P* #\3`#` 뮘`  "8*  2  "9   ":*  2  ";ٖ  "``2Lm 쀢  ` ( B: (7 bg 2bP`b'a `x`B :x ``B :`E7b\  am ؔ婖 ` ` h B/: h> m  `咖  `劔 ` h B: h>  4@Ԓ C! ` ( B: (7؀`"`X 2`t 2> ׺!К``> apؔB?#ap;`@8"؀@t`߰ `X `t > ם!К``> apB?#ap;`@"ǰ @& & &  " Ȁ`" a "a ̀`"a "a bo. M bb . L b @. L . I. J . H ` W6 0 4Q  6 D I&6  B 06  ` 9  46 3 6 D+ 6 0 $ 6 0 . . > !L !L&!&!. N%؀`& `X "`X  Đ & `X "`X@"\@ > "N !` X B: X7Ɛ ̀`" a?"a Ȁ`" a?"a a?"a4@h H "@7  6!`X@M  8`?@D'H Zl''''7@'耢 ?'' '>   8 BR: 8 [  :> (" @/`7 ` /ǐ  >   /ϔ  *`  /ǀ7֐ '> "@D'֠,*`2 #p7#\#`#d#h#l 5 d W `"S "f,P  |2 3 @< "f`.  3'֒*2 ,#h#p7#`#\#d#l  "  `"  "fP,֖  "f`  ' "f 2'%<' Y'> p`C @c:p d 2 a`<' d4' "h`  @" ih(' i`"  [@l' `$    @] 2U  $`   @O 2G  $ @ ; `$ 2 ` @ZX 0 `$ 2 ` @d! % `$ 2# ` "2` 2 ` 2`   `>   `," `T`p'    @ 2I  T  0@= < `T 2 `P @Z 1 `T 2 `P @cɒ & `T $ `@ 2`D 2 `H 2`L  `@ `0   \ x^' j`ϐ @2O0 k`ǐ @2G0 r`" \ >b\ "b,a0?'  @,@-b@  Lk쀢 !0'' 20> 2' 6' &d"h" "c`2d0' q   쥘 dh'''7`B < b2  % "f ! "b @  bb   ܔ#\#`#d@g "``"Lo  쀢   ( B: (7U bg 2b Mb'a x`B :x ``B :`D7b\  am ؔז  h B.: h > !m    Ḕ  h B: h>  4@ C!  ( B: (7؀`"`X 2`t 2> !К`> apؔB?#ap;`@g"؀@q`ް `X `t > ̐!К`> apB?#ap;`@J"ư @& & &  " Ȁ`" a "a ̀`"a "a bo. M bb . L "b @. L [. I. J . H  ߆6 0 4߀  6 D x&6  q 06   h 46 b  6 D Z6 0 S 6 0> !L !L&!&!. NW؀`& `X "`X   8& `X "`X@"\@ > "ဒ " X B: X7 ̀`" a?"a Ȁ`" a?"a a?"a> 4@ H "@4  6! @}  X`?@D'H Zl'd'''@M'耢 ? '>   8 B: 8> "@#',#\#`#d#h#l#p  ? `޺ `,. fP",#\#`#d#h#l#p w  `ޙ `  fP,Z  fއ  f 2'$<'Ѐ H)> p`C @`.:p d 2 a`+' d#' "h`  `@" ih' i`"  [@l ' `$   @ `@ 2U  $`  `@@ה 2G  $ @@ ` ; `$ 2 ` `@V@ 0 `$ 2 ` `@`@ % `$ 2# `` "2` 2 ` 2`  @ Ɣ`   `," `T`p'   D `@ 2I  T  D0@Œ ` < `T 2 `P `@VD 1 `T 2 `P `@`QD & `T 2$ ``@ "2`D 2 `H 2`L  `@D m`0   `\" br`xM'" \ "a0b\ "b,a0>'  @+,@,b@  L쀢 !0&' 20> 2' 6' &&@h" "c`20'     > @h'@''7 `B = "b`Ѐ" f " b Ѐ`  `#`#\#d@dS b` ;b\ 6   ``` `0 P ` ``"8*  2  "9烖 ` ":*  2  ";t  "``"LU sԀ    ( B: (7 bg 2b? b'a  x`B :x ``B :`E7b\  am ؔD `   h B/: h> m  `-   %   h B: h>  4@o C!   ( B: (7؀`"`X 2`t 2> U!К `> apؔB?#ap;`@Ӑ"؀@t`ǰ `X `t > 8!К `> apB?#ap;`@" @& & &  " Ȁ`" a "a ̀`"a "a bo. M bb . L b @. L [. I. J. H `  4  ` ߔ 4۔ Ԕ  Δ . . > !L !L&!&!. Nѐ؀`& `X "`X   ۲& `X "`X@"\@ > " !  X B: X7r ̀`" a?"a Ȁ`" a?"a a?"a 4@  H "@@0  6! p> "@?`Z\'`''''I%> p`C @]:p d 2 a`,'耢 d$' "h`  @" ih' i`" `[@l ' `$   `@ @ ̔ 2T  $` 耦 `@@  2F  $ `@@  : `$ 2 ` @S`@ / `$ 2 ` @]`@ $ `$ 2" ` "耢2` 2 ` 2`   `@宔`   `,@" `T`p'耢   `D @ h 2H  T  `D0@ ; `T 2 `P @Sp`D 0 `T 2 `P @]9`D % `T # `@ 耢2`D 2 `H 2`L   `@`DV`0   \@ xP' r`" -`\ "A0 - * ] & m "h?#@ ,  @,@b@  `Lܖ !0' &$% "c`20' 耢   $耢 '''7`B < bb #` `#\ `#d@aK "`` `L婖?   ( B: (7  \> `  `Z`@'H'``'L'P'T/' /`@ Ӑ`D@7`7`@ Ɛ`D@7`7H`L  & ȆN H 2J bp ba 2J ba 2 J L 2 JH@ਤਦ 2DJH@ `  `@  ` @#\` #`#d#h#t#l `Z#p#x#|#`@ `D̀ l ` @f ` @` 䀢 "   *` ` H 4 4 JH@8 `  > ` @8 ` @2 ` * 0 `2@"` #\#d#`#h#p#l#t `Z#x#|#k   ` @  5> p`B :p5 ` * 0 `" `@`#\` #`#d#l#h#p#t#|#x# `Z`Dp`@ `#\ #`#d `Z#h#t#l#p#x#|#X " "``" "` "`` "`*** *  5> p`B :pְ   `  ` 2  ` ` '`X 2 " 2PT@%   5> (`B l:( "` 2`@"$`` "@`  `  '`T ` `!   ` P2 `ZQT , /`  2 *@  ?2    *@4 , ` 2   $ ,`  * &  /`* & $/` 2  8 4  ` `"@ ``߭ `ߨ  '`T ` ` `2  `  2   "   #` 2   PT՘  '  *" ?"%@A !ۑ* @ `   "`X 2  2 " #dP#\T#`@$ 2°  /`2 @ *4 $ 4$*  & $ `     , ` " `   , ` "% `    , `2 `  䀢`" `    5> h`B C:h2 `  , `  ,,> !L"a  (    *`N      *`N ` (    *`N ( *`N *`N ? ?  `?"% [A! U> "`> @ h^ ` > ` ;``#\``T@ 2 " #dPT#\#`@$ 2  /`2 @ *4 $ 4$*  & $ `     , `  ,, )>  %> `  ` ` @#\#d#`#h#l "qL #p`H#t#|# `Z#x`@ `D 4 $$Z5>  axU> @ D ` H`;`> !> !#h JH 2> > !! #l> #\ `T@@  1  *#  2 ?"%@ 3 A!ۓ*@  4 $ @  5   6 #\> !(@Ę  5P`B :P  H 2$@H(@ H,@H0@!H` `Z 0`P`#``@)#\ P ``P`#``D#\PT@F   PT@=  >  @ > @p1!X8\>  Z   `@/'`/ @ Ֆ DՒ@7`7 @ Չ DՅ@7`7䀦`  ՗&  N `| 2 bp ba 2  ba 2  2e  `J@````  2  *  >  + > !L"a      *`N   H 2   $@`  (@ `  ,@`  0@" `2  0  Z #\ P`#` @`   Z #\ P`#` DT`@|  @ > @oq!p8\>  [ @'D'`'T@': 0 @` `        *`    2 Z Z` [/` /a@LԪ D8Ԧ`7\ 7H@$ԟ DLԛ`747\`  ԯ& Ś `N `> ` bp ba  > ba  > ` 2 > !L #a* N  @` H 20$@`(@ `,@`0 ʀ`+ Z  "°  `  P,  0 2`l T2*0  "`T@׫   "  ` P,   2`C T2 2@׉~   `Tp   /ꀤ 5TT#\   @-  > "`> @!S ?@ `24@> `B :E   *  @/''d'#\ h ( @  > > "`' > @f!"  npT/?' 0뀢 3 < +" , 2/ *` 4@ `B < #\  @  !x  > @(!  3 *  * @/뀤뀤   +` :~%`#\  @   > "` > @! /a`/`ԐL' А8#`7\7HԐ$ АL`747\`  (& > `N :`2 `J` bp ba 2 `J ba 2 `J` 2h `J@````    `퀊 2  ` 䀢 "@ژ    >  *"@ <*>  !x`>  `"@u Z @> @n"0 Z D> @g"80> "H@a` 4@ P`B < P   `H 2```$@```(@ ```,@```0@& `2`0`#`P#d#\#l` #hВک  #`P#d#\#l` #hԒڙ   ꀢ  T@Д  @˖ T@Ŕ  (@h #\  @v  > "` > @ߐ"X /a`/`ԐL А8`7\7HԐ$ АL`747\`  & * `N &`2` ` bp ba 2 ` ba 2 ` ` T ` ` @` `H 2```$@```(@ ```,@```0@6`2`0`#`P#d#\#l` #hВ #`P#h#\#l#d` Ԓךꀢ  T@  @  T@  (@h #\  @  > "` > @!"ݰ /a`/`ԐLU А8Q`7\ 7HԐ$I АLE`7\74`  X& n `N j`2` ` bp ba 2 ` ba 2 ` `  ` ` @` `H 2```$@```(@ ```,@```0@z`2`0` #`P` #l#\#d#h, T #`P` #l#\#d#h T@^  @YH #\  @  > "`9 > @x"4 /a`/`ԐLЬ А8Ш`7\ 7HԐ$Р АLМ`7\74`  Я& Ś `N `2` ` bp ba 2 ` ba 2 ` `  ` ` @` `H 2```$@```(@ ```,@```0@р`2`0` #`P` #l#\#d#h؃ T #`P` #l#\#d#hs T@ӵ  (@Ӱh /` /aԐL А8`7\ 7HԐ$ АL `747\`  & 5 `N 1`2` ` bp ba 2 ` ba 2 ` ` _ ` ` @` `H 2```$@```(@ ```,@```0@A`#`P` #d#\#l#h   P` #d#\#l#h   ꀢ   > T@  @ T@  (h@  >  @ > @j"@>  @Z`['/ /@h Dd7 7@] DY77䀦`  m&  N ` 2 bp ba 2  ba 2  2o  `J@````  2  *  >  + > !L"a      *`N   H 2   $@`  (@ `  ,@`  0@, `Z    # @P  ֧@ @ Ӕ      @P  ֓D D ο   @ > @i="㿘_``)E * 2    277;  7`27@> `B (: @   !  @     *`  (   7` 7@> `B : @ѻp>  @'@ `` `  * /"*   / "  " " " "`@ @| Ѐ " "  <Р `8 ?"`8@y  `@ > @h#p>  @'@g `` `  * /"*   / "  " " " @@B @( Ѐ h " 8 ?"8@ > @hS# `>  @' '  ` >  2`L> @#8  ``* '9&bp` `沔 @Ŗ  2'ba @ `? (@' > "cؤ@ ܐ ,  /$ bp @<؀`2`X> Ւa`T "`T "`X4 ,`<*0a8  > "`> @#02 А  Ș ڵȀ 2$ a@ @     2$    `ǀ @Z "bp  > "`> @#X0 @ " ` 2@ɐ`0`  ` `@ "@n `  ?"` `@ " @n ` ?"` `\ 83` "`@ 2 >  `" x "x6 `@캓*`6  > a(a,  "a, > c`0 "`0` 9bp@> Ր! L`" Lbp= `\ @Dz &bp@gY -'  " ` @'2bp> Ւa`D "`Dbp 2&@؀`"@`8 ?"`8@bp@Ő @ > @f#X>  @' '  ` >  2`L> @~#  ``* &'bp` `沔 @]  'ba @ `? @' '|@} Ԑ ,` /$`$`  $`bp$ $``L   *  @M @a8  > "`> @ 02$ Р  T Ā  `Ȁ `̀ "a@`ؔ a@ @   ` Ԁ  ` ؀ ` ܀ ` ˿  ` ` F @a = "5bp '8 `> "`1> @b#0-`? ?  P4`  \ @h" bp " bp!`B:`bp    \@#: bp 2&@@bp@ > @e 8㿘      :  {   @ !  o*@f*``ca@  @]  "$ ]   @ N"@ & &  @  "@& &  ;@볒  '3@W* ,6   &    0% : 0 > a(` "`> c` "`> Ԓc` "`> "(`B :(  4` &  > >  `@>  !h#p''@`7N 'H'8'D:   ????????????-  '!x > @k HM   2I `X 2`H`L 2`H2 ऐ`!x`>  p@Q`(3 !". 2> @  @N x  @ ,   ` 7> ``B :7Nf ` ''Ѐ  Y ` ' `  // ` /`??'` HD#\#`@̘?7> `  x  8c8 #\ ' >qN  `"    ` H B: H7N7>2 "@* "@'䀢`" #\ @* 2``7>N#`#\8* `7>8 >> Ր"$HD#d#h#l#`#\@87>p #\ ' >N W rv  r`" P  2Y7>r  t"@ `  7> ``B :7N#\8* `j7>8 >> Ր"$HD#d#h#l#`#\@8̘|7>P #\ ' >N  >@ j N`"    N7> `H`B :HT7N#`#\8b* `7>8 D>> Ր"$HD#d#h#l#`#\@8q17>* `7>8 `O 2 `O @[! 8 `O *`O8'@'H L8 >> Ր"$HD#d#h#l#`#\@87>> %8 @  !8 "@ M @ "o`8 7> `@`B 7N:@x  > @ 8" >@!{>  @b2b 쀢 b " " ܒ * " #> 뀢  8  ̀  "`    ` ` *`8  @ ̀`"@ bb H@HD#d#\#`O @O > `    `  `@  B@ :> `    `     `B 8>@ "``> @`?(x`B :@@ B :Hx`B :H@ B :8P8̀x`B :8̖ሔ@ B :8 䀢H`B :88@ B :8 耢"8H`B :88@ B :8 J@ (`B :8@ B :8@ ̀`!#p  J   J @2 $ 2'' $ 2 T8  J@ "` `?#\ ,#``?@@ T >8  J@ "` `?#\ \#``?@@p P> @@& 7> bp 8>`@ > @aې > > `@ !h> @#p''``7f '\'P'X:   ????????????ҧ  '!x > @}    2}  X 2 H L 2 H2 ऐ !x`> !@}˒ (g !"`b 2`> @|0!@ '  7V  `B :7f   @ f  7V@@ `''Ԓ  Ӕ  /'/ > *  ( '?` $ /(@뀢 3- < +") , $A>9\X#\#``(* 2``f7V  `B < _7f#\  Ԛf  !x > @}?!h 7VJ  3 *  * /뀥뀢 c : PPp #\ ' Vf  |  *` (" ߘ  27V|#\2`*`"" ' @?* 2``7Vf#`#\P6* `7VP P> *!P\X#d#h#l#`#\`P47V #\ ' VKf [    *` ("   2]7V  `"@ `  7V  `B :7f#\P#* `n7VP P> *!P\X#d#h#l#`#\`P7Vh #\ ' Vf  V@ m f  *` (" :,   f7V  H`B :HT7f#`#\P* `7VP DP> *!P\X#d#h#l#`#\`P⣘17V* `7VP `O 2 `O @WS P `O *`OP'`'\ LP P> *!P\X#d#h#l#`#\`PC7VP V`!ӐV  `b쀢 b " " ܒ * " /V +뀢  %P ! ̀  "`  @ ` `  `  ` *`P  ` ̀`"` bb \`\X#d#\#`g @L  V `    `  @ @ B@ :V `   `    `B ;V` "``V ``?(x@ `B :`@ B  ;\x@ `B :\@ B  ;PWP̀x@ `B :P̖ሔ@ B  ;P 䀢H@ `B :P8@ B  ;P 耢H@ `B :P8@ B  ;P J@ (@ `B :P@ B  ;P` ̀`"> cp  J   J 2$ 2''$ 2TP  J` "` `?#\,#``?@< T VP  J` "` `?#\\#``?@<PV `@'@'@ 7V bp PDV>  @ > @^ ! @ 0`05  3? x `x.  0'` # ! ?`  ?`  ?`   ?`   ?  I `I\ H `HW"G ` K  I?4`4D 06`?  =?@`@8  6?`1  /?<`<*  (?`#  !?8`8  ? `   ?4`4  ?`D`D"  I `I\ H `HW"@GD4`4K  I? ` D 06`@?  =?,`,8  6?<`<1  /?(`(*  (?8`8#  !?$`$  ?4`4  ? `   ?D`D0`0" @8 2@ `8 @8?2  ` (  ?`   ? 㿘 h@}`h   ?`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @Ò &   "  20   " "  `㿐'> > #\ax   @l #> > #\ab 0  @k %> > #\aH 0  @k !> > #\a!    @k > > a#\ !  @k b@oc#cx @on  cH @oh 0! cP @ob > a"a" > a"a" 㿘> > aLT"%> 3> "` > > b@@v"8>  ""`@v@ ` > ! "  (> > > !Ȓaؖ @tϔ > > > !ذ`'> +> 5> /> -> )> @@vZ8 ""`@vV@a؀  @2 @> Ȓaؖ@t  @  ! 2 (Ȓaؖx@t (!x㿘!>  < *@}y > `!x  > > b@v"8 <> #@v"@ <@'> > !` "⤤ @9 <@  @ ⤒ *@}J  !x` > > b@u"8> # @u"@⤀@> !`  @⤀@  @ 㿘 ! 2 , , ?%> #> ` "` "@t @mx`< ,? $`<0(&!> #> %> '> `""`"@ , " >   @8> aȒؖH@s! @mb! " ,?$"@U ` * `2 "` " `" hȒO => !L !& ( `>  "` "   "Ѐ & А "` "`" `>  "` "   "؀ & ؐ "` "`"ؐ& 㿘 ! > >  @ `"  "`> "!  "> "@l0 Ds `"  "`> "!  ">  H@lڒ㿘?  3  * @ <"*`3  'P <  ! "  > > > !Ȓaؖ@sI!M   "@ & & @ 2G ,!> "@k  &@"@k &@@> *`!@2 $@` " @`" @ ` * @`2 "!L@"`(@" ,> @a @@> !Ж!Ѐ`"@А "`@ # @"@"` /` ` ` ,2`*  ` @  ` ` *  $`` `> > > !Ȓaؖ@rє!x2 2 2@ @3`# @+  ,* @ "@ 2@ #+ @" ",-\4 @> "` > > c@t?"8>  @t; 4@% @5 * 5  N/` #-,2`2  @*@ @>    -> )> '>  * !x` &#@t8,`2`@t  ,` 2 * #@#@ `"  "` "@> @k#x> `<?` "`<` * 4@7 $ *2$P `@ `! *`!2@@ ,`&@ ,"`@"`,@ , & &@" %@&@ `! Ԗ , `8)> #> > ` @` * " *$2 @ # `  `` *  !x`c@s"8> ``(`` * ?@ `$@s `2` ax  ,> > c@st"8@> `$ X@sn4 @4 `$  `,2 > > > !Ȓaؖh@q!? c *  $ ax  > > c@sK"8>  x@sG@s ^&@!> @O&@k#x> `<?"`<  @@jcx <?$ <@9`2 @ $ @ $@&@ +  4  @  " &  &   @&  !x`> > c@r"8>  @r0 > @j#x> <@"< 㿐@` `* *`"'P    ! 2 > > > !Ȓaؖ@q(" 2r ,!>  H@i  & H@h Y&> ! @h > @jx HM&  "> *`!2 $` "``"` *` `2"!L" (44 " ,`, $ ,"`"`, ,$> + D> !ؖ!؀`"ؐ "` # "" > b > > `@r\"8-`> -` 2@rT2   -`2 @     (   > > > !Ȓaؖ@p"G-` 2 $@@ > "`> > `@r!"8->  !(` @r3`P`"`> > `@r "8> -`!P  @r3`5 ^> "`> > `@q"8`- 2 > #\!x@q%5 @ C@ * @D  % " @> > > !Ȓaؖ@p2"t `*`@*@ @ݒ   <` ` @`&  ` "@" `> > > !Ȓaؖ@p "" 6`+6`) "`> > `@q"8`- 2 > #\! @q> ! @gҒ /> b "b44  $" %$ - 4@ > "`> > `@qk"8> -``" 2 @qb44 g `;> "`> > `@qT"8 > `-` "8#\24@qI4 % ! @     ` @`&  ` "@"56`> > > !Ȓaؖ`@o"+ )> "`> > `@q"8 > `-` "#\ 2@q 4> ! @gN > b "b44  $$ "$ j-   @'> "`> > `@p"8`-`>  - "#\ 3 #`@pڛ3`4 `""`"@> ! 8 <  @6 > > > > !Ȓaؖ@o""`> > `@p"8`-` >  - "#\ 3 #`@p3` 4 `"  "` "@> ! @hb> b?"b@P-$2 @*2$P 2 `! *`! ! Q,` L` $@G> "` > > `@pf"8> `#@p`$5& '@P ,`( `!$ P  ` `! *`! !`2> "` > > `@p4"8> `@p0#  `! *`!@ 㿀>  bP' @*  2 *`,`apBa@;  axH> > "8@ocP> @o#`?$ >  ax2> > cP@n"8> #h@n(5`?@#>  ax> > cP@n"8> #x@nb\&`> `@W  ' `! , `$2  /> > #x@e   >  6> (`B :(`< "`<$ $ > `!x > > cP@n"8,> #5`@n2 &D ' L> > cP@n#E ' L@=& "^  ! X `' L `2z bn> `D ' !, $2  ( b\b\$/> *!b\3 q & i/> r ' L> > cP@n@# ' L@&S/> ` L ` *` "2 bn ! O, bn?В @  *4 2 4 bn " b\ @  `,  4 b\("b\@3=*4,  4  2 " b\ @  `, e 4 b\&G  X 7 XB  6(`B ':( 6>  `B : !x  > > "8@mǒcP> @mĐ#  6 `B < `  bb  #d`#\#`@>*  `> "P @'Ԁ`ǒapBa@8`0 "5  `T 2 `T`P@/  "*  `T 2 `T`P@8ʔ  "  `T 2 `\`@  `D   `H  `L   `0`@  2 `\  `\`:`x" b` ` @? ax  `B @? a :@  @ B @: @ 'Ԧ (  ` 3 3 < +"  ,   z  w`2t  #\    3 *  * ^#\   ? * c #\   {耢 2#\5    l r耢 !  * @i#\  Ț T *` '7ԀT (  P &#\`w `  * @"Ԁ = (  / bnY  *U,0S  * @)Ԁ ' #\ؖ  惚 ?ږc c $? 2  6> `B : 6>  `B  :  6> `B :`"  bb  #d`#\#`@<<  㿀> "P \ @  Z!pB!@6 `2 `` ` H> `2  `B> `( >>  2` 8 @2 2` `  ,  *`*$ 2`  4 ` 2 "<`  44 "<  @ 2 @  >    B: 7` "b   `#d #\#`@:  @>  @ '  > > > > !Ȓaؖ@hZ%W!@`; '  @r Z  "        *` "l  2 (g   bZ#\* V X  2 .쀦 P?# 8  " 3  < (-  ` @Ŗ2` "` *  ' . . . *  ' .` .` .` " "`  "@W   (& `   4 `@ > @M. 㿘 `" > @a.! `> @a(!0\> `'H  d @ ' ` 2 Z> > > !Ȓaؖ8@g%Z  "   `"   ` 8*`  *`"    ` 8*`  * 2    "`  2 Z`   Z2#\H* ㅚ  2 ,`쀤` w?# `  [  d>  !x`> > `X@hԐ"8> @hѐ x>  A *`  ' , , ,"  `" `  `     *`  ' * * * ``" `   `"  '      ($@ `   ` 4   &@ H2*@4@@ `"-`` (@"@@  > > !Lab" > "`> > `X@hL"8> @hI > @hD  ?c  2``$` @"@@ > "`> > `X@h'"8> @h$ > @h `?c  2ɀ `ŀ``` ` `!@> !h" '`" 'Вb@ ??# . **"@o3* `ڰ ` ` >  ` " > `"T "@ > @<T>  !x`&> > `X@g"8`>      0 ` "   1 "@   2 @  3@g  ax > > `X@g"8!>  #@n@gax  > > `X@gx"8 > !@gr ax  > > `X@gj"8`>  !8 @gc ax  ( > @gX  6`0`B >`0 2GT `2CT  2T `  TT `"4T  "0T``",T "(T` #!@>  !x`> > `X@g"8> @g!hI > @g  6 0`B < 0k T - ) ` $`@ 2`2> b `   > > `X@f"8> @f! > @fڐ :  `7> ` ! 2> @  ` <"` ` 2"` "   `<"`` "` `  `  "` `   2`>  @ > @J[!㿘 `2 @* ? ` 2@`b<@ ( @ 6b< 6`@&@   ` ߀ "`" ` ` ?  ` @@ ?xx㿐!> "> > #\! b"x  @[Y > > #\"b   @[O > > #\ 4b(!   @[E > > #\!Ԛb8   @[; > > #\#hbH  D @[1 @-> @06@+Z?> bb @^ > "!> "`> @ِ"@>  " "> "!"> """"`> > """`,> """"`>T#a x %"$ D?T#a4  <p#a  - Z $ $ 4$ L$ @$ $ $ $ $$ <+b`#b($ $ $ $ $ ,$ 0$ 8$ ($ H!>  @nP!  @$!x$!|>!"@Β 㿘>> "dX @ > @d "`?  0  ?  0  㿘_@ "K @K 4E `   + " *  @@ 27  " *  "    + " *  0@@ 2"   " *  $@"  $* @` `0``b(2a0`a8  >!(        㿘 !(@m+   && & & & & $`8 8 8㿘  @ؐ% @m%$@r h>  @ 㿘NN /" N 1> "@ې  $h㿘N /  N /"    @$@ma$@r|$`@r /  ,@Ɛ `!``@re$L@`i,(> h@d"x@+  > h@d"Ȓ͐2,L@ @q ? ` %@q`h#%@  F  @G   @l%$ $ (@r# @`  h`h$@r> bp@qc$$@q_->  ``$$   (+$h$%,@@r / 2,L@ @Ē $h㿘 B> "@>!`:`$ 6e 2! .!$ *   4  `"`  8 8!> 9 !` "!o $!@  $hĀ㿘&!."s."tN  r  @$@lv$N / @q$8."sa`" ,J`h `h,@q}$N . B@q / ",.@"s ."sN`.2 LN .2LN /L > bp@p$@p$@q /  > @lc@  ."t.@@ `> a`2&!> @c}#H > @cx#@  e  "e㿘.a "y bs  > bp$@qa`h@p`$Xbt @($@k$!``h,@@q$bs 6a1> @q( / "*#h@p>$bs  &a@p_ h@p  a> h@c!#p@ . a@pK h@pHaL@ hi@p= @p $@ bt  N > #@> #@o$ 㿘!`e ?> @b# &! "e!$h&!, ,",( "(`(",` "`2(㿘 #> @0 @@-b  (` ,"`,&  , ("@ch@Zu 㿘 a 2 a0֐Ԑ`0a "a0@%a0`a4"a4& a4a0"&a4?&b(a 8b 4a4 0@b>@b@b b@@( @&b@`0@@0k@0i 2 aa "a@%Fa@, ba8> ! @Z㿘   @k  ":   , ,``* `2 @"@,02`#P@  @    @j  @o˔  4 `` $ `$$ `" $`   $ $ $  "@&  㿘`.`2 `2@`@o 0`2`㿘.`6``@? "`"`& "@ @T 0`2㿘> s"* 2 㿘. > "2`> 쀢`* `0 `@``2@``"`㿘. > "2`㿘 $ 2  @=* 2 & ? 㿘 $ @ 㿘 $  @w  > c@o 0@o 㿘> "* 2 㿘. > "2`T㿘. > "`2`㿘>  ,@ !  `"`, "` "`  "L $@Mz |> @X!`, 2   > b8>  "b8$ "0 㿘>  0` > "8 > % `, `"`, "` "`  "L $@M> |> @X!`, 2 $0㿘>  0` > b8 t H /`  > H 00e* ! > `,> 8> @ """< #"G"`,'> (L $ 2 @L 䀢  @F   2L $0,`", "` "`  "L $> (!䀢`@X@Lq  "@LŐ  "> ! |> @X/!, 2 H 0% 0㿐@R<  ( !  @Jp ! `` ''H /f * '  @KNH 0㿐@R  2 " !@  @J 'H /f * '  @K$H 0㿘` .`# &* $@0`4,&, ?@?$@@`&%@*  `$&% 㿘`,  &.`"4* @  .`0 @ $@ `,&, @?&@`&$* $ 㿘`$@Ė `$ "  %`( `(@Ă `%@~ @x @s `@o @j `(@f `*@b `,@^ `-@Z 㿐`0`@l|@J`@lu@Ca@ln@<b@7@6 a'@/ b,'@) bD'@# bH'@ bL@ bP'@ bT'@  bX@  b\'@ b`@ ba@ bh@ bc@ bd@ be@ bf@ bg@ bi@ߔ bj@۔ bk@ה bl@Ӕ bm@ϔ bo@˔ bp@ǔ br@Ô 㿘`a  .`"4* @  .`0@  M > "@@H CH /` * ! %@*`$ (@ ,   #@   # # "  " @ ѐ`%@*  "$@ $$%2H 0 (>  @'@A  ' ( "$@Ԓ $ , *  @  *$ $@ " ڐ"(* "@!0   ֤8@R> "(;"(;` @ > @AӐ# (> "> `@' 0" P@"~;0'@"x`U@"r`@l`&&@@"g0 0 `W@"\ 0 @"V0 T  2`Y@ I`Z@H0 @E  1`>@`<@40J @"70#`0@.`/%@0h @"* %1`;@!`:@16@ 5@`I@`J@"D ϰ 2`@ `@ 0D   m1`;@5`:@d0  W@"a0`'@"[`@U`@`T@O0 20#`0@ `/@E0 @A0" P0J @:0h @7  1`G@`F@,`@@#`?@&`<@* t D16@ 5@`I@`J@"D b 2`@ `@ 0D  S !> @"!> @"H /`0#* !0#0@m 0T@ " cW U@ " > ) &@ ">  @ "F>  @&>    @!>    +@ "> 8 N *@>   @   @ "F0 V@ "  @"  @"  ݰ '@ "\@"P Ұ (@"Z ̰ 0 `Z@ )0 @"hN0 R@ " ]8 S Q@"   @"   `W@" u0 2@ 0 `Y@ s 0 0" O@  -0 @ ">   )0 @"YI  @>   @ "n>  P@ m 0 z/@>  u 1E@" ,A=@",'0h @> 0J @ "h>  %1 Y@@"'V U 1 ;@ "3. :@". I <@d 0 CA@", ?@|,m$(C@, 14@ > I@ ", G@,Ȁ M@ ",J@x 0 3@>   2 @ "K. 6@ " ̐7@"    @ "`.8  @"9.  @"   h`>   !L ` hd  t!L!L  8`x  > @[#0 Δ h`>  Ȱ !Lx"h  "t> @[#0  "  Vp4  H2  (."* 0@  .> "@ 2  !> ! @Q j"x  $b0 4$a$b4$a$a8a8$a<$a$b$a4$  @ "$b("( $b(L` " a@%` $aŐ! @%ђ a $L`@ " L`Ѐ "L`ې`В  $bL` "$b Ґ` $b  L` " Lac`* `4b> La " bpXa* `4b@  bp  ba " ~ `0y " bh  bh@& 2  bh@& 2  2  2  2 > "   2  ( La  a@j $a d  "d " b`   2 bpa "a8 bp  a8 "  a8  $a@"x˔ 2 c @(|@@(yyw``p?   2"(" " 0 E   > "@ 2 ;  8 7  " 2 p4 ,  ."* `" &"* @  n.H2  (i!> ! @P# ۔"x  $b0 4$b4$a8a8$a<$aL`` $a4@$"` $aF! @$R a$aa $L`@) " L`Ѐ "L`Y`В  $bL` "$b P` $b  L` " La`* `4b> La " bp֐a* `4b@  bp  ba "  `0 " bh  bh@%t 2  bh@%n 2  2  2 u 2 > "`  2 `(`La  a@ $a d  "d "d b`   "a bp  a  a8 "   0Na8  $a@ V"  $* @ + $* @  !@* @  (@  0( 202 `jC    $, @8 @?1"@ $$a0*@ a0`$a4@ `"@ "` 2 04a0$a4$a04""4`$a0a0"a4$* @a0"0"0$a4$* `"$* @@ "(0 $*`@  %@ @ `0">?h '>  Nh   @aƐ 2, O .a|@60"? _  J  4  4 `" H 2I`"4 I@2A4 HQ 78d HHI "05 " e`02 "%e " Nh``b "Nh " O @afh 2 O  @3N  O`^, O 2.  2- %> 4@N? "& @"OX 4@O !  P@` <> aL> #p  $ $! @ > !L!   @eiX b(& ̀ ?"(& Ȁ ?"(&А$@&&"&&   > b.* &!  @ X > " G N 2> !La(?.t!   @e(`P b($` ̀ ?"($` Ȁ ?"(a$`Ȑ&@$aې$a"$a$a! W!  . N * @> *`L@(ǐ.* &^ 2!@%0Z > "@_’ 0S@I > "@dה 0I @_ x> !H@_ > !`@_  > !L!L!7$!t@% 03'H J // "% 2H 2 H 2H " H `" `2I 2 I 2I " I   B " @ HBH7@7  BH7@7 ,  Ȱ  H ϒ  6DHɐ0B6F0Ò  0 6FH@6D8 > #p!* 2 &#p*!" `2&6&>@3Ȑ"d&> #p*!> "*  v&`> "*` Ĕ @N 2g  * "_&> \"""@`W  :ap:a:ax:a:aa0`2:ap0K"@'>  L $ 2  " > ( "a!x`3> @V 0/"@'>  L $ 2 Ր " > ("!!x`> @U 0"8@  > !@L!  ؔ N`$ y`$ &`|Ԓ@M 0>  ,@ @c=  2 L $ 2  &`@Aߐ @M|0>  ,`&`&`" ,"`."&@` >  &``2> "<&> "<@ 2 > "@`  ```*``  u 0> "<@  > " @ '   *  |@A ~ .z& "> b "br&"@ 2m 8   2e !> #h@Kw e/ DN`0 " @`0 &`@#h@ @!  > @#`@@ #h&`(b``(&`,`"6"`&  #\z  "* @`& &`(`20  #\ c    @`" ``(` *`(` Dѐ@#[0? I 8   2 Ȑ ܐ  #\) "ٰ  .!> #h@J ֐ DL`0 " $`@@`0 $`@@# @   " @"`@@. #h@LJ  @2@` @     (   * ( "   (` ,"`,&` , ("@"V @@ > #h@L$@ $`(``($`,`"@&`2  ( ,`($`,$`( ," $ ,`$`(`("`,`(&` ($ ($`,@`&`Z0J* "F &!  $>  ? :  &А 2 0,,? ( `& 20 q .!  $>  Ӓ? "#N   (@a @N?Ӑ    (@au @N  , D@ @J$<ذ$(հ D@ (8@0̰ʰ D@ (<@W0$( D $(@ɔ$0$ D $(@$0$( D@ (8@0,$(D@(<#\0@4@8 D@ @$<  D $($8@T$0v s D $($<@2$0i f D@@#\#`#d$($4$0$8@$<VT D $(@ǔ$0K `H D $(@$0? < D $($8@ Y$02 / D $($8@"$0% " D@#\$($8$0$4@?$H@x@S $2    @$$( @  @G  $   !L  ͐x$ @ @ ؐ@[G$( $@`b$ @  @ . Ɛ$  @T$ `@@  $2   @P$$( @K  @> )$   !$L  sS$ @  ~@Z$( $@`$ @  @ Ԓ l v M`@Ȥ@ Ē \$2]   @$$( @  @ ה$ 5 ``0L   >  0`'> "8$!@   $ $    4*`" *  `0 $ " @ o @ l  `@ @; $    $$ @ I @ZP$( $@_k$  @!  @ 6 ΐ  Ð`@ˤ@ &   > !? ,[ ,&  @Q > !n? ?> !L`9 m `0 "`p"(&`0`p`t$@&`p"@&`t&`t`l$`d@  &`h`h@]`h"@&`h  o `L̐,^&?"  '>  "`"`蒒 2 > ?!В    "`t"`X   C"!p`> @> ;"b9""@zԀ 4  @  .@  )@  %@ @ @z @w  @r @o   @k @f 0 H 0`@ u> @ c>  @ > @4 (< Pd"2 䨀<䬀"䴀"<  2"d"d  "d䨀2  ""d"  ""䬀" 䰀 2"""> 䬀" 䴀2 ""3 2"d"d  "d䨀2  ""d"  ""䨀" 䰀 2""" "d"" ݘ  2ld䴀2 "dd䨀"d d d@2""" "dd䨀䴀 䬀n"k 䴀2d2" 䬀  䰀 "2"""" dd "d䬀2 d䨀"d d d@2"""m 䨀 "dd䬀"d d d@2""" "dd䨀䴀䬀"  䴔 A"䴀2d䬀2"   䰀 "䨀2"""" dd "d䨀2 d䬀"d d d@2""" "d "2d2"㿘d2d@d =䨀 "䬖$ 2䰀" "&$ 2#$#$䰀" d"d"d"d"d`"&d2"d"dd"$d 2"$  $ 2$`dd" "&$2#$#$` 㿘@   @ $$&d&d&d &d`6$$$$$@  㿘  @ $$ $" $$$$2$0 䨀 $"$䬀"$ `㿐!> "> > #`0#\$ؔ  @C > > !`@#\   @C > > "  `P  @Cz#\>   *>  + (tt> ( d @VS 㿐|  @ ; @% "6 $  0 , @L 2%  H /` * ! @t`" $H 0$`" > @M `&$ h>  @> 'L'P'̺'L x  ! @A ˰ @Ӑ "ư     >   @M L 'Ԁt  x   0  ذ  @    @ @   /뀦 2   /ꀢ@ //뀦   @g 2V @ @/& 'Զ  )  ? L` LL`` @ @̒Ԁ   H /`4'А* !'̐@rԀ PH 0Ё P@JP 2"@  @@<Ԁ L@̔@ђ >  @ > @0Ґ p>  @'P' xؠ  @ Z 2ذ @ "Ӱ   Ͱ ˰  >   @T2 @7+ 6( ' 쏔   0 ̔  @  @0 2* `  c'Ԫ/ d   0  ذ p @  i  @  2 /ꀢ@"     /뀢 @   *"'Զ  %  25  \   ` ` P  H /` * ! @Ԁ  PH 0P 2"    @ה>  @ > @/ X> @> 'aL'T\'X`''H''L'P 'Ѐx  !d@ ]   @  " d    >   @ i  @=L '''Ȁj H ؐ됔  0Δ @ ְ /@3     .  ꀢ@&& 'Ȑ /  @   /@ 2 @ @/& '̐ /`L I   L쀔 L` @ `Ԕ@ 6P`2L@P"@q &Lؑ* H* @'@  /  2X   D  N `  @̀& H /`4'Đ* !'@X@@  TH 0ā T@)T 2"X`"@2" P LP@"@   @j@̀H@L@  >  @ > @. x>  @ ' _8 @ ( 2h @  "c $ ] W / ؐp  B0뮔 @  耢 逢``7 @ @C " /   /뀦  " =    `t `  `@ 2& `@ > @. 㿈 @  7 @ @ "2 $ 2$, @&% @RԒ  ''$3>A''$`l@F `l$@@  `> $ &@J а 㿀> !L~ @ i Z @  "U $ 2$O @ I&@R  ''$' 'H /` * ! $3>A`l@ `l$@ `  @ @O ` H 0  `> $ &@I! p>  @'L' x   @   @  "  L{ 'ԀM 3 @   0 } ذ Y @h  R @ݔ     //뀏   2;  U  & 'ԴL`     H /`4'А* !'АԒ @  H 0Ё 2& L@ʔ>  @ > @,Ӑ!0  ?0/  *? %` `0J 8? `88 J(J  ?  ?㿈&@@Qk   '$  '>A`l@۔ > @H!@$  >A`l@ϔ > @H!p&㿈@QA $#>A'`l@θ > @H!$`l@ί > @H!ȁP>  @'@Q" `  @ //'$2`@ `/`/` ''''$``   ``0&`$ @IH /* ! @H 0 #@  @  2  @  `@0`@ @ > @+ߐ!㿘`> "> !@>S  # @P ``` , 0, 1@$ 42 ` , 0, 1@$ 8`$ <`$ @` $ D `, `, `, , 㿘 @ 㿘 ` > > @?"0@?