D|p|p, ,``@00ھ>b0<4 `@# ` !" $@` `T@  H a@"@H*/+  "a  0  "#p "#| * "#t!` "#x@㿐@#  a"a @ "  "@c@  @ p  !@@㿐 c@    "(@ɒc# @ D ?#c' / - + ,`2 @@〒   # #X@〒@ɐ#@`bp@@?@2 @a aa @`#@Ȳ@  p? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @\"1?㿘 #@(1 @M"1㿘@ " ܒ㿘 @0  㿘 #p` @ ! `  "  `X "!J  *@J` )*@㿘@Ґ  #p` @ ! `  €a  $€a 2$   ! @"0 p  $  $`$` 㿘# a`   ``*  `a   '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 !  @@ 0(@  㿘  @ $ ? `$ s*㿐 !/  0T@㿘  㿘 !`t€㿘) !t ?N  @  "!!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @U"+  " * @7 $`0 "$`4 " @$` @ 2!t&  %!t  @+" 㿘# at  @ 4 "$at & 4$at㿘 #t*`@   #@ْ 4   #         # @’` ` #|@  #t8 <?*  8 آ&@  `  #x8@㿘?( ,h1 \&! H L` T ` X P d l$ p  t @  p.@` * @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  << ? * `:```?  `@ "`@"     <?"  <㿘 ax'H'L'P'T 'X w"ax@/H @#@㿘 #H4L44X44444444D4444444 44444㿘 'H'L'P'T'X#`@ H㿘 #`@ N@`N@`%` N@`` !4*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @N N@ @E N@ @< N@ 0 x   ? #P0(  @ 0,  ?L?hN@@ `N@ % X lT㿈 #P @,(  ?L?㿘  D`  !|  chJ@ #!| @ @   @ *0   @ *` (%s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx %&&& &0&@%t44,44444444   44p4pH4H44444H 4X-4 D84pA4L4tZ4 He4r44484h4 4 4 4 4 |4 4 l4 4 4 4 4 d&4 @-4 444 X;4  PHq < @ H_FqEP Q /mnttyj Q HqP@@<@T PH_ < @ H_FqEP  H_P@@<@T UHpsx Hp+yA HaHq6$yүDʰVW 8Bf2$*ħ4V* |<1:O/SW(kr̾mm0 !߯FK.X},ugj~kƷ *Dw)ȉ0'T-^` G/_4>[{lg UC #VrQN _b;k@~OnAM\b<\n_)T&, 9rQLh7N$BCF,q (U,׿+hh ;,Uta!4ol8!_VfG7d>\̝zjKsxo ... . .. installboot export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- `dmesg | sed -n '/^root on /h;${g;p;}'` rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . .. bin dev etc mntmnt2sbin tmp usrvarinstbin.profile2upgradeinstall  install.sub bsd  install.md boot( #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_size if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.conf resolv.conf.tail dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done /tmp/ttys mv /tmp/ttys /mnt/etc/ttys questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname >myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab host* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up MDTERM=sun MDDKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' ARCH=sparc md_installboot() { local _rawdev=/dev/r${1}c _prefix if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_prep_disklabel() { local _disk=$1 disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } md_consoleinfo() { } ELF`4՘4 (!!۸۸44UUddttX444OpenBSD㿠@ @D* @ +#@㿘c" @ `'"  @, / &@ &cJ `ؐ  *"J` `&* А@_@+*`:` J " 㿘5!?!`     , `2 ?, ??@@??㿘5!` !  㿘     55!a"d@"|㿘 `  "`㿘@ J 2@@6@@U /  @  `"@Ɛ 2     4ddb@N#@㿘 ?@?`Ŕ㿘 4ddb@5# `  ` )d+d@3@  O4@""@@b`@ @"@f 㿘@k㿈'5"H)5" !"` B%5@Тa8 $a8eb@@) @2 = 2,ea8bP@)  L a8ea8bh@) e'B a8!8@   5ebP@) !@ "eb@)  €#!@  $8!5!@`@"@ $!@!@` @e@Eg"!@`5eb@)` ! 5eb@)X !C"C##"@!C #C"5$!@"aec@): 5!  Heb@)1 C"5"aH`e!  5ec@@) !  6 ec`@)  #@Ӓ?`  `$  #@Ò?    $  ec @(?㿘@@㿘@R55"aX"㿘@I5"a㿘@B5 "a?"a㿘@7 "c,㿘5!@ @+5"aX5 `㿘5!@ @5"a5 㿘@l5:㿘@e5:h㿘ec@( 㿐@D ?25!8ec@.@ 2J5!8ec@(v `k`m`b". `w . . .  'J`x 45``*25 @ ߐ@  "5a8ec@(< !8ec@(7 㿐 @Ϗ    5!8ec@- 2K5!8ec@(  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @! 'J`x 4!5`#`*25  @T @@ٍ "5a8ec@' !8ec@' 㿘5!Ā 5!H   "@    `*5!5!H``$   $ @$   $`$`5P5 㿘e cr@'} 㿘e cr@'v 㿘e cp@'o 㿘e cp@'h 㿘@ FcT@ Fc|@ F@ 5!? 3 @c,?`&c,@@Ր 㿘%5H   f $  $ @  $ f `@, @H #,  H  )5f`@'  )5! #5f @ $ $$ a@'"& @ ! $ a@"& @ ! $ `$ !` #5` f@,`#5@ga'5@ @2HaH ` @? $Hf`H@, $a !5!  @  $Ha !@@ $af`X@, 5!H!Haa`$"`$ ` " @b  $@@@@ x @   @&    @, @"@5f`h@& !@T*  @/h pf `@,? <     a@؀     @– ?  @y   & 㿘5! 5!!` %5@@ @  5!H @j  '55!H  @b '5H  @S  z$ 63 @$2ff `@+   @@  @      @f @@ @@@5H5" !Ȓ@  "#!Ȁ  @ 5$ Ȓ@  $ "@ $  $  $ 5a` "`5!@` !5!H 5"!@d y$ @@5!H5a` "` @+'5aH`5` "`]5㿘5!C"@C5"Ȁ@C$ 5#@5*5!@!5!`5@  " @ !@ !`"`5! @ 㿘5! !``   H# ` 5< 2 `` f"<@AL ` "$` f@%G`'5 @B 5f `@%8 @xp  f `@* 5  > B;  @2   # !5!  " &   #   !@<"@ !  & - 4X'@R 5!!X" 'X\"@`'\А"@@'X'\Xf!f?00!\ DB F?0 ?0 `f d#\@<8@'8 `$`f! f!(f d@- %@@$ '5`  (f! f!(`f0 d@ϐ- 8"@֠<$ \@##\`- @fa BXfH d0 ¨ @;`8<@$@$@ ǐ  f@!㿘@w^@w"㿘V@ 㿘)5!H  !H@H  !H   @Ȕ     @ ?B@f a@)    6!H!H@J  "  D?D? 5 c, ?"c,fa@$  !@$ `ـf@~! рfa@) 㿐'5    @p    @: ?vtfa@)  $ '7a@> cfa@)    X$ T@ 4A`6fa@)o   7 'a@?fa@)_ ` D 4,$ (@A  fa@)E ` D 4$ 0  D 4$ခ㿘@9!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!! ! !! !!!! !!!  4" ' 't/G#c-ftp+f9 3x+;f 4&* P@€"    b@d b   #@p   fbb@" @D@Pgb?Ґ?#ē* & @ @5@@}` tf`c@( ? 'x' 't '|'|t''c @'o @u`-ffc(@" xcP@(s @@ 㿘 4fch@#@8 㿐@ɇ ' @(^ @ `@!㿐 #f @| c "L " n L  o  @ = ",@``"@M 2  .f @ @ @`ff#ؖ#fc@"H  2 &*@ &"`c@"0 `"(&@ "$&@@ua"@ƿ # g2&@@uM`"2 &@g`@"   㿘@)&&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H%%&H%%&H&&H&H&H&H&H& /I!>#>%>9>->;>+ !)c'g*7g $%* @€ $"$a $ $a$" '! % 'b a@ g`8@! @"@@O(?Ӑ? 3#*@`& "  b g@=``@@  2@g`@'>  @^@P!耢 ' @'. @ R  @@  @m@ @@{=`< @ @2 @@@ @ 2-`%a@*U@ !!  @g@@=.`@X 2 ag`@@= ` @@{า`@    @`  @R ꀢ4?a耦` $ b @'@ޒ@`?㿐@g  @6  @܆ ꀢ ` @! 㿘 !!@  a`?  #5@    2a@ 㿘 gN  nga@   5N  o55 "a "! % !  @ , ` @p  $@ @&N $@ , `$@  @ , 2*@, $@㿘>!` !!@` >"` @ܒ /- (+ )> "!v " @! @)Qa!貆!㿐@?gg!@yϔ0!@y˒㿘   @    @   @ 㿀g  @y!  >  @ cB ҔQ   @ @ @  @ @` ` @ @r @ @h @H`  @ @Z @{  #\@Q @2 #\#`g!(@yI" @T @ɒ  !, 4` `4 @ @?@g !x Bgax?g !@@y >b Ng ( 0 f7 @ @ ?, 4` `4 @ @? @ @} .6 6@r @g?!x B?@ ?g#\  0!P 4@xΔg@xʐ!hg!p@xƒ 㿐>"`g!@X'gg!ᰘ@x>>!` g!$'@C'@ܒgg!Жᰘ@x>"`"gg@x!g@x"` ؒ!`>!`g" '$g"0'"gg"@ᰒ@xi`~   @ b @C@ ?@ߒ !@?g b B?@g` "x@: @3@H  @)@    : @ @; ;`@ @;`   @ @#  ;h@ @ڔ ;h#x;p#\@wa!贆㿘@ ?g@xŐ ?@C @Ր  @㿘 @p@7" @qH` 4 @q@@ 4g#b@8 㿘  g 4b@-#@~ 㿘5    !%\FaT  @! }?!%\Ua "!0t!& 4F& 0aT&%\ 2.$@ ( :> 8@N  ̘ d : > < (#  ; @18 @n d ( 8b @ b >  @1 ,? >( Ȓ %:> 8# @; $@ B > < d" $@: @ @D d@d@b>  @  ,? >($>0&`&dx g#@  Z@  Zgc@ݔ  㿘-= $0$ X? 8;#S@2Q? L (&K? $*& 4* &@ (   $@͐4@ǐ@$ >   > @ c >   >(   >0&`&d g#@ 5 Z@ 1 Zgc@z  㿘@=;;:t;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:|;;:;:;;;;;;;;:;;:;;;<;`;l㻀 4"h'H'  ;h%c- !+h9>)h7hV 8QN* (@€ 'J  >F"b``@r @6J@ 70/gX@a /% >'"b` h`h@k @@I`  ` '"@=   @@@I”P?? 3Ĥ * &@ `   0`08䀠.`? @̒X  @ƒ h @ @=  h @ @    @'  " @ g@o  h`@!  @  "@!@o ` "@@@v `h@`@! @ 6@Ȑ 'h@`@ @h@X  @ h@a@ @j  ha(@!c  & `&@@& ) @|  g@b gh@a@  @$X "  @  h @ " h@a0@p  >"   2`h@@X h!`@@Z 2`@  @n@(@& #hahh@ h!@wp耢 耢 @r1 ? @nb`ha@  @ی@㿐  @ '%h@ U@ܐ`?@t  2@㿘 !bd  bd@"   J@ " @j  @㵠 4"'@u  h h  O h h @@?ha@Z `5h - @@-'%@# Ÿ@p Z  @@h   @>"`hh!a@t0   @@`   ha(@ = ' <@&>* &   * &*& 'h@t "  6 h!h.  @t" . h@s" @@ސv @`  !02h@tϐ"(@ΐ@̐d ##h;h@b0$@f&@r@mb`b@@t`@ 2@@mT`h"P@t@ @@@s h@t"x,  `2  b0$ ` >@" h"@5 >"`@"  h!В@tl b@  b h@"` 4"'h   "@si >>b *    !hhh"b@sU  !"d` #3h"d `-h+h)h@`  2 b"@s8 ,@`  뀌@`hh""@h"h h"@s   p'̒@h"@s /a`@ Ph!Dh"h" ""hh""h@r"  @z hh""@rܐ" hh"" hh##@rɐ"  "hh""h@r"  " hh""h@r"  @" hh""h @r"  " hh""h(@r" @@hh""h"@rw0 2 @hh""hh #@@r`H 2 $@hh""hh $#@@rIP 2 (@hh""hh (#@@r2X 2 , hh""hh ,#@@rh 2 0 hh""hh 0#@@rp 2 4 hh""hh 4#@@qx 2 8 hh""hh 8#@@qڔ hh"" Hhh@qȐ#@!h Lhc@q# Phc@q#h T#@qcc@ӫ i@Ĥh"h"@!hh#@q݀`@ӌ {i  !D l 2 p hh""iii l  p@qt  2 t!" xhh""ii t (@q^8 x " xhh""hi"@qM@ x " xhh""hi"@q<H x " xhh""hi"@q+P x mhh""hi"@qX^``@  8i!D l  hh""hi"@qh l " lhh""hi"@pp l 1hh""hi"@pޔx"@ђ`  !Di!D@pΐ   hh""hi"@pi h" @p i@ 㿐@t  @6  @ғ ꀢ  @Ҍ `@! 㿘 !"`  b`?  #>@    2b@ 㿘 iN  ni`@  >N  o>> "b "" % !  @ , ` @w  $` @U $@ , `$@  @ , 2*@, $@㿘 L@ @@ @2 i @, @֝0@D@㿐i'@ ȶ1h  -, , & @ƒ =   , *& , & & @o! 2J&@㿘 4i`@j#@ 㿘 h@ƒa`  h@aX 26 @ "0 @ѵ  *i @ѯaX 2 h`H@Ѩ 2 i@1!` h@ќc 2  h`H@ѕ "   i!@1  㿘@㿘@C 㿘@㿘@p@㿀i'Ua'  @ሠ 2ic8ሔ @ 2] `&` 2 Ni#@1@UN u2 Nic@> "  N <2  ic@3  `( 4*@  @" `i# @1x@*J`i#@1n@  `(* N ^N `(`? `-   * `(*  &`  㿘 jj`@M `0@J 㿘 j H @n ia a%j  x @ @nݠ  2 @j@ij @nϒ㿐'H@Л : 'HȐ H+j 'H/j-j@Ѝ = 2,@,@`@N@ c j`@П 2N@s&  i2 N@j`@В 2N@f& i2N@j`@Ѕ 2 N@`@dU& $ l2 N@j`@t 2N@H& o2 N@j`@g 2N@;&  oij`@Z  i`@9*& (!` !'j N@J@2  @A 2  ? @  , 2 H5H  H@n N@ i㿘@@㿈@L@ -2&` &`` "V`"' @ 2 # 2  ` j!@0L@  "  & &`j!@0;@ @ 㿘   D@z 㿘  " $@0 " `  & & & & $㿘@  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@< 㿐    ``'@W   '``@O & 㿘 @ @j֐ &  @$**@"" "$@$   """$ "     " "  " 㿘 @_ @hg & 㿘  @0 @0  ?` # & & 㿘@A  & 6 D   $g`  ˒  " " " " $" 㿘j F!@m  D㿘@h j@m!㿐 `'@ ja@  㿘@`n jb@ 㿘@`o jb@ 㿘jb b  @ 2    ` *@&`   &` U&`  2k `  @Χ 2    `*@&`  &` ;&` 2k#P`#P @΍ 2    `$*@&`$  &` !&`$ 2l#`# @s 2    `*@&`  &` &` 2 b4bHb\bpb 4"') ` *`X! €m@lN!Xm@lI!hm@lD!xm@l?! m@l:!m!@l4@gp@gH m!@l'm!@l!m`@@l!" m@l" m@"! 4 m" `@@  4 m" `@@$ 4 m" `@@  4 m"( `@@  4 m"0 `@@  4 m"8 `@~@ m"@ @t@  4 m"H `@i@ @ 4 m"P `@^@  4 m"` `@S@" 4 m"p `@H@ m"4 @>@4 m" `@2@4  m" `@&@4 m" `@@4 m" `@@( 4 m" `@@4 @"m" `@@m@"Ȁ  4 m"В `@@! 4 m"ؒ `@ݐ@ @ 4 m" `@Ґ@  4 m" `@ǐ@4 m" `@@" 4 m" `@@$ 4 m# `@@( 4 m# `@@4  4 m# `@@ m# @@  4 m#( `@x@  4 m#0 `@m@  4 m#8 `@b@ "  4 m#@ `@W@ m@F#H m#P @I@  4 m#X `@>@  4 m#` `@3@ @ 4 m#h `@(@  4 m#p `@@  4 m#x `@@  4 m# `@@ "  4 m# `@@ m@#(2 #4 m# `@@ #!"m"  4 m#4 mm@ِ#4 @Ր# 4 m@А#4 m@ː#4 m# `@Ő@4 m#Ȓ `@@4  4 m#В `@@4  m#ؒ `@@$ 4 m# `@@4 @m# `@@4 m# `@}@" n@j i!`!%n` @@ d@C@c` @ 2`@O D@K i!!`2 nn `  d,`` " ` @%@`  @^@ 2 ` @iy @iu` @ ؀!n@ij  @ig  n@l (㿘!>"( m@iU"$"(>"",㿘!>"(  >",n@iE 0$"(@ސ"(@`H nn@i9 8n @@i5 $"(@i/ H"(@$"(㿘 ?  1>n" P@Ϯ &" >1n  X "  M."  -*  ^* ? *4* ^*@**" @ 4" 3'H'" '% 3'Hh@<?2 e"  f a + g% !c"@ؒ  'n"`p@ܐ  Ā@H*` n@c``ĠH*`@P nĒH* @'H n`x@ `@d n`@ `h@Y `n@it ` `H H` HHH''@ OH +nL =H 7H 1HJ@? 5`А   `  H@]@@cd@e'H`@_  He`'n@*} @/H 'H   @ n`@,    `g@Ҕ n@h  n@   㿘  n 4`@ψ#@ِ 㿘@2tuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuututuuuuutuuuut(+\)>'>%>!>#n/ 35>9e7 -* c@€  %"4  $0 $8 $"@@@;gaȀ??Ė<"@* @ &"@ "  . " `. @n@a@, @Y @'@@T?@ naؔ@x <  "@@  @@  `@@@1㺰 4">b@ ' >@ n!>"4`><  2 >@` "ny!"8`v"dޔ!x€ (<  !@z nX!#n$a@͉#( @`  ?"a@g֔J@ $>@  >@` n0!@>@ >"0`2' n!@)  "0`>@h   >@`J`2 n>"<€ n!ؒ@g   n@" 㿘  n 4 b(@'#@x 㿘@V}l}}~xL||||||||||||{||||||||||||||||z||||||{ ||||||||{D||||||||||||||||||||||{p{{{|||||||||||||||\|||||||||{|||l{PPP0PPPP PPPPPP@㿈 '/;^! #)H-H#c/H7o+P'G5ol9G 8g* al@€ D  @  $ D[' D  @  R$ D D  @   'G$ D!d C%!dh ?%h D  @ z 6$ D D  @ q -$ Db*'` &%` D  @ a $ Db@ǧJ bJ `" @ Qb  /at %atȐ $@ C@9?? 3c D*@`&  $ D  D "H@ ' DH @` "lP  `@Ѫ!p 6 DP!po`@ ?`^T*` € @ @ @_ @v @ @ P@O p@  @ @ؐ `@<   4"@0  4* b: @M @ Yb? H@ H#̔@po`@j o``@A @ Hp@] @ߐ0:at 7 `m@ؔ 0o`@$ h  ?@ H@   @  H ``@#Hp#@#@!@ H!p@@Ɛ㿘@X o`Д@ + @!&&& `&$@(a 㿘 !W&&6@ Pat6 e`g@y  o@   㿘@^6 "o   oo "o o!! !xo!@&ܒ0 @em㿘H!d` `s@A Hoa@ H!h`G#e`r@/ ob@{ #e`e@# ob@o 㿘`( 2 @"&`&`( @!@ʒ !Ԁ@ oJ b0@  *J㿘N`o`"`obh @˽`N` obh @˴`o"p@<`8 o "#0* ob@ˤ`(b@˟`(o@˚b`,o@˕b`0o@ːb`4ob@ˋ`8ob@ˆ`po `< Bb@|`Hob@to``Job@jo``Loc@`o``Noc@Vo``Poc(@Lo``Toc8@B `\`'o,H@6,` v  "#p /o-o+o` @  B a@`` a @  @+ B ; P@ ` ` @B @` `  *@cp ` ocx@ ` - 2,` ` ,`: 2` - oc@ِ ` <  ? * "  2 *@- o oc@ʿ`` @@擐㿐 @* @埒  !. 6`  `6 @哒 @(' o#B* : `/D^"P*` €&(''o#B8' o#B o#@o# @o#@o#@o#p. @ @/  @ ? B ? @ B ? @ @ B     ?*@ !   ?*@ p  2  *@ "    `*   @,p H ,`   @B  BocȖ#\@a0:Bo#h@ #d#l#\#`@ܔa  p  "cp* @p`@ϐ0 `@ʐ  po@po`  @p`(@ɮ`8@ɨ .p`@@ɞ ?`&  * &@%ސ 㿐.>`  4 *`@ R`P!pp `P@|` * "#0 p`X@qpp`h@kp``x@e p` @_`p`@[`X`p`@T`X p`@M ?`&  * & @%`(p@:``,p@5``0p@0``8pa@+`4pa@&`p. `< @ ;  B ipp 9?`p`<  pBa(@ `HBpa@@ @`Hp@aX`Jp@ah`Lp@a`Np@a`Ppa@`Tpa@ߐpa@ې`\`   ? , `"? &   p%p.@@.pb@ȸ p`b@ȱpppb(`h@ȩ`  F<` @v 4" #'@Ɯ (?p@Obx ?o@ o @a͒ ( q@  H@ǣ@b?v    ސpb@fpb@b@ǐ (/o3o-HQ+q !@E@" @ Ԓ@ڔ!p @n@``X 4@" 4X` ? "`@ǡ X  "X ? 4"X`? $`@ǍX  $X` 2` n N@? @ఢ 2X`@aQ@aʐ (  q@|k x㿀qq`q'' '@q' ?J q@g qJ qq q`@0䀢?J? '@滐  @淐  @泐  @毐 @ `q @_:@  @Y`@` ? "2 @Y " @Y@慐 @悐 @ @| @@Y}"㿘q@Z`L  㿘1q@YU L   , @ZΐL   㿘 5 ЄL  ?   ` " @,, 㻈 4"' 6`r&`  &``@j ,@ "@T :  q @!͒s-q`@i =q qn #`@  "n#h "#0 <? " @ A0 *?   # '耢q @!.6`a @( 0q'耥 )M %'q%q!qI@(  '@ 0  '!8@!] L@ &`XaP@ +q M `\)q   ?)쀢'!`@!3, $ Ӡ L@ π  ̐a@몔耢  ? q!@! 6`6`qo a@ q `a@ q`@"? a@ q   ?֚ '耊"&`(q!Д@ ڒa@z q   ?  'q!Д@ fd&`,a@^ q   ?  'q!Д@ JH&`8b@B q   ?  'q!Д@ .,&`0b @& q   ?e  'q!Д@ l&`4b0@  q ? H  q!Д@ O 6`p&`<b@@ q?   #)쀢 'q!Д@ 1׬6`HbH@ΐ q?   # 쀢 'q!Д@ 6`JbX@ q?   #쀢 'q!Д@6`Lbh@ q?   #Қ쀢 'q!Д@ڒ}6`Nbx@w q   ?  'q!Д@ca&`Pb@[ 2 @   ?  'q!Д@GE&`T ;qL` 7q*`: ` q-"6`* >@T ? d  q"ؔ@l 5` &@  7 ? G  q"@O 5`%` C-`  "cp  X   " @  p *L@? 5`А   `      '$:  '쀢 q耢 q# @'-` `  C$ ̐   ?ݚ즒` q"@ ? ɒ   '@}@n @u@f@]?, @k@] e-` q"@\   ?즒`O q"@Gr ?    '@7@( @/@ @\?, @%@\ -` q"@rB?   #S 5`$: 6`#P@[$@T sq@`?  q@x#pq"@B㿘 (  q# , 2 0q# 2 4q#@( 0  2 Hq#@   H 2 8q#@  8 2 p ,@ 0& 8 p <  B 2   8 4  @ߊ 6 p& < q#@  `@U: ( r@  r @@  `@U) ( r@ِ X `r @Ҕ     -r  a* 0   @  B   B  0 ( B :`@ X * (    8@  B @, @r, @:` " X   8@  B @ @r,!(@:` X  2   B " B r@i!`` p      , 4u#`@z p0      B  4u#`@@f>0 4$* 2 " " " "  `*`2 6  $$$$ @    @  @'+  @ b  2@(  @ b  + +   4 $4$,  , @V?*   , 4@ z 2"$@ 6 2$@ Œ 2$@ " 2$@  2 $@  $4 㿘uu p`@v 2 t 4#@Sc0@* >    ( 4u#`@`0/        B   4u#`@>0    ` #!* u 4#@`0@ 㿈uu!a @# 2 t 4#@c0[* >?    ,  4u#`@c`0J  ` 2@`    B 2 @ 4u#`@M>04`'`'` ''@ !@ z @  @ f @  @ T  $@$`$`$` 㿘 uu!Pah@ 2Jt 4#@c08*@ J02    ( 4u#`@`0$  2    B 2  4u#`@۔0 ` (@ @"&@㿘`uu!a@i 2 t 4#@Fc0;* <    , 4u#`@`0*    *`0    @ B  0 4u#`@<0 @ D <@  u!@S@㿘@    @ F  @ 8?@  ?    㿘> u"X*bH' 4s#0@SXbH$@ 2bH ` ,bH X ?4  " X* $ X @| ! bH@1 ?L ", LH`?H@- LbH`2LbH@Y$LbH ?bHp'D 4 8'X'H` X '@G  4 X/ ?/9uH@SQ"h$@ ` ` /`X ?4`  "`X* $`X @ ??@͐ L O ,O ?O@ǐO ? * `O ``h`qL`  4#*`@ R` cD k &"P b %2OYOU"D m gOLOH8C,D`(,>  (d 6 @ː$D(D`(@ @ʼ,u" DD?`p<  @B ux@=$O @ʤ,ub ux$@-?O + -/@L#'"@ʉ@L?`" J` @L "?#? ' B'؅ ЉD?@Ԑ *`:  + -@Fhdh=?D9 4`X D2 4@ 8   F@$@%@N`B @@b8 @F? @@bu"@R 4 u@n "㻐 4"'@` "  @ " -`@ } 4"5u;u7u9u-@@      @ @ C  B @B 8-`2U` Q-`@@ll"@"2`2a`a@QȐ#@QĐbؒ    #u ) 4`'%$* a`a@Qc "X/$@ O X` ?"` X* $ X@u  O` ڐ?* * x`-`@ --@`2|  4" u@m|#P 4"!X'@猲Ppu@Q_#` # ;u9u7u5v/ 4  #*` c# "t@    ĠD u,`` @v 2` u7`6 @Q+#@IⰠ  % 4+v'v,`@Q`0 8 `8` 8`@5`D 8,``` ?"`* $@   vv6  @`P/ @@ /v-v  +v) 4 ,  #\;`#hf? $t?`@# ,& ,/v-v  +v) 4 0  #\;`#hBؠ? t?`@ɒ# 0& 0/v-v  +v) 4 8(  #\;`#h? t?`@륒# 8& 8/v-v  +v) 4 4  #\;`#hx? t?`@끒# 4& 4)v@'v+`0  @  B 80@0  @ B   ~@ p *  <3   @  B @b h@g B  4vb#b8@ p <  4  8@  C  @   2   ;`#h#\!Р? Bt?2  p2  pv 4 @c p < @ B  %?@ +`  ? @#B #s p+`v@j"2`6 p 4#@Ւcc 4t 4c@ΐ#@є!X 4<6 p& <'v%v  /v- 4 H *2  #\;`#h? t?@ꠒ H6 H/v-v  +v) 4 J *2  #\;`#h? t?26 J`@u# J 4" v@kV#(㿘?"H @Ô H           B (# ` pؐbH@  bHvc8@+ bH@s vc X@.@w " N r"w`@Hz. `@ 2` ?* 2  r@w@ w@Nݐ 0 #`IJ )v% 4;w9w7u!v.`@@NА 0`  8@``.``? "` * $ E6 @ ' #/u-v`8 H "`8@  đ.`@ ",6 ``(.`@N@鶒 !v.`@@N 0`  8@骒``.`` ?"`* $@Z Ő`8㿈'w%w/?2 p@8' p  <  @㰖 B ;`#\#h 3t p   < @ B -w+w)?5   㰆 #@@ d  `;`#\#h`  2  pt 4#@;c0 p   < @ B @b8Ӓ ΀ D=#=㰁㿘 2 ??#?b:b  : : : ?   # B#  ;? (c?8  @ B :  f?7?5?㰒b.`㰸 @    B @B @C@8    2 ` (``     B       892 `(`99  ``@ 2@b.`    ; : p? <  @ ?:c:#㿘J  @  @(` `(`@ b @ F (`   㿘?* : `6V*`k  €w@!@w@"p0Ow@#0Kx@ 0Gx@!0Cx@"0?y@!0;z@ H07z@ 03z@"00/z@#0+{@ 0'{@!0#{@"H0{@"0{@#0|@ h0|@{!0|@w!0 |@s"0|@o"|@l"㿘's   "@W @} 2$8@ @   " @ޏ$ <㿘   `" `2 @ ` ``   4"p' @ t   , @ " "@ "    `d#}b@  N r }ЖbȘ@ے$@N’ / "`N@`r2G }Ж.@$@ǘ`.@@А?,{ А@/G t@aaP  )  "} #"تa`t   @*  ` a*@ @#\#\@  `@ 2@@  }@h"㿈.` `*`2``   @  B  ` B  ;`  #hu}#\cX  t 4 # ? #v 4 @ؒc ##@?2?  ?##@ 4 ` 4}㰐##@,c f `2 `  4}#@ cZ  ` ,` ,`  @+  @D}+ 81  `8+ `82% `  4`$` *`2`    B@ @b  @C 8  @  $@4`   +  Ȕ  ‘+ } 4#@Sc 㿈*` @` `  `  B@ ` B `;``  #hu~c#\  t 4# v 4 2 `~ 4 `@ c8 ?` @  B   @ @  #B 4~@ #`x@]c   4 ( &@~#a0@N &@6`  㿈?.`#``l@` 2i `  ? *`2 @K*:    ? *@ :`  9~  7~  5v1 4;`#h#\!`p? &t?@儒#;`2~@!@5@@.@Jߐ ?, @Jې .`  4#@cc .`  㿈?.`#`` 2  `  ? 2`*` * @Ғ :    ? *@ :`  @ 3 4;~9~7~  ;`~~#h#\? Jt?v$`@:   @c@ib Ԑ @ΰ@ "`@ٖ@@c @͒@͖@@Ò@͌@J= ?, @J9 .  4#@c .  㿈.``` `5 #!*` ~~"ƒb谒 #  D ~,`` @ 2`.` ~29 `(6 @Ii# /.` t 4#@䂒c) /~-~  +v) 4`   #\;`#hX֔p? t?`@]#` .`  㿘. `E A ? = ;.#~!~ /@ @@R *&@sc8@i  4 @.c@c# @  t 4#@c `@5 2N@  @&@ 㿘 2 @@ 2  2@ `?@(@?? `0@ @! #esc8@ `r@΁ 6 &@`e@z 6&@`H@Ő 㿘  ``ܔ 2Jt 4q#耢 U"* d D j 4 ud 4`2`( 4Z!& (`,& ,`0& 0`4& 4`8& 8`p`<  B & <M6 p2( 4@!& (,& ,0& 04& 48& 8p<  B & <`26 p(`(@-,`,@(0`0@#4`4@8`8@ p< `p `䥔! 9?!@G0 B !@  @G㿘.>`  4 *`@ R`@G!%?, >ʔ@G!#?c”@G!c@ c@G|!Дuuc!@Gp  @ % 4䠙<  `@㿘@24|dlx #!?" $@z $ ` # #?PPP $!"!"x#!|"X Ԁu#a}"4( € #("bP$! @)!  $!@@0@A !T"T`P @ M!  #P "bP$!&@!  $!@@`@Aa ! $!,"T`( @n %!  #P "bP$! @ݔ! $!@@]@A9  !# # "P"! ?1"L P@  P@@="L@A Ѱ? !@a 6 a@@,"P@A ! < "Pc@@ΐ !@渰??$!$Ԁ2 !a@<؀   ! $Ē  @ ?2 $Ā2 $@?`2$ Ā`2$ `  `"x # # ""as#"`i}" *` €c? `  a"x #"!Z"b`a H>c? !""`"b` ` !Ā  #"` #>"!?;"a ` !"x  : a@ 8@%"x?""`% #1 #>$"`"`  : a@ 8@"`  ` $"` ` ?"` &!&!" #"a"`% # $̰ 㿀 #a   PP""X"ax"|b #  #!Ā`# #"`' $t?`" * " @  "t@6`@t# #aԀ !P@!  $!<    $<8  $@FbP$a $ `` ! #"Ā`!؀ @BВ @!؀ @Ed "  #!Ā`2 P! $ t@ @ t@"bP!x?$P|  $ d"x`"| #aȐ "a" b""X"`' $t?`" * " @  $"d !"bb`H@t@Ȍt;"bX"@  p   tp@   @`x#"@ #"p #a#\d#`#d#h"`?bX@ut@Qt$bX?c 4 #!Ħ `' #à   ?#! #!@^>? 4!$ @`Đ Ё㿘 #! #"aЀ 1 #!  @W    !@ߔ   @>-?@?  㿘 #!Ā`Pa@>Ԑ ?!` "`"a8@>ǐ ? 㿘 #!̀ 4 #!Ā  #a@] `P  #"!x! "`P"!a@]В P "ax $!@= #!Ȕx@> 0 #!a@> 㿘 #!̀  #a @   #P"ax"6$!$! #!Ā W 1 Q !a  @དྷ E  > b a@A ; 7$!̀ 6@=`".$!@=`"($!@=~ `E# @=w` a@>( $!P @=k`"$!@=e`" $!@=_` $!̰  # "P "axЀ  a@= 0(  #!a@= 0  $@=9 #!Ȕ0@> 0 d``"@^- bX@=ې 0b@=א 㿐P!`g? #à b  $``? WbP!xP "a| #!Ā 4=#!x9P!Ѐ #!x2$ #a7  a'@ 6&$%̀ #!xaĀ % #"% #  @  > @@ d@   $#!x̀ c(@=q  b@=k ?㿘  >2@ `(=  #!̀ 4 #5!Ā`21 ! #!  @߱   P!@ 8C 4 2 > <(>8@ b >8  !@ߔ   @d ` d?? <  @B0@(% #d@,x @' d@(ؐ d2@b @B d`(b @ @'g" @[!x 4"?cP '@  $ d`D  d`  @2 "Ѐ`@0 @ {-'?` d ???<"ؐ g @' d d@+ @#bȀ !?"`6" @ /bȀ b #@  "#H @fb  ?`H  `V?`@ M`@&  d@(  d @.  <@b  "`9!?" @ 1b "``@#  "#`H  b ?`H?`@  `@` @ @B0"   $ t@   $ t@  "b  "  "@ܣ " @8' @9   6 4? @@g  @ @ @B`@.g⌀ ["`W $ t `?"`@* "@@9 F$"@ 6 d  @ @ @tB@.=4? <ؔ @⌀ `"` $ t `?"`@* "@@ $"`2 ?"  @ @?B    @\b̀  @7@8n @  d`( @7 @1@% @Y!ȁ㿈 $ d?` '@-? @ d`0@ @-뀦`@瀦``, dЀ` 0@.  @+``% $'7@0@ "@- `   ` @ǔ  '@7@7 0@&  "쀢` @ʐ  @@-`0y"  t@t@  $X`ƀ"X  b  #t `?"`@* "@@ $b@s0Bd`@@hb   #t `?"`@* "@@ $b 3耢  `쀢 ( @ 耢 %`    `@ `@ `@) "Ȓ?B'@-| 8`d`4@wb @ "`@0h@@ 4" $?#P`d '@    d  a@6 y d`D q d`  kbȀ  @, c d @.N Xb    $`t@ b  "b  bȀ  @-  " d@.>  @  d@(  @zB  d`(@,y @{   !"  $ t@Q"P$"P  @X1"X 4"Ƞ `'@,k "@   $ d`D ?#P& " @X"`?bp?H? 4#PbԐ? ' ܢ '@,2 !?L+ /!?b)bh#H@M / /-@`-@,""b@UF  "@5Qbܔ@6- Sb< @ @bܒb@5 Fb@+ Ab@ <b@. 6"Ѐ`@, .b@10#??b'@(, 'Ȁ 2L"`=L /d?@Qb@5 0cHbؐ@% %-@@ڐȀ b   @c   H cb ?`H?`@  @@* ͒"@$F Ȓ"!?#H @%: b  "`+"ؒ @ܐ $b "`  @#   H #b ?`H?`@  b    $ t@V "bX"`"X@< @J " g"`c $ t `?S"`0V   ? @ @ "@*"  @Ľ ?bԦ  '@4: @50 @M 6@ݒ@*0"@ؐ@w@ђ" "` $ t `?"`@* "@@Y $"@p " @Ͷ @.@b @Vl#㿐 $ dP` ? ' 5- $3 "g?  @ `T ` E @4~cX b@䀥 db $€ %d` ``8 ( ` "` !c@4R  " @ϑ ѐ` `8   0c0 ?c@42 ?bX  "bX㿘 $ 0"`  #"*` * & 6@ Pp?@ $* @*`@"d@ܒd b " 9 $7 U@y O"   ` L? @3خ @v 4 $ `0@  #" $`0P"@*` *  . `@  2  ` ? @3خ  Pb @""@Š" `@3 ?㿘bx Q" "b $ d`&"x"x? `p  !`   "" `  @3q?0bP #""b`  "z " ?"x  @8p"b#" 㿘 $ `Qb"""x? a0 a` "@35?0bP  B ?b`"  #":#b Q? # ""`"a㿘"`a x  "` #"x "a` #"!  s " " a  @ :; F@@o  @a :@ D E@d ("`%"a@$@ %"` -" $"  : a $%"a$@ %"b@ab  %`;b8p   $ "`` aȐ @2~?㿘 #!`L  $ ``b@2l C? !y 7? ;  "B@ ""8"b(   :!# #  : "a 䀢   b8@25 0_ "C ?㿘b" "b@㿐  p?b " :   2 @"  "@fU%""` :`@ @@~  :?@ f @ B D (8. ""@:`   ` @h:   2@""  d%"b" 㿘#bb !" "@Ӓ " #a@e$b㿘`$" '#% #b"@  @@Tࠒ @?b@Tb&@@$b` 㿘`$'#b"@  @ &@ b@*b&@$b 㿘' ""   #@aࠒ &!?< 2 @ @] @ < f $ ` ( P@' ""   #@a &I>: 2 @  @P  @ :d $ 4`8 @0!` `  bx@0ʐ ">@ @0` @0 >?@ b@0 >  P@  '"` ,@廒  Ѐ 2  P>@/ @0  >'/0- :2 @   #\@Ú "쀢` :"   #" : $  @ d ` "@%@ Ē   P`4   `@ 4 ` " ?"쀢`2   @c @0   PX  * 2`  *` '     "2  @   @  Ѐ 2  '@/$ @0'#' #b@X #\@ <@ Eb@Nࠒ 怦!@.  @ @/Ҙ 1 P    @   ch @/ @丒   @@.  @/   c @/x   P`  `@9㿘 #a耢  )  $% # ! #g   :b!ఒ  "b? b> B@""8"b㿘"h"h ` 4+  1%"p"p"h  "h'% @3' #c@/ #   #   =bpi"!"   "b@=bp] && %' #  =bp M "b&& \@ `bp <`B=bp "@ʪ &"b$  ""bp@ <`C &!=bp@ʍ$" $`d @$"@N  "b?㿘! #!  1 #" 2?!=@v  $!  " &"`@@. ?㿘! #!  1 #" 2? @Y  $!  " &"`x@.b ?㿘! #!  1 #" 2?!=@<  $!  "  &" `@.E ?㿘! #"  1 #" 2?!=@  $"  " &"`@.( ?㿘 #!` E1!=@-j* @ ! #`! $2 !쀦`2? `2.1: !쀢  @Ր !`$!쀦  @ (!=@-B* "@@   & (& $@  `21! 2& $  @]  &㿘 #!`C E1 @- * @ ! #`! $2 !`2? `2.1: !  @ !`$!  @b ( @,* "@@   & (& $@ `21! 2& $  @  &㿘@ɷ "[?N V #a   &N?@&ޔ!=* @ # #  @  # # 7?! $a쀢  @ a`$a쀤  @&!=@ (, "@  @ ?` &@ @ @  $` $ $&@ $?㿘@V "[?N V #b   &N?@&} * @ # #  @  # # 7?! $a  @( a`$a  @&X @Ö (, "@  @r ?` &@ @G @f  $` $ $&@ $?㿘@!㿘ap@H   ? P`@  ?㿘 <    < & +& "*0.P(P$#"P(0  #&  &  &  &  &  & P   o @& &  <@!h ? % 4!?#P' @X '  'ap,'t@` $`d0@ @MȐ!㿘la@+ ? 2 L 2N   a@+ ?㿘 P   @   4!  P P@ @+ɒa? P,  W @"&, b,@ N,  b0@+ ?㿘`K bP@w   ?㿘 L h!    :` @Ŕ  & `  @  & ` @  &` @  (& ` @  ,& `$ @  $& `* @  0& `0 @  H&  P @&  8& `A@ : `;@ ` &L < (  @ &,., Y ?  W㿘@"@ 4"c'@" ư?``   :`0& ",    A4  #`P  A @  `bX A @[  !ǒ @R  ~#`   @H  t`   @?  k`    @6  b`(   @-  Y`,   @$  P`$   $@  G`0   *@  >`@   0@   5 ; @  - L  `  ``b     2 ,֐, 6 `b@*]  ? b@*U  " @L#㿘`m c@v    ?㿘`m c@v   ?㿘 @K"b㿘"쀢` n Ӓ n #`  :` @ E `& ` @ ? ` &` @ 9 `(& ` @ 3 `,& `. @ - `H& `@& `8& `6 @  `P:`& @  `$& `> @  `F @  !?# @ `*  * `& `N @  `V @   @ `*  , `0& `f @  `&`^ @   ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b Y ` ?  |㿘 @ "b  4"'?@!+? #?` ``0&"쀢`!’ @   `   ! @     @   ` "(`  (% ##`P   `  b ` ;@ 6 @   `Òc,   ;   ;@ 6 @ b  %   @ X      @ O  (   @ F  ,   @ =  @   .@ 4  $   &@ +  v `  >@ !  l'? @ `2 @ F @   _0 `  N@   U V  2  @   I ^ @   A n     n  $ )  "c@    # 2! ,, & , $   6 ch@(>  ? c@(6   @I#ȁ` (:`((!Dž0: 2`(0 ?   ?㿘ڒ  "!    S;` `*  & ` `*`@& ` `*  & `  (`*`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `*  & ` (` *`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  ;`*`+ 2 *  @ :``, 3`@`H`8& B&?&E :  $ 3` < @ (@ `P   &,.,   `  b` ;;   @  b  ` ?}  &p 4"?c'@˔ !B?  ?  0& Ѐ J  `] [  P * 2` * 2` `@  c * 2`   ` `+=  `-5@ *   - @ (`(`(`(``-) c, ; ;  , ;  `***   : .`.`.`.` )   =(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  2 *   (`(` ( 2 *   (`(`  , 2 *   (` {(`  $ 2 *   (` n(`  0 : *   (`a(` @ ::: *`@ `**`@ (`(`(`J(`<  *` @ (` ?(`d  ^       "`    $ 2" ,?,   , "   6  `(@%  ? `P@%   @Gm klXlllllllllȝ㿘#`   c.@W 6,`@\ #?@$"`  , ( @}  Ж@%  ?&@. 㿘`D "`  , (  @:b  `  3& ␀  @  $ h` $ l`  8 @   @@  @$m @%I (, @܊  @$Z @%5 ?<   @B a0@$ ?㿘`    @+  ( @Q "`  2    a`@$Đ   (@. O#"`2Q @@`@ a@$ @?<  @ȸ .#0 @+ (#, @#԰?@$ 0"И@$ ?@#b  `@v`   @R     4b  '   ` ["*` €@# @$k *?"@! "耢` @#?,@ۗ < ( @/ 2' &`0 `0 @@Ȓ b(, @S b`@# ?"%@#2! @ ``"`  ( , @ؐ ~@# ?"`` (, @ʐ , @o `ob  "  3& "  @ѐ%`F) $"@;" >@Ϗ  ("@ @" @# @ c@a"  &` @l ) $   h ` $ l`` @Y  h  $ l`"  8@ @   @D"ȁ(@ڢ #"`2*?<  @= 6 ` @"]@*'   @"O@#+ ?(L /?  / )  @@  6,@W 2 , c@a@ , @\ / ,@? @ޒ! ",?( #"""'$ 3 $`h  $ l`b@ `h  $$b $ l`b $ @! @"b@IJ  @!0@" ( #"(""( &$ 5 $h  $ l`@ז h  $$b( $ l` $ @! @"@b(  @!0@"s 㿘@C 6" "@#` @!}` "`@Ň 2 ?@!nh@"J ?㿘@Ĕ 6" "@#` @!S` "`@] 2 ?@!Dh@"  ?㿘@d 6" "@#` @!)` "`@3 2 ?@!h@! ?㿘o@(  @!@! 㿘@0  @ @!Ӑ 㿘\s) 2 '&@"&`(& N    L "  2'<`  @ؖ  >@ 4#7 "#  c@# @!` $c@!K ?@$*@@˔ @ @!_ ?2&㿘!??@Ë    #@ h @!D 0b8@ꠔ   @ X@!4 㿘@ @?&@"`  8   @ 4 ?c  4"'  `  &c  ` 8?# :D @ 6  `@ @@?  ! P      `8%? @Ӑ  @  P @   `h@  ?  @  @  @  ? &  @B9 p ؝㿘"  "b  ""` ""䀢` @" #"D`@, "b`@ > ?@  ?"` @? 6 㿘 N a(@  aH@  ?@g?`$ #N /".  #bD$$ $ $ $  #bH " "bH #""H"bD 㿘 #"L` "`"Ā` "b "` `  #"P #b@ @  #L  㿘"` @3 #"D )' 4%  4   4  2 `2 @!p @  2 㿘 #"@ + #@X$b@!%)'bD`  #"@=, 28?"L "&"L  &"L-?"L` "@@؂b̀  "L@?!@ 0@'@ bD@"L?@ 0 $"@] $b@ 㿐b % #"b % ## #@8@ $bP@` @~@[  ٰ? :? (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX` 5"Г*` €"`bP @ @ bP `O0bP a@ 0bP  bP 8@# 0bP X ., bP   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X;`X `;`` h ;`h< "9"20QRbPbPM (-  PAbP08;bP" 3&  @ 8@ )bP% # @ & : & , @1, 6 ,@bPp @ 0'&,  & bP @,,&,&bP `&  㿘"`)"% 4X'`? $`@X  $X *`@@0 = :, *`,? ! 4@k&"X *@ 2%,X `  2,0  4"X`? &`@X  $X@2`b@  (b 4"'  "`" @@?`&@ * &@^@b `@ԇ "Ԁ2  `(;!@@##(@GR`(@ti @ /`y `Ԓ #h`   #`#dc8#\ @՚ ` ? ?` 2   `cP@Đ`8c`@@F`&@  * &@ @u ?` @(#h, @h  2 @#p, @\?`&@ * &@Ȓ@Vb @>#x8b 4"'  @;a @v 4##(%@@F@sƒ @ "/  @Ē#@ǖ  @>#㿐@V` N N N @@ N 2N0@   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0(2   0(2    0( :( ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ?    *    J ** 㿘"$c "b`4`I?"$J@ - 3 b( *b( "cJ"(`@3$ . :  "$"$'?@  :2J @ 4#c؀ :2.  3Ā  4@#c@  ?*@$"ı. > ||<Hp| 8888888888888888888$D888\88t88888888888DX8l8888,DP8$hh0<hHThhhhhhhhhpDhhhhhxhhhhhhhhhhhhhhhhhhh h$hhthhh$h8<<DXXXXXXXXXXdpX0Xl0XX XX0XXX`XXXXXX0XXXXXX`XXX`X X`(@HXXXX㿘@@" /`""`@$""@ X @0"@ p @X0 $"@P  5\- $`JW#*` €R#cb@ !$"x`Jb`@ @B "b< "b7c""bP1 "b,   "b$@ "b "bcb@ 0c"-* : `#X*` € $" h  $ $" l""# h $" l  "b  "bL`@ @9 L  ݤۤc@Eb Ӥ ""ͤ  ""Ǥ   "" @!c"# #'b"X @ H $ "`d"`@}  4 !@Ncb '+@#@(  `H#@?a00M!8"bT!c@F":hh h"  bha@@N @bh a aX @B"@g ""a !c" @ސ!  #?T"a@b" # N"aa@  0c@ b A "";   ""5  1"bH@"", c@ ^b $c@ rb  ""  ""  ""   "" @W@[??B   4sې" $"`t !%`qȐ   @@  !  @  ! " %` @$@@ `` ` ## $"`d``A#D*` €! 3! 3#Ā7#Ē *@@ #@#Đ $#0& 3#Ā@a@k @?. @"b#Ā ##Ē *3@ #@#Đ $# #"!㿐 $ " p'    ) $7; $`J ē*` €#cb@!` $"xb`@+ @"x* $"x % ` #"!c bJ@ -2 J` ""P '""P'e  ${" ly w  "bq" m"bĐ j% `c@b e@sa^% `b Y"b U"bВ  $" lP% `4!8 $cL"`"LD""L @"b@@-`  c @b@9X cbL,"?'"? #"b!' p "b"0"bT"@ "P "`"p"""bP@۔؀?H? 3Ā *`@ &  ` 2 4 4# 4"'`t `?   ` @9  `   | -/ $;9W7` 7@~b ) 4"X@f8" ! @A@ !@  @@ "@~ݐ ",@", %b@" @@@~Ȓb 2 @`@`*L%L %L `L@O` 6 @@ @@~  `@ 2L`""L $ ## ##耥 "`d@p# @Z"L s+ #  n+ #@Nk` D   !@>!@~a"  4"Xb@e !b @@& !s @@ "@~= ",@", +b@ @$@@~(b 2@`@ "1%a`G   $@ $`L  "`L :` @@ @@}b  `@ %a !"P "J @ # $"PJ "@$"P(#%+<@ؒ@RL `?,@5K @V`@!  @ ?    @   ?` /,`ΐ P ! $ $?#$" "`"b#b"l#"P     /9 3`D"*` € "b #"&" "b %``  "b &l ##X  $"`d%`` %`` "b 4" $"`t%``& "bw!8 ~%``z"bxc@_Sbt"bx!c"@dmb  %"b@u @%@ @Ő @,`V"b@` @OcbJ - J "B%P"?%P!c"# #'b"X @ H $ 0"`d"cP@9  4 #h@ cb %)@@v(  `H@!0@ "b"0 "bT #" $"`d@@(?=?#``* `G@!*` €@ ? @;` 6@@@ 2@01@  a@ @q@"b܀ `@h@  #@b #"!%! 4 @""X ,  c@ @M@K㿘"! 4c@#   #"XJ 6 c@#@ 2@ #`?"`# * $#@- 㿘@|<@ #x   x㿘 #"x`c@z ! 41#@  2@ 㿘 N  `@gN b@W :?`(b@O @0?L , ' #@{̒ , 2,@@{ƒ = @ 䀤`."@ "`"` ` #x |"x"  $|L ې 㿐 @g  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @K @  㿐@bD  2  J?` '@e  @n@* "b,  㿘 4c@T @@5 㿘 4c@L"x@5 㿘 4c@D#@5  㻐 4"' "N  a `L@` @`\*`: @2`ha0@  aP@< u?,@@݂ @)$a@( @Ő_?`,@ J \2N2 2 *@P @*a0$ $J + !*:  P" g G" 0  p"0 $ $@( @,@!@ݐ ?J   $`X $ $" \"`X  $`\ " "`\" @4!㿘 N  a@  b@ ?$@$  $P$ $ `$ $  $`T " "`T $" T"P 㿘 $ P  )' 4%  2 `2 @~"0 @Ē`  2 㿘 $ P`  "Ā`   \$  W "`22 P 2 *`2) P2*@e8   $bh@A  ` /*@6$  ` /*@$ @?$ J / * $ $ &  P       2    @" &b@ ?㿘 $`P  &"Ā`/"`4?2   #@.         J@ /2 @] 2  bb`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ "`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  㿘 $ p` )/ $N  /&`p .  'N   . @z @g&`p  $`p @`p `pN  /"N `p 7XN, /3X` ? ,X  .,  'N,  ., @G, @4,&,`p  $`p @`p  XN, /X? (N, X  ,@ؖ  *     , ,,@ǖ "Ѐ`@     ,, @,㳈 4b "'@n"-+)'%!o@c @acP@_#x@n, :@x0㈀ @R0@͐,O@J#0〢  .@C##  O逢 @8#  @3 @`@w,,&,& ? @2 @㿘 @ ? ` ,, @ ? 㿘N@`/ "@l$&@`P@ ?  ?*@  * . ?*@ .   4" $%?`X''L@w{, F D@3  @ 2  ,@` @* @#@p  %?W`p@ Z L@ @"@  L    ʐ    2ª  ?@0,@` @@L  @,@L  $`@ % O  O耢   4#`@| O#`Д@|O耢  @vL"@  4" @1 㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @f:&* &\ L㿘 @!  "b@A @e"@Ɛ! L@ !@7 ' %J?`/"?@  $a@ϐ A⼀ ؒ@" /* "\@N &+@a % $ `` |*` €Խ9"T`b@ א S⼁㿘 "b "b @ 0bH@{ _@"`@@0  h @S   ?@В @H   ?@Œ @=   ?@ @2 2?@ @"h   "@   ?؄pؔ""  '''@   Ȁ    @z Y @s  Ȁ    @h G @a  Ȁ    @V 5 @O  Ȁ    @D # @=  Ȁ    @2  'ؐ @) @#    @ ?@  И\Ϩd㿘 $ ` $@s 2  $ ` $@ې 2   $ x`" @   㿘 "S?N # $`   !=@c  $`8bN # \N  #" @ܐ 2 c(@ ^ ,?  @Հ @O!=@ `, @ " 2@  `cH@ : ?, "  "" 㿘 (!=@ } $`* `"  @ 2` `2@ 㿘 "S?N # $`   !=@  $`8cpN # \N  #" @ 2 c@  ,?  @ @[!=@ 4`, @ " 2@  `c@ Ȑ ?, "  "" 㿘 ,!=@  $`* `"  @ 2` `2@ 㿘  N c@ƒ / "N,@`N & ?А , *: * :  .2` 2` @ o J 2 @5  ``8 L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ `h@ 6 S`L@  @@f N$`$ @ 6  ` $ ( $L $@~  6   `@ @$  $  @ `Д@  @? $`x $  $" |"`x   $`| " "`|`@  ? $x`AH@` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@N`   5 J?   ` 2 .2? 2? J 뀢?@5  @ 2?L?Г* @L *`В@ `=r$@$@` k!Г*` €N Б* N * ?Д * *  * 8$` "NNБ*` N * `?А @$` ?Г* @N *`А@$` D  d$`N?Г* @N *`А@$` ,  )?$`N?Г* @N *`В@$` ` `""?N?Г* @N *`В@`$`  N?Г* @N *`В@ `;$` ?@9&@?? 㿘1 $ 2 )@’  &  ax@ ΐ ?㿘 $ `r%`$`g )@ `-  :      @ 2  @ 2   , @r#,l&,,&  `  &  ? $  $@@$ @C  @]_  $``$  `$$  - ` $ @ $  "@ @a@ U ?㿘! $ 8#`$`3` / - +`@ ) *  "  2  `   @ 2  @ 2   #@@㿘 $`   *@  "@`@@`2㿘1 $ 1B !G@֒  & a@  6?"! !1* * * * * * * * * * * * * * @u" $ "`"@Ѱ 0 @"ؔ@ ِ ?㳈 4" $` ' 2  1@'G- @`<+@2(``! $   @ ` `   @b0@  ^?@(G@UJ ```2@`  @`  B$`@ @%  1! $   @  <` @Ҕ  @-  $`$@ $`!" @`@y@ V  `@pHb@  `?@? @*Ր"ȁ㿘1 $ 2 "@  &  b@ ?㿘 $ `c@ I @y"`, @`0` `@@p 2```@p + @n`@[ &`c@@ @[ &@@[  &``,   &` " @N@@Lc`@ ?㿘! $ @@+" * @ @pB 2   @p &@&@ 2㿘1 $ 2 !=@e  &  c@q ?㿘` @  ? 㿘 $ `-!=@`, @` `2` " @  `, ""  "" c@1  㿘 $  ` }  @ 2  " *     +2$`& `W& `R   B`25 $"5 $@ 9"" "$ 5 $  &z   @!q  cؐ  &` @  `"" "$  &   &cؔ @ `@  㿘1 $ 2 !=@  &  `P@ ?㿘 $`   *@       2<㿘 $ `6!=@Ð,`@     2  2  @%  @ZA  $,`$ $ $ $  $ " @`@> 㿘! $ &!=@ *      "  2  2     "@ & &@@0?㿘1 $ 2  @""0 @@  &  `@ ?㻐 4" $` ' = $ L` $N / @  2` $ !`"0@2 @N*` "0$* $"0@Y, $@  @a@  "` 4` `($``  4`$`$" @(l!H㿘 $` -  $  $+) $' $,`b     h   h 2l    @@$%㿐`@  @6` `   *  `'  * @t  ((44T``PPP㿘 ԟ$ $ J@" ?   " @   (  ((( ( 0(2    0( :( ?   @    *  *** * + 3` ` 03 *   0*:* ?  !    㿘a$?N a!@Q    j Ւ"? "bH ?㿘-)'+/$%@lȒ ! @l’᠀   $ a@  ؔ !``?  @  ? %Do ۢ! 㿘" !ΰ? @    & $ &`?  ,@j d&, ,`@b d&,`d   / &`l   (& `t   ,&  `|V  P 8  ` H&     ; @& 8&  :N` `2 `5`0"D., 4@., "5;`L4:., `K&7., N`(@  & X& @  &  &O& K  P@" a  b& 8 6: @&  &.&., &,K /`  `$` &  & & `P@`  a"@   b  `` & `& a : :K /2 +?& 㾈  4 ` '-#*` €"D`$%İ  b0 b` b b, d, b%   d b !@  d ,   :?, /,  2  1,,  d, d   c!P ,d  Vc" @  b a:!   `dƖ < (  `l 3 ,  `t * @  `  !! `   ˒!    ?       c(@C  b @$#P㿘 ?  ?㿘Ԑ ?Ԩ  ?㿘a$?N!Y N "?a!@N  2?  ; "? 㿘ݒ"  ?# `@' `$ & `& NaY    ,aY /, `?  ,"@@a d&, ,`@X d&,`d   / & `| W  P 8  ` H&  @&  8&  ,.aHa)՟ 6 (`t Ҕ & (.a(a 1 ``l Ŕ &``  ;@ 8`0& N``L#*` €  @K     $  &&  & L /2} &y,N` 4 `  ` `  ` & & aI }  aQx ?c , *`  0P&N` 2   (@ & B& `   `$ & ` & 6& N` K  P@" a  b8 & :`P@`  a"@   b  &` `& ` a: : 㽘 4 "`'`BcX``   , d, 5c @> c* !@'    :, Q, /, ?","  dܐ ?` F*`  € 54, ` 4 3, 0 ` I  ? @ `2 @Q     6, ` 1 2,,  d,圐 |   % `  0 7,! P @" a  b   ;@|    ca @~c @y`(l `  !"4 "4ӱ#耢?}8 "8c@  "4 D  k ,t 9  !"< "<#耢?V@ "@`0@ "<   D!   d  : @     21 ( Ҡ  @  ,   @)!Y   !  e  ?       `p@  b @"L `da ?J/2 J"`4 ` 㿘` @g:@&䗒㿘 @  @_`! $  $ a@W $  "`@l @("Ѐ` a`@0 ?㿘! $ 'H'L'P'T'X H@n@F 㿘`  $ @M 2. ?@g 2* 㿘'P'L'T'X L "b"` 5 41"  $@`t@s &""a(@m,@nS@e 㿘'T'P'X P "b"` 7 41"  $@`t@J &""a(@m@n*` @]a0@l@2 㿘@[X`X 0Pp`phx   $ 4 D T d t0""@  ""!X!h!!!"$"4"D"T"d"t 4"  '//'  @ȷ Ѭ '|'x"aa@ @@? $a@   `#c%Ѧ+ $/Ѹ'l; $'t'p'h'`'d 3* (@€b   #@Qр" bb@  $'|$ @$@Q  !"8@\ @  4`$b@J b@I  @܈b 2 bb@@А  / , , ,"$b@|d !8 =`a@ bb`@ H `@  `@\m bx@ P)=` $ $(/ %(@ " b@\M b8@~    #@Qio bb@n  f$b@u$_ Z$ V$ R$b? #  @Q@ $E# bb@D  $b   @Q,2'xbb@1  $b   @Q/bb@ !$b   @Q# $ #`bc@ @@z?? 3#ē* & @ @`DaX"`T`T" " Ѱє    HD" @#!+!. & & & @H #`@ۀ 2 c@Ȑ .  @ @eB!"    $c0@ ` "$` @j' cX@c    $  @ -`@  @?c р##`P < 8 ( %( "  +` *" "" @Y  c`@* 쀊 @?c @ 쀊 ?c @ @?c$@ 쀊 <  8 ( %($ d $ dch@2 +  @Ø  P<* @ *@@ x"`P`P, |4 4 4  , , $ $  $ 쀊 &<  8 2 c@  ?   '/?//??? l @ ( 6(@bD#@o (   @n  (`@ (   @^  (` @ (   @N   `@@p  '!?##`@a ``@_ @'?#`@,  '?`p@N ! #`< '``@C  `@  `?@4  @k   t@M'ѐ $`@  ѐ $`@ǒ"@ Òa\@ Ò"(@ @2쀊 2@b  4`*`@  cX@ #'쀊  @ ''@P 2 * +  & p  @  ' h@`  d@>`@a`a '@ h@ @  ` @t@] @o 㿘@@<Òa\@  a !@ ђ`T @h 0 `  $ @ `"  $ ǒb@ @l@"㿘@ @Ր @"?c 4"+ $`' --  $  5 a`!R*5  h5 @4`: @4`   *@$* %,!?# @#' ##' #`#* #* #*  #* #*  *  ** $  @b`  5  P 5 @U5 aђ! @|  쀤@`!`?#`p@gV@a@ĕ    $`Ő @ċ  @ %@!x@Ԛ  -  @  쀊a@'!@0&@  P@ a$   V"  / / / / / / //?" "@ ''Вb@ ?? $*`" * "* * :@B:@$ $ $`  ؖ  ؔB;` $( $8 $   1 $  :1 $  h@: M@ <    `?"' @:  @   *@ -  쀊`e` $`Đ @ǔ v@)'@!@!a$` #@  @# !@Δ `@ɐ" $  $  `@D @ ༒@"༲ @ 6%#` 2 @H @bP༲`@  %`@  ޒ` 쀊a  *  @@a @@X@c +'  "    `D " @_"p  ?  %#`' 4` ?"`* "@'     *   @ *   *  @2x@I@+b?Բ`y?    @?mc@ `'c@ `'쀊  `'`@"R%`'c$c@ $c@" %#'2 4` ?"`* "@     *   @ *   *  @ːx?@?@Đbմ?@"?@ ? `@"  % ? 7 쀊  4 b`?"`" * $"@{ @ "`  ` `? (?888* 2 ?cx 4"?c' `/  4 b`?"``" * $"@= @ː" b@V} ?#`@d֐?#@Vk?#-Ѥ@dƐ?c @VZ` (@d@VN`  @@d@V@`: X@d*?'`&'B' #B` B()#B ?@dq??#c @V?#c@U f?!$``  $ @~ߖ  $@~ؔ @@ @[d $?ؔ   #@~’  @y#  #@~  #@m $#\ #@~#` #@_#d #@~#h #@S#l@c@U?#@@6  4 @e#㿘     (   @~f@B: 2   B* 2`@ : b`D 8 怢`  㿘 @    @`? @`?㿐`ݓ*`#8 €@ 0 `O"*` €@ 0@ 00@ P0@ x0 `@ 0@ 0@ 0@ 0@ސ!0@ڐ!0@֐!00~@Ґ!X0z@ΐ!0v@ʐ!0r@Ɛ!0n@!0j@"0fc"0@"X0`  00@"h @" @"  @" @" @'@#01@#0M@#  #@@| 0D@x#h0@  #@j#0@f#0   @]#0  (@X@ 0@R P0@N `0@J x0@F 0@B 0  @= 0@8 㿐 @0! 2` 2`  @&!H 8 ?* 2` @!h  !x @# '@N@a @G' @a,  ! 4# @a`"`?"`" * $"@̐ 㿐 쀊` ' @A  @'!8#8@b_!#8@'!#8@bR!#8㿘 * `  * *`@ @!0`   * *`@ @!؁(N@ ĠȢ̂ЈԖؘܚ 5HВ `@ ` D `@ʐ H 2H#l;p#\#`#d#h;x;#b8@; ?#" 8ф @ @ `. @ (  쀊`@;"p @ #@3a`@&@,#02 2 0((  P``? 㿘 4b@b#@ 㿘@(8(((H(((((((((X(((((d(p((㿘c@e /%#)!+-1 4'5 3-9р 8" * |@€ $D!$aH %!@$!0 $aH %aL %4$!0"@A,   $!0   4#@bDc @ @z?А?D* `@!@ aH  aL 4 !0 @0@h@aN" cH@ @i!8㿘 4ђcP"X "<+)'%Ѣ cX @\cbX  #`@C h@I$8  %<@ ?4 @a 2㿘   % 4$` !L`` 2  !H`!D`` cp@a `@2 ` ` !@`` $?"`` $* $@ $Ȓ`+!4`` ^?"`` ^* $@ː ^` I?"`` I I*!0`k`/` M?"`` M* $@ M` -?"`` -* $@ -"j ` 5`А `  `  `/` ^?"`` ^* $@g ^E` ?`@`? "`` *:    * `? "`` ,`:    `* $@5"  ? & @`M  &  @ !<@#h ѐ "8 6  `@cH@@ 㿘 4"XR ђcP "<+)'Ѥ cX @[   @ #h@$8 T` %<@T` @- 2( 4Rb $!`)+ѐ@U cH@ d*$ @%a, %!cx@ %!@@ ?2H@ې @!@7a,? 2  !<@#hѐ "a8㿘@12@22x2222222222h222222222222222222224222222P222222X㿘      @ @Q `@?J@ -D  J@ * ?* : `,̐ *`       ѐ  "cҐ "aT  @ɐ @`J 2   ? `@ @!X@Z  (?@c@x Ґ!X@Y  (?@c@l  `#d!$!@ " @Y@ 2$$!@?`!@  $"!*  # @{ @O@ѐ ` @!X0!X@ڔ@Ð  $ @b  @@ !'Ґ"X@Y  2Ґ"@ @ !l?" p " t@@Y`  @@ ?`@  @@Ya@ @" ` @ #`"@Y@ 2  2 !< " $   2@`@Ԑ `4  2   "1? ?@` `@ € ?`@` ``2 `0@ €?`€@ 8 "8?` @  $!   $!  P@ " X@Y !D@|  $@ 1!H  $`X@(  $!  aX@X !D @| `h@ @ 㿘! $!?@&!D @ Ҁ "aD?$!$!㿘 $!#aD %0`x@ @| 6V @^`aD az@| aD@Q"@| 6V @ "?"PaD0a@|r 6 @ """"aD0a~@|b 6 "!"! h) 4"'' Ȑ@: $ @X]D%0 @|C? @  "7?@ "1?@ )?`@{ ؐ @ '`@p D@|?`@e   `@  @'" @C h# 4b'7 Ȑ@:I $ @X!D0 a@{?2`@2 @ @ @!b @!`% 4' Ȑ@: $@WҔ `     @C6Ā a @< L -  @WӒa@ '@b !D a@{?aP@  @͐!`㿐    " @B ap@ǐ @I J? 5 А     ?@AY ax@   `/J? 5 А      @Wm 2  @; 2 J 5 А    "{  2Ұ  ! @Ӑ   @  @n "  @Ð   @  @^ Ҕ @W !X @W      E &B @  ; "   @W 24 ` Ҁ`!@`")!@   `V @2  @  #d`#d V @2 $ @  $ 2     W`@B`@  4Ґ#a@\cX@ 㿘А !ҒaX @V"!D az@z"?a@ΐ 㿘!ҒaX @V"!D ay@zm"?a@ 㿈  ?' 'ҠD#0ax@zW?a@ @  a@ ax'D@zA'?b@ 耢 4' @ ` 4` ?"``* "@8 @Q"(`@  4`?"`Ⱂ * "@  @$㿘!<H`"!< $ "a2ѐ "b!@8  2`€㿘!@` € 㿘!@` € 㿘!Dє "@yʒa @"0㿘!D@ "@ya @Ԑ"0㿘@ Lѐ  $"L""a㿘!< !H 2Ҁ`6 !@   @ Ҁ`"!Hђ  $"""""㿘@"H㿘!@ !< #!<p% 4'ђ"@ww #aD0a@y] `@ aX @UgWҀ`"P @@"PP  7aDa@y@ b@  @x"` ҄ld dld d㿘!@ 㿘!@㿐И"@'   @@ b@ @GR !@R  b@ a@U Ґ!l@" p " h@Ua Ґ!l@" t" l㿐!@R   b@\ Ң!  P`@  b@O @> ax@     2 @TڒaX 2 ?? @@ 2 2 c@' $` @?$` 㿐!ҒaX' @T"   #@@""c(@ !D @xpa @#8㿐!ҒaX' @Tv"   #@?ܚ""cH@ !D @xJa @f#Xh# 4b'  $@ҒaX@TJ N @J? 5 А    ch@ @T.  c@ !D a@x ?bc@X  @E#ȁh# 4b'  $@ҒaX@T N @J? 5 А    c@g @S  `@] !D a@wǔ?b`8@  @  H㿘N 0    4#* R  x" 2{ zN" 5 А@  D "  5 А@  D  X@ m   p@ a 8 `  5 А    Д `  4#* R ?  `* 5 А    Д `  4#* R ?+ N \2 `" N @S; 2 ,  N` `@S,  $@ 6&"@В &㿘 `   0   4#* R  x#0 5 А@   2 ` ` 5 АJ   2 ` 2  @0@   @  &`# 4b`'Ȓ @l ! 'Đ 'Đ Ā b!/ҒaX @R"!DȠ"$ 0a@v b@ b @ ʐ ؁x# 4b`''7@ΐ  @b@˔ ҒaX @Ry!D a@v^?b@y!b @ !% 4'@4 8x@4 @ '̀'b'! @6 '̐!'Ȳ .`А?``"@ NҐ!(@6  2NȰ !'N  5 А    ( N  :$ *: ?'̰   'ta8Et /t.`" " `` N @t!@'t +t t''ҒaX @Q!D a@uД?@!` @ !px# 4b'ҒaX @Qː!D 'a@u ba@  @ !h% 4'ҒaX @Q#aD0 a@u aDa@ڐ  'ؒa@u a@ΐ  @ !؁h' 4'@<ߢ %ap@ a@5א `a@5ϐ `a@  @{38 @iҒaX @QV!!D0 a@u; !Da@  'ܒa@u/ a@z  @ g"h' 4'@< %ap@c b(@5 `b0@5{ `b8@  @zߒ8 @ҒaX @Q!!D0 a@t !Da@2  'a@t۔ a@&  @ "X㿘 "h, @5:    h' 4'@<# %ap@  ܐ 2@b@.  @z8 @ҒaX @P!!D0 a@t !Da@Ԑ  'a@t} a@Ȑ  @ "h% 4' 2b@ ҒaX @Po!!D0 a@tT !Da@  'a@tH a@  @ #P# 4b' ' v c0@   cP@ ''ȠҒaX @P)!D a@t bcx@Y  @ F#x# 4b`'?#@2D?c@ #@vbҒaX @O!D 7a@s۔?b@#b @ #Ёx% 4'ҒaX @O֐#aD0a@s?aD@֐# 'a@s?@ɐ# @  p% 4'ҒaX'Ԕ @O#aD0a@s?@#   #@;Ԁ'`@ aD a@sp?@# @  (㿘 "@@푐 @0 "h,   @턐 H!8  㽀 4b7'☒  @'$ X @OG%D0@s,a  8@X @O7D0a@sX  4@ԐX @O(D0 @sa@  @ŐX @O#0D@ra('  @X @O D0@ra  @X @ND0@ra  @X @ND@rӒa'  @X @NސD0@rĒa  $@{X @NϐD0 a@r ` 䀢    `` 4+ 4 P@b Ȁ 4 b@ `~ɀ8` ?#@@춐 h'P7 @Q  H $'@p7@졐x8@0 |H@pt X @NqD0a@rW ,``(` "!''aa$"7ƅB' B'@@h `@d `    @zb ,  , $    $@ !D0a@r ? @`bd   `  , @ "  "  5 А@     :"   ! @2j   @   4` ,?"``* "@Ԑ ,,  ` 4! @b    ـ h ! 4 @"h l @"~ @`Ȁ ;! 4"@ې ̔"@` !@ђ"!8̀  @맒  @Ē"Ѐ  "(@"!8Ѐ " @둒 "@!!@"؀`   4!(@b䀢  P T@o!0` W !`"@@_!P!D0a@q ☀  4R  `?"``Ⱂ * "@#  @ah 4`?"`Ⱂ * "@ !T  4@  4" @)!?cP!P- 4 `'%?#` e %?@/" )Ғ!X @Lڐ'D a@p  @ L`@!G`@/ Р@/>>'!X' @LD0a@p @빐!,`  @Ȑ!  ` @꿐!?#А@& 4` ?"`* "@  `|`!? @!㿐 x %  4 @ꊐ"@  4`?"``Ⱂ * "@W  >@p" x  @5 @f"   S@- @^"0 S`" R''c c($"7ƅB' B'@@<"@ d R@7"H d @1"P B  B `2`@'"` 4`?"``Ⱂ * "@  ^?# @`6 ^@bbh 4`?"``Ⱂ * "@ڐ  x    v* * 2 @Dch# 4!8b '"ѠȒ  (@`ҒaX @K!D0 a6@o  @^ c0@ݐ "## bҒc@X@  @#X㿘!8 !h#c` * !$cҒaX @Kv"c"!D0$ a5@oX cp@ 㿘!8  c@Ր  c@ϐ %c@ɐ  `4`@,`$㿘z!8 )`@ #?c 2  @`0@ ,  %#㿘T!8  `H@ "`x@ #@ "ah㿘:!8  `@q "`@k #@ "`㿐 '!8  a@W 'a8@Q ?# @ ` `    @66a`@; *` $x 2```2@"Ё쒈 @2  22"㿘!@N? ΐb@ 㿘 $!@;? c@ 㿘@5Đ  ap@  @2 ?c8@ɐ # @ @ta8 @zM㿘  `@2   @. 2   2?㿘` i@@#X"#`"@m#@2`H $!`@` 2` @ `#h@ 0 Ԕ` 2*`?# @ # 2!` #x#"@@ `H!8"@`@ @?# @ `` 2@6 `@ݐ#p) 4"'"@// "@~RҒaX @I!D0aK@m : @ #\! @y c@I! # @y#\! @y c@Ij!#@爖" @#؁) 4"''ҒX@u !R @<"`@g!@!䀢`@`!P# 4b`?"`b * $b@4 ``  `  2  ` @ @@<!`  @}X @Ih%'D0a@l  @} @ !p@30 Ȓ  (@}X @HDa6@lؔ 耢 !@ZX뀦 @r8  Da@ a6@l'쀢 6c0@  @!ؒ  ؀@;b`?"``b * $b@ b`?"``b (* $b@ ( w b`?"``b )* $b@ )% 4`?"` * $@  Q@昐!# 5 &# @2!#,`  2  H!"@  @ ` `  @m ` آ`#,`  @Y!В`?"` * $@. # '  @   2耤2@3!ؤ @/!  @(!`@ ` `@x !@  @ 0#d` #d *" @  $ 2 ( " @!x1 4" '#aD  %@| +"`x@ +ҒaX @G)Ѧ" @{ '@@͐aX @GaD0a%@k 6 @Q 1@桐" @|9 /"!,/P )" @{АaD0a"@kj? aX@0 12 @| aX@z"aX @Gj" @'ܒ@児"(!,@倐"0P 0#Ѡb @{!D0a#@k8? @ 1 @{ @H"@Ґ"aX@G6 b    4'@ܒ@N"P 4`?"`Ⱂ * "@" " @D"`㿘!@ €  $ "a ?? * " * h+ 4b'' D   @ޟ +,b`x@ ސ  #\! @wD b@@F͔!"p@!P @В ! @{hҒaX @F @{D0Ha"@j @b 1"@屐" @{I  / / #\! @w b@@F!"@䪒В ! @{)1Ғ!X @F|@zĔ D0Ha%@j^   @$ 1 @t"  @ߐ@䄐" ! @{!X @FX @zD0HaI@j9  @ 1)@O"& @`" @Z" @T# @N# @H#  @@B#0 #@@< $! V ! @z!X @F  @zTD0HaQ@i 6 `@ݴ 1">@#P9  "2@8. @ #h` &@"#x@"(@#@#@ &@"#x@"(@#@!b @#㿘 p $!.`# 4 b'@'  `, , `$ @4 /  @ٖ ؔ @J8 c@ @4 '$  @( !b@ @@y b@  #@`  @p:$ `@ΐ b @{#ȁ㿐 $!.`   '  @0 cؔ@  `, ,     @y˔ 0$  * "@  * *㿘  N 2 , .`#@%2, #@2q 4`?"``Ⱂ <* I"@ <FN, 2 : :  4` ,?"``* "@ΐ ,* : $  4"`:?"`` "* #"@ * :  4NN 4N` 4`?"``Ⱂ >* "@ >㿘`U O`. 2 : D  4` ,?"``* "@l ,@* :` . :`  4#* R  4"`? "`` *:  "* #"@G `@* :` ݕ:`N@N@ 4`N@``` $" .`' 4  '@xȔ   '̀`'А@D / @D!!( /`@ @C`*@@?  $"!cx@ȖĀ  @jc@i ` "``@` @x- `? ?  `  ` `$`4` @&D @ 㿐 $" .`  '   @/$ cؔ@)  `, , ``2   @xF 0 @xA ` ` ,` ` "@ * ,      " 2 "   2   :2" 8톀2  &  㿘 4`@I#@Th) 4"'  $@wҒaX @C:'D%0 @g?@ C"@ ="`p@^  @lw4` '`@T D@f?`p@I   ``@C  2@ #x@ 쀤`@!@r" @ 㿘!Ѡ!Pؐ@G!㿘@ !@D 0ҒaX @Bǐ""  , ,  @d !D a@f @ῐ!㿘@㿘 D@B’`D㿘 D@B`D㿘`@ @ (`( 4   ? ,`,  ?㿘`@ @ (`( 4?    ,`, ? 㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ 0`0 4   ? 4`4  ?|㿘`@ @ 0`0 4?    4`4 ? i㿘`@ @88@4 2  @<<@( @ `@88@4? <<@?>㿘`@ @88@4?2  @<<@( @?`@88@4  <<@  pppppppppppppppp4pp`ppppppppppp|8Tppppppppppppp0pTp ,DdHpp㿈@b   @u! @# $"c`h @eL  ` $"# "bP"$Ґ "b@()Ҁ  Ґ "b #!-' $+7 3/9Ҁ`G#*` € %""!"H"P$bLҒ "P"!."H"T ?$bL$"T"b8"!"H ?$bL$"T"8"!#"H#bPo%"Ғ """H"Pf%"Ғ "H"!"P%"\$bL "b8"P$bLT%"Ғ "!N" Ғ "" H"Ґ D"b< AҐ ="b Ґ 8"b Ғ ""2"Ґ ."b4Ґ *"bҐ &"bDҐ$"b(! Ґ "b@Ґ "bҐ "b$ % $Ґ  "bҐ "b0 $@r@a?X?"T*@& $"TbL "D`bL"`bL"<` bL"`bL "bL  bL"`bL"<`"bL "` !Ғ"(@}"( &!: $"( % "  @""= 7 X5#\" `.!!`"&"d$ Ԁ "  ""  @"" ` !8!`" p"a"  4"H`"bL   !`  ܀ %@ ", $c @ ",㿘"4`#D @A   @ @v@q "`j"` `  @ /-+L) 8`D  "N`D0B3 "2N`D0= . 5V`8 " `3 `@ݯ8 $`@ݨa@&@3@-" @ 0@!H0N`D!h``D`@5`@ْ%,@Đ 2`:@`ap@  4"'H'D' U "D` '`"L` "`H '`H'x'|' ''t'p'l'h  'd'\: D@5aD@!h $ Ғ "",2 LD2("`2($ .2 (" `2( $ | 8'|` @@D (D 8' x 8'x84 8<8"L `z'"8` !\@Cq @Ck! \@ @L @slh4'h@sel 4'lb@  @{+LN !@sQp@ 4'p   `  @m  `  @   @>v$@ @  $` @>n<  @ 't@ ` @  $`@>WN`-"$@n^$d 'd2(:d`S|'`'H 7't''! !@B@r'l p''!@Bې@r'x! @BӐ@rސb ' @BŐ@rА' 'h'!@"LҐ  "aH  4@n 4 @!㿘 :"0 @`: )   "  ?("R 8 "`2 Ҁ  ?!@€㿘;㿘  "  @  4` ?"`* "@   2 x 4"'R8 "L`"` b( @x@ے!+<35-/ "D`@ a@|`"`( ; `@ @ 8@\C @g`@z $` @]%bT 2  ,@T @P b@  !@G `  "`2 `? 2  ` @3!Ҁ    (`8!"@ @& (`8@`<" `@I` 0 !`@B`00@?`(@Db<  "` `  2`@``(   4@ 4` ?"`* "@ɐ 2]  @"㿘"D`  "` "<`2"` $ $#`*  @{g&@@{cې 㿐̒ # $ cT@!!@m^*`  @l{&& ?$cT@t 0{ &$cT  .`"@`2 @{'@ 2R 8`"L`"` b(@wQ@S! B7) 4    4" `?`$``@ "* %"@ ,  @ِ"` ?"`"* %"@ Ĥ㿘Ң"D ``@ !@"`( ;  @@ 8@[C !@@b`Db< "` <   @ 㿘'D@D# 4b  L?`&  @  b* $b @  $ "0`  4" L?`&  @  b* $b @z  $ UbD;!@-  4"  L?`&  @  b* $b @U  $ 0bb`?"``b * $b@=  4"  L?`&  @  b* $b @&  $ b`?"``b * $b@ 㿐Q iR 8`"L`"` b( @v @ ! >' 4 6􀥀` ? "`* $@Ր   􀥀   4" `?`$``@ * $@ 2 `?"`Ⱂ * $@ 㿘"D`   "` "<`2 `M% 4` E >` ,?"``* $@m , `( $c ` ?"`* $@V  ` ?"``* $@C   P ``2` `?"` * $@+ 㿘<@ 4@ I0?(@ 0@+ I07`?"``@ /9 /`?"``3 |, | 4`?"``% @ @ 4`?"`` = = 4`?"`` *Ⱂ ** "@  㷐 4V 8"'2   D@>b$    D@>X$@mȔ#@O@/ 4#b(@?Ib. @ׯ"8@(b @"@㿐"`@F??"P@א0!@׉㿘N 1% 5#ґ*`: ?А  J   2Nb$  ?N 4"`?"`` "* #"@;  N  㿘   4bX@>ݐ#@. 㿘@KLd4@Xp@L\\\44㿈@  L @mJ?`d  $ "# "- $) $# $' $!+ 3`<"|*` € %# $c $c  %  $ $ "c @ؐ@?ܒ?c#*`@&  c@c  $ "c 㨐@ /   @%.  $#`` * @%4?㨀   @A  @> @$ @Ɛ"@  @"  @ @r 6   c@@A ?7'@'耢 " # c@ @1  `@ @ !#@f " `@ #@qc@@ @ @  ' c@^X@ =# 耢` `0 "@`P 2@`6 #* $, @v, ?@v"  @τ`@~@.  @%c0 @)@єԁ 㿘@#  c@  O?@O`  c@ 0 @fҐ \   c@ @g4? \@l-  $ @>@= "   $ @P$ ( (`$  <$ @א  $ 02 $ 0@*`耢 2$"` @ge?@gc耢`"  `2@ `2` 㿘@    `( @   @fn& T    `p@ ?*@& X*`*`*`*`*`*`*` `@i  㿈 @* $c  c'쀦 ' D@ H@ $f D4d D $#`  0` @P  0`Q#p*` €@L    D& 02 @& 0>& 0 @ & `И @)  & 0  ` $ <"@`& $ & $& 0 ` $#`@0 & 0 4@0`@ & 4& 0@_ D耢   H쀢@&'  6' H' 2 D 쀢  `@Ԑ 4 @ @ Ҁ@ Ғ"X"`""X#@ " bX"bX # А"@# &"X $#` "X "X`0@ "X㿐 <@y  03#* € 8  %& 8 <& <& 8, $ $#`  $##& <& @!@i"@@t"@& <"@@Ő& @ $ 4   & <  $aH` @^ 08c <c @@& D& HaH @I 0#@  <Дb? @& D & H?/a & D& H $#`  @aH < @& 㿘 ! 4N @jwJ?`d ! 4a@;f##@;ba0 b@;]##@;Yb@@敖 㻐 $# 4b'P 'T'X'P $# 4b! 4 @ `29   㸓.  @5E  2  `2(  $#`$@"x㸒`@e*` 2 b@I @ h$ 㸓*`" b@=  $ 2 `"`@eݓ*` b@( $㸑* "@ $c   !.   @P"@ ,㸁p $c܀   @d @ $cb $c  @c @  $b ? $"c c*c *  " " " " " " ! @# b# ~?  @w :1Ԁ & @<?@*b0 0i'Ԓ ) $@h  6 @'@* b̔@@r 'Ԓ ) %@ht  6 @@* bX@\  ??`@??'  : @hV ?"!Ґ"`$ tc` <<Ԑ @"X @" t%#`""  """ "" " @Ӱ?@*abpx p  $Ԑ"`X'#`X#'' 4 b '' ''' X "  T" ` 8  . $ )## # #  """   "  ?  @     /  # # # #  0% '` @ђ  T@" 4@k`2 $#`$ 4@`@)Ȗ  4 & 4 @ǐ#P 4"'!Ԑ <@     @8@)cF <`  `)%  )  . )`$ )` ) ` /``"` ? @   `2  8 "` " < @ Ԕ .`@l `@e,   .`@l `@em c" Ԕ .`@lq `@eИV L"`1 ? ?    .@lT `@d`  . @lB `@dՒ8( "  .@l1  0 h  P 0 ` $ P``"$ 0o$ 4" @А! ఁ p 4"' @L#`0a@Vr @8?@(aݐ J2!7` a@VX <?@@(a.  !@T  !   !(   !8    !H ? @Y"`H 4"  Т '???? @Ԑ) 0a@U 6@@(Nbp,  A A2;  ( 6????? @ 0 a6@UՔ @ɛ`"& (@ɕ@(#bp 8?b` Đ   `   b @"ȁ G  㿘 .@ G.` ` .` * * * *  * b@뛐 H   ?''''   @dʚ F @` A  @d 6@@%  2  @`" ` 2 @f 2 @ *  @`| @e @@aE0@aB 㿀   )'''''  @dp ?㿀   )'''''H' H@dY  ?h 4"'  @ @ȭ@'; cR @ @Ӑ̀ @ț@') c@8@ `K)+@e`@e2=@`@e@ 23@`  2.@ ? ? 2'@ ! @eZ @m @@d0HaI@T  @V@& #cH@꣐ @@n `@@n? @겐#h : `" @ ``@ "` 㿘 $c䀢  @_ @  &#cx 6?  @: ;Ԁ`" @?@&cx 0  @x #Ԑ Ж   @" " " " "   @ް?@&lcx 8 4"  '` @  @@&Qch Ub !(@dcȔ @/0JaJ@Sߔ @ǥ@&3cJ 04`( 1  /-"" 2  @ 2`@ ` `@  .@i9  % `@@ `  ؀@n b @ِ 00' 4`'  `  ? ? ?  `"/'/''''#@`"``  ` .#  $ )## #  "`"`"`"`   ?``@     /  # # ##  .@hΐ @a`3`@P ` @\ @aN@@%`@h  @b 㿘@?tDt$x8P<P`!8!L!`!t!,@Thp @"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""t(" $8%4%4%4%4%4$%4%4%4%4%4%4%4%4%4%4%%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4%4$h$P%4%4%4%4%4$$%4%4%4%4%4%4$%4$DH 4"T'" "aa"''''''''"" " " " " " ')\H''''c5%\-\/\''''( /* @€"L* h%"LL  * :  2* H@€P 4PP 4PP 4PP  4PP 4PP @4P@% L  k@0"'@  @''`J` J`O`@qؐ @q \  "bdJ`J`:c"`@q "L @/%"L@}  "L@ "`@q  4`%"L@Ò '"L@ @; %" J J`a@q !a0@q "Lܒ@'%"L'@C J !J`aH@qk "9F@|?  @#) ah@qZ Fb %"'" …DB'$`c"aH@qB  "L! #@"L@3a#$`"L %"L@| " @e "a@q% @  'J`J`c"a@q Д~'"L@*@y%"L"L;"L@<%"Lo"L j%"La@p   ? ???   :'''' @5  @Rb(@pא \bp@`T @""L :%"L@a  % " xJ`cJ`"c"bH@p #Ѐ bh@p "L* "L!%"L"L* "L* @ %"L@@?U? 3cē* & @ @ ? @Qv  b@pr  ? '"L@ . @@   @ . ?  ?  ???  :??@ " @Qb@pC   \"D\"D `2 b@p2 \@_( @ %`b@u "L@T! \@p b@uӐ 䀢 4  ?p?h??x   :'l'p't@S " @Qb@o  `"L!@c )` 0`@_|` c0@u @ "L! ' ` ) ' @_i  `cP@u  ) ( @_]  cp@u @{@V?"Lc@ut  ` c@o @( %x  \"\"""L! )0 %`x!0\ %""x)0@ZP 'c@uI "L   /  @n ?c \Tbh"*bh *******@]E$  "L `@ '?`c @^ \ "0 @`'` ) @^ ?c@u Ѐ`  '` ) *@^Ϙ ?"Lc@t  )'` +@^ ?"L`@t Đ   ?`?H?P?XX  'XX 'X @_6 ` :Ĕ @^ "L`8@t ! '` ) &@^  `X@t ܀ (' %`?'@Y  %`" `x@nА T"  " ܀ `%`'"`"`"` "` .%` )%` $T%@``8` `(  耢 %@ ؀ "``@n  % )%`%`  /T%@%```(` `   L@O   ) 3%@%`%`` @O| '`@nq  6*@'%#, @ @ "@P@n[   ` @nS @OnԀ `@nK @ D ߓ, @Tb  ?@ @ "L@| '  @ \a@s (\p` `u`  ``" * " " " " 2 ؀  ) .@]   %a(@sɐ  %`?` ) @]   %aH@s  %? ) @]  ap@s Ԁ  +  )@]t 3 \a@s \@gp 6\a@s p@ a@s @g`# %x @a`!?##`@]C  `b@se #`@]7   b @sY  %x@@0?'`c@]  '` ) $@]  `@b8` ) %@]   @X@@ (?x@ \bp@  @\(@  @ '@ ??'t@My t@Mu "L`\"t@Mm  %``'' ''@`̐ \\`\@\"HHT"bT  " T \@T""TbH T@ɐ \"HT "L@Ԑ T"" T ?@ ` '7@f   @%`T$bT '4 $','('<?'0'8`? ''@r @`T@P@\  T@ T"L!@WT@\d`T\X @q \X@)`?  T   \0 T0  0H H0  㿈@; \"X`  % B"ąB' ' 'c'''@L  @_ \L2 2  (   %xx\"d`\\  ? %\ t"\*!T "(. . . . . . . @b: @^\bL    ,* &,\ bhbh  .   . \ b0  -! .  . . . . . . 6  . . . . @[Ĕ  %"`x \ bhbh  .   .  %   6  -! . . . . . . . #x. . . o. *\"P\ hh `* `2.  ` . ` `2 ` `-!. \. b0. . . . . . . 6  . . @[x  %"`xD \ bhbh  .   %.   6  -! .  . . . . . .  x. . . #. T!\*`,2`2  -!2`2 . . . . ` .  @  ''ܐ@H  % x`\b`\T  (?# "`!'? "`"` '@ bL 6\@ѐ"\"D#@bL    %`} @   T (a`?㿘\ bj@[i `?㻀 4@"' .S-   `?$  '$ @Ɣ K`M @2J &@@`+=`) 5'7  А@J   08@+$$ې@Ր  * ` `@(@:  ` ``2  %@ @P#@@ 4"' '@+  `?@ \` \   \"Las@p#Pp 4\"Lai @#h@aa 4@o@W#W 4@ 2@M#M 4 2  \ \X*`  b  /"X @G ''@ݒa % % ȅ   %?` HD LL? : H:`: %  -: / %, tT2`"( @B: L@= <  \T "X`?"T'"X@-: t@)   *@ , \"L`ܸ` %`| @V "L @6`@v#@r "La  ?Д  ??'//  '' ' ' @['@T \b  @K @F 0 'b '``:q"L @   8@0g"L S\_ M'\ , 2 X# %T"(`t$X@ݮ: M`t@ݩ <  X\"T`""T$X`t@ݙ: @ݕ   *@ -\"L`I @ p@  "     @ې "L@֐  "L @ "L  * @`"``  `  @¸ "L@%@"L@%@"L   `?!' M'% 5#! " А@J  c0#8@ `  '4"L 3/-)` @ @Y  @Y ?, '`!@c Ȓ $ ٤@T`"L!@N!   %@ !!@> %@ ` 4`?Q"``N0Q @)    !(!@@`!P@` `"@  !X '`@ !h@` 뀢  `@  !p@ 4`?"``Ⱂ )* "@ )"L\"La) @Ր@͐ p@"L  4 4 b`?"`" * $"@ "L!@@E!" 4" @ݲ!㿘     3'%#  )2  2" 3 # 1  @@ @za@M   ?  @   2 㿈 , !@^   ’  @@J!@@B""0@< @- ؖ ` 4  b '*@ "P@H &"x@@" @" @%+)'@H b@` @\G . "@ .@`@ @"؁㿘 ) % # @@ѐ"    " 6 6   " 6  6  `6 `6 ``$    *2 2@@@@6`ƀ 㿈"@ \bL !    "@#@@#0@c#   &? % @r 0S Q O @/ `/ `/* ` B/.*2  * @  6` .@, ?#5 @*`  '`,`,`` ,X` 5 , O  ` * @* `\"L 4b '        @! @!  @#@ 4 b`?"`b * $b@ϐ `4@#P@  " `9/-+)  @[ . @b .@Đ` #x@chb@b` ?"`b* $b@ `Р  @۬#   )  / `   2?   )  .$ `   2 㿘    "F # @ )/` ,+``0) ?\"0@Uє   \ `"   @\"La"  @@c  $ ?  @   2  `  " Є@"" @ "㿘@ @Es @0@>  \"X @Fѐ`?"X @ڿ`??cp 4?b# \?'#bD/@%R@%\\@%G@ސ\bX @%;@\bT  @%-@\ 'X@$ '0@%?'X…F?@%??#c @?#`p@X=?\"`7 %"T' % ` Ƒƅ HD @ %??@1V8?# %`';` % ?#``x;h#\@$@U?#@T@  b 4@A"b @  P 4"`'*`  € `!#*` €@!p @!0k @!`f @!a @!\ @ݐ!X   * * *` @  H!   "  @"< @"(8 "H@ `3 @"h  "     @" @"  @" @"  * * *` @  "@ @*b@~"%b@y# b@t#b@o# b@j#0b@e#@ b@`#Xb@[#pb@V#b@Q#  @X . 2b@ޔ .@?#  @X . b@͔ .#@.b@)#Р#@$$  *` ` *`# €@#\@#\@  \@  \@ 0\@!\"La"b  "   050    @X0 . 24 @ې Xb@ %@Ӑ hzb @͐ x' $  @fb@ ab L  @W . D  %*  @@Kb@ @#  *` ` *`# €@#\@#\@ \@~  \@y 0\@t!\"Lab `@i b % *` @` b@Z b @_ X % 4,  *  *`@ *4 #? '*@:   +     2`#\@,!  @Wu . 2b@ .@!@  @Wd . 2b@ .@ " @!H㿐\bL@ `?#\!Ԑ ! @N; 1" 㿘&@ '@!Pp S ( <G"@* € !X !`@ǐ!h: !p@ `1*`@!x `)*` !@0@@!0< * *   @!00 * *   @!0$"@ 0 &@  &@  4`?"`Ⱂ * "@U 0@n" (N@ ĠȢ̂ЈԖؘܚ 5HВ `@ ` D `(@a H 2H#l;p#\#`#d#h;x;#bX@H #" 8\ @ @ `. @ ( \"L`@" @ #@b`@&@ p 4"'@Ȓ . "@Q"`?Z@~Nx,  5 4 `А@  `  #*  R *J 2   ???????????@zw/w@Ѕ @Ё@b @ݔ  @>v  @U!  @ɐ @֓"㿘 4b@"#@d 㿘@㿘@b#b"b#`@$c ?L "  $c  @Uc`?#b$c @= %b@$@F@5@ @" @/c @-|#@-y#@-v#@-s###@  @0 cز`@! ?@-[ @J@ - +J` 2@@// 2@@/* @/2@   ?@@ "@@`@z `?쀢  %@  @A @N0@  @G@א  @  %  b#؀ c #@2@ @)@=@ @= @Z  @  @a 0@w @Y @S @?@S 㿘@P;  @@r㿘@DŒ   @2 @6  JJ "  " J@! J ?( J@( 2  `J@   㿘 \"""b "c@  % ܀ b"쀢 @@@0f@. @=@55 5,585D5P5\5h55555555555555555555555555555555`' 4% %' c @ 㿘 %    0 @(@P@9@)8@J@: @[@K㿘]#< @' % "`㿘]#<@&  %" 㿘]# < @& % "`㿘]#$<@&  %" 㿘]#(< @&ٔ % "`㿘]#,<@&͒  %" 㿘]#0< @&” % "`㿘]#4<@&  %" 㿘]<#<@& 㿘 ?@-?@  "!!"@K ?"@@c   "(@,Y 0!\   @ ?@$?쀢"`@,: 㿐]#Xd$` ?, @  #X  @#X $@ #X( @E]X  #X]X @ !b`?#`?]# X$   %!`]#X$ ]@} 2$#]#X,    "`   "` & > @ & & @ " #@ %]X * 2@  * @ @B ? 4X2?@(?Xd2d d@ %d 2d ?@O ? X2 :$"x@+ bs?:$ %!? ! `  ?*#!  ] #X$" @) ?倣  ]"@+} = ]#X d;  B;d   & b#d ;d0  @0m'"@+@H  c  2+?]X@, `"` @ "@@& &@" #@  "`   "` & &  " # X$( @[%]  㿘?  %!?"@+   %"!]#X `?( " #X #X  2 㿘@ W? 4^ @ 8Y  c @ F%]*X2  $ 1: $$@) %XXd45 d8/  d@?c  Xd2 d@ X 8  +  c @ F+ 3` @* @ ( 㿘1]#Xd @d#X:0@D?     @L?c 㿘 q ]$ #X2 ]@4  2 @( #X2]#X "(: bd?]X0?]X$ ( 0 $(( @B 㿘!]#X @$@ ( ?#X?(#@`"( "(`B : 㿘1]#Xd( ? "d(d 4#X21?d$  #Xd  #Xd ̐B? #X ? B?"(: ]#X @$@ (@    % ? % 8   㿘]#X 2??0:0  !]??:#X2?!]#X@+$#X ;$0$0 $4;$ ;$@#$($ ?? ?#$ ;$0#X $ @M ?"@)w 㿘` @<+  ]#X?d? "d;`#@``#`` "`"`#`#` `" "`   ]X*   ?㿘!]#X@ cX` @"`@@B"cX@2`#X"$㿘  @MY ?  㿘# %`@v!] $$#X$8@;ʐ   ???:$ "$:$0"$ $#X" ""$:$"$(` `Ӑ `#Xd ?"d `@S#X]#Xd?""d:㿘!]#X$  #X #Xd 2   2#X@Pd#X?"d` @B7#X % $#X@& ]X  ?  5ЄH  ? 5Є " ? 5Є   㿘  5 А   ]#` ]#`@ 1]]@ 5 А@    ] #`@x 1]#`@q 1]#`^^]D]T]]d]^^<^\^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^]]^h^^^"!p(h"ah"t"x㿘^^"!l"ah㿘@&@E^h!^@"h@E!l@$!l㿘]@E#h㿘%^p@&@Eahp@$ah$p%^pJ "p#^@EРahbP@@ p@p㿘!^#^!hal@ ^!hal? $!h^!t]#h@^"!p㿘)b'^l+^#P%]" 2  ath:  @ J hL@E @l#P"@2`@:`@ hL h$^ap%at㿘)b'^l+^#P%]" 2  ath:  @@ ]?L@E\@l#P"@2`@:`@ ]h8?]#h$^ap%at^㿘%^pJ , #^@E8ah!b#P@@ p@E+#Pah@@  ppJ  "yp`@%$p@Eah @$ah㿘#^ap]#h@JP!^@E!l!^!h@ apap@D$ap!h"@$!h5N   㿘!]@D#h!h 0@Dܐ#h^p#h @ p @*`@ : @p *p㿘1^!p!]#h@ !p*@`J@ 2 `!p^!|  !p#h@ L#h   㿘^!pJ V 㿘!^!p1]#h@J #h!p#h@J 0 !p#h@J  㿘1^!pJ  !pJ 0 !pJ   㿘]J#h  ^"!t^ap*`ap^!|   %^  |㿘 @ Z?`dp *` hd1^!pJ  1^!pJ N !^!p1]!p#h@(!^J !^!p1]!p#h@(4 J . ^,"!t^!p 0%1^!pJ  >- [^ "ax 㿘^ax "ax@C  z  㿘]Hh  h6.@.@H@(0?д(`? H@F26]#hffffff0fffffffffffffffffffffffffffffffffffffhhiiiihiihiiihiiiiiiiiiiiiiihiiiiiiiihiiiiiiiiiiiiiiiiiiiiihgTi$i$i$i$hgi$i$i$i$i$i$i$i$hi$i$i$i$i$i$gTi$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$i$g\qptLvo{~ |${(tq$psvut{xxu<}yvpt{D|$v8rrvX|$op|<|<|$zHxr|X}4w(wLwwz~ ~ sXuz|$|$~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ n㿘@*J@#㿘^s"!z7^䀠 @ 㿘!^!耊 ^  W"a!耊 @Z"!耊!T#!耊 N#!耊 H# !耊"B#0!耊 ";#@7#H" 㿘^!? @#P#X^ /"a `#```   #h  #p ɒ 㿘}}^a`*:#*` ^!@0.L@ +"` "`! % Ѐ "L@@=-L@ $ $ ^!!^L!@,,!^! L`L@0^! L@L`㿐!^!䀢`/!*` ?Ѐ @֒  d} ^:o$! #^La  b b^a ! ? +   @b b " Y"ak  #4Mb#$ILa G !^! ? ,a@Ր  !@cxK @Ր  -/// / ٖ : d  ?`;  *`   ! " @^a  "a0  o !  ?݀   3  㿘@$ bb? b?b  @p 0b@l0 b#h !b# @$#$#㿘 %!`^!@G@#=?b^:b# bb#l   %@ Ԁ b b"##^b @' @!l :$b@!}b#Ѐ b  @@bcP ( @!k#$b㿐 'b'#@"z㿘 %`^!@"J" @# ^!䀢   g   0 @-㿘! %! !^!$!!^!䀢@ #@"> q !* $!㿘@@V? Lݠ?:L㿘@!^!耊!! @g @j !@Ɛ0+  >$!@  @  ` !^!@++! `$!`瀊``#@! @㿀b# ^ 2  :  b"" e^"!#c`^  ^:  *@,b# ?I` ^ e`;` 2^ e- e!^!䀢 "/ "^ !䀢 "/ ^ ^)/@'쀢`H ??`c"@*` c   `^a a !^ !a b"#!^!  !` @: ^쀢 J ^^^  "a     :\^^  "a     :Jl!^! ! `^a!^! ! "a     "@ >J@H  @3` @ "` g .`"+ ? & +`J`g+` f`J@`J@J@"`J@?`J@2`?`@ Ɔ d㿘 d  f   d f" d㿘 %#㿘 %#㿐 %#ؔ @:r 'N   %#ǔ  pb#4) 4"'@ b7 #$@ 1  +, ,԰ ` ` 6 d` d Ԁ"?3L ?" "C" @!8㿘@ @:i@:&@@  0&  & @   @ ?@   %J!N@ "    %J!N@@`  ".@ `@ Հ㿘`@:G@ @*N@  N@ "`@ `@ J"?8J?   ?J?8?㿈# %`Ԁ "@6耢?`쀢?`@-@! %# "  %@`^b@#@5?#$# %" ԁ㿘  % @0 @㿈+ %`Ԁ" @a`Ԁ   @^ @'@ @ V aH@   %# L'@ڐ '!P@}@4耤@f@4@U@4ސ@4ܐ@)q @,  '@!'!P@\@4b#Ȁ  @ @ !X'@耢 y Y@BĀ@4 %" @ %^"#"b@%``b@ybb "c  % Ѐ ! % ܀@ˤ`?b"쀢 $ @@@!" b# !P'@@4j 㿈@  @ |     %@ Ԧ @4A ! %@~  @ Ԁ @{@m 㿘 %" @2 㿘 %" @: 㿘 c   @@퀤 А 耤  㿘ݔ 㿘 % ԒՔ 㿘Δ?㿘 % ԒƔ?㿘 @^ "  @㿘1 % Ԁ " @  ԁ㿘 @?㿘@9@D}    ` Z 㿘 %@$# " !@ K J!H㿘0@?@㿘@8$   %J!N " N`6 %J!@2N  2/,  ,N`&  %J!@2N  " ,@@7N ",`@v " ,N  ,㿘! !ȁ㿘1 %# 2 #Ӑ!Ѐ &#!&##㿘. @> @ 㿘٠@7L    %*`J!:`@ %J!@ L 2  L   `/ @7 U   % %J!Ja@iN*`:  @"@ ,N  ,㿘 - L@ )@7Q@7N @+   "@/@* @2~ @@@2x㿘/"˒  㿘L@) *`: `#`%2 @(L`L "L`L@ `%`#2  %  % Ԁ "@`@6`L@  @漒 L@1*: `#`%2',@(L`L " ,L`L@  @`%`#2  %  % Ԁ ",@`?" @@6 `L@  @,P% 4'a !  @< ?   @t @   @    @"㿘  @< ??? 㿘 d9  d@ ,,-@@1@6S, ? $@  $` ܒ$,㿘@"( )L &x  @6)@6&  @8@ @1ab0@א@1Z0@Вb0hb# WאȬ( @RЖȤ  ؑ,7@ "@5@11Ȥؐ宒 Ȥ 6Nؑ,@ "@5ΐ@5ː$H@@1ȤN  @5J? @5*?@VO@0@0㿐b# Y b# 2h N?"P L/@` "Z L |  @5@5P   2 L %2 J  s2 @@5i ,@5` 倥`"@0  V @-  @ O&&@` Ӑ@L@  㿘b# K"@0"h A@5" @5@5 " 4 L %2 @J  s2   @@@4`.`@4@ ݀ @06 @M(@’   <  `?@0(  @4Ő  䒐@ %cȔ@F0$@ b@L#Ȁ <  @4 * n@ؔ %cؔ@"@/ސ(@M` 6  "x㿘b# 㿘b#d c  @??  b@ bcl "cl㿘bcp @U"cp㿘    b# ?4 b#  b# ? 2?3bcb` "#tb# ?@ @ @c  & T@Y? @ @ "d?@ @ic  7S? & 2N?@"I? @  @   b#  @ߒ Sb@<.  & ?b#b#  b & 䀢 bb "cpb# E@b#D c "?8? ` Ţ @Β?  @Ր ? b#d b"#l c  bcl "cl  &" &@d &" @ %?㿘@   b# ?b b"#l@Β`@G? @? `@#@ ?㿘b# b#l  k  E 0A@X??5 3` b#  @ )b#d @   @9     @1??  Sbcl  "cl| 㿘@ ?  `@ ?@1U & b  bb # ?㿘"@j  &   " 2 㿘`2@ & @ && @" `&@&  &`@ "`@㿘? " " &`@?"`@㿘 0! & ??> . & & Ȑ㿘 @ ! % Ԁ@'$ ΐ@-{ @-y 2 & &  2  &  & 㿘 2ސ   &@㿘# & `@S 2`2  㿘  "   @: `: ( :@ (:` * J   "   " 㿘?b-#  & P*  :b@ dF?  @F耒 @@uD? @?`? 0#c- (B? @ b#Ԁ b#x   ? b "B?  #c` ǀ ?  @?b#  0`   ? 㿘 b`#  & P*` :  @ @ f   @?F? xb# '-cנ  -c0c  a  ?0U`B -c K ?2-cs 稒 9 @-@>眒0%_B? @ b#Ԁ bb#x b!"#@ ~ۤD@F? @? ?D  @y㿘?" %V 0`F ?   %: `F ?   %: 㿘 "@* 0 ?   b#   @0b#   @㿐@r?    b#̀ b#|@0`8?{  b@n|"@ޒ 0?"@ْ㿈@@@[㿘?  #@ -z?  #0@ 0@   2@ 8bD?b#| @ 㿘暒 b ? \O b#̀ #@㿘@ݐ@t &@ߐ?     8 wb@Ґ     ! kbQ #P@F 0@  @??   W @8R(b@8# "?   0b ? ܀@ Bbbbb# "cl"p"h%? И 054@  b#̀ $@ 0 %b ? =? ߀@ b"#h@{ ?  㿘#x^ "bHJ 2 #"bH ޡ$ &"`H ޜ$ & &$"L"P㿘% &P' &* H@* ) &   L@*ޒ  PP@*ؐ $H @D$   $@.@P $@.% L$H$P b^^^^^^ $""("b,*8#"0 #"0^ 4x# 4!bb #'  @  b# 5 & H^"   %*```? & & %` % 耢@ 2  &   & & L " * & L" *@^^ $ `" "$# 5^ؐ@2 @./ $  &!^ &"  H`P "@ @   ^"  & `L*@^^^ "$@b0" #"$#b0^^b$0@b & H^  + &`L * b$`0 #b$ " b @T#㿘L   N  `@  "NN `4N&J 2 J `JJ"  㿘%^#^b0$" 4!^" " 4 %!  & Hѐ  & H " @4"  ^b0 & H@ @  &* b0L@ @  * " " b0^b $"@ #t"" $$##t  b    0   0  (bLb,bH  b    0   0  b@bTb0㿘 %!  "* %?`   !^" `   & L@J?` `" ` & L@J?㿘^ &  &`H?L" J@!^K"$"@$"$㿘^" ?,  & HJ   @  2 ? & 㿘^. "H@:`@ 㿘` &" ܒ`B @W ^b4  "b45b܀   {܀  &Z^b$b@P@@ 4Y  & P5^ ?@ `  J `` & H@J? 2 7 &L@J?      L^ *?$?"$ ` & L@J?   2 &`2  & ^b$ ?"b$ & H^"  &*@" ^L *@$"$㿘^"$b & ^ct0   $@ &?T* @@?? &*` T & ؐ$@@$ *@@  T* @& &`T* @" > 2  ^b  `"b  㿘%^L8  ^bD@2b@ ",8+   b# ^,8:"@ @bb#tx@b#P^2  $: @  & H^b *x#t"@㿘 b#      0Qb  ^" ^3^b( + % ?`(&b( % !^"  # &`H. J?:`@ `H" J@  Y"  $"  a&b( -  b( (  $ !^" # &`H. J?:`@ TR`H" J@  +"  $" ^ 2"b( ,#^b (  ^"( "   ! & H. J?:`@ $ Hb J@R  b  $b ^ "b( !^" `  & & L@J? " ِ ~  &!^" .  H: J@  _  & ܀`j _  _ /`_  `  &"  & L"@ @  *"  H" J@ "  &!^ H" J  0 "   ^    ^   ^ "b( i   $b [  Y"  c$"  b# \ F 2X b㞐 8b#܀ A  ">㝐 %a@*G^b$b@@P@@42 N -*`: l ^" `""  N       M ^b  "b  㿘^J"8  ^ !b^bDAb@!bb#x#t@6^G" ^"$bcPb#\  b#X  &b#܀ ^ & H^  + & `L*@  " ^ & H & b*@`L * 㘀  ^"4  H **@`L *@ 2$#t^, "@b H &L &H"@H^ b ,"#t㿘??m  ?9?  ?&? H/*  ? &  P? &  & B? &`H*`H&㿘 42 ?`0F? # &?/? & `P & H? * & H"@@(* & H?*  ?怤  &g`P `P`B  & H&㿘5^x 1`  x x^ 3`"P&`  > 7^&p""P  > && > ^P @b:㿘^ bP2 ObP ^ 4 p 8 ^p  @"p` " :`:`"@"`$  $@` #^PP@    4 2   8  P 2 `  " "㿘#@   & "`㿘!`   d$ @$ ``` ?$ 㿘b# ?   ^2 `bP  bPbP 4 @8 @^bP` " b@ f4; 9 2M `"  c= ?"9 D@ &" 47@50D 2 `"  c ?  SD@8 &" ߒ㿘  ^2 `bP ~ bPbP 4@8^^f"P" b@ f4- +g 2=?B@@ c) 2`#`D (@%? 2? c 2??D?@U㿘@ ʢ ? ? ? 3b@ v?   ?c & ?@B? 㿘N -  ۱@#@@#s  @u= @ @&M @0u #@G 6@&Aؐ ) L@ &N օ @&@&  ւ.@@! N 2 ]@. @!@0- @&@0)@3  ` @G@D @H@) @ډb "ch@   4`   ??:㿘? . 1]* #Ȑ?  8@0  . 1_* !8㿘 '"1a . $0,! ^)` % ԰Ȑ  > & 1"{ ' Pb  %` Ȕ> & # !` @ A  % $ !  ?  ? p@  㿘`?㿈  @  %> &> 㿈@ 耢? %쀢?  % ` "$:$:$㿈 (a!2?2 ?2  % b#|#!  :" %??Ԁ@"͐ 㿘[   %   @r ??  4`  ?? ;`@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@@@@0㿐 `'@  2`  @  0 &"`Ӑ㿘   & " ɐƐ Ё㿐 6b  "@098@?Ñ* : `:5#*` c `c `c ` '"l ` '"p` '"t`c @ 3Ԩ &#c *` ' @㿘    b0b#㿘   @㿘  % d "@m  '@j"@g @d!@a!P@^!@[!Ԫ ' 4 'C  0  d@А  *`, @@*`ВБ:  @ & T@. $@ EN@ ,`  T?* @?*`@  & &" "`I"Ԓa0@ % &Ԁ .0  b0@ɔ 0@$8@$5 &T.   "@@԰ 瀦 0@$#@$  "@@ 0@$@$ &ؒ "@@('( @( @o"8㿈 + %  "N@00/N@ @ % %*!&*aN`   %N` "@@ 0 %*!N` ` %*! %*! % ! a//'"h/@㿘b#    "x@ 0  թ@׸  %"`Ӷ b4b 444H Ἕ㿈 'D+aa"J@   2%a€ %a@JD@ a`"@%a%a  DJ ?`03'D7#*` DJ@ +`? `}'D & D"`@| +@ 'DJ@ + ` ' %d"`ⷐ aDD z?'D @]? @ @< 2 '"'@Ғ '  "    5( D/ )%`? !@ J  D 'DJ  D@U 'DDJ uD@ "@€ DJ lD㿈@'H@ @'# ` @@' #2``!" `@ސ'#8@\0ɐ `   HJ " `@  "{``  "&   o`L Ci`"_`"```" ` \` `?V"``?Q"@"H`?I`?E` ` 5 А      5 А    ` @f`)"@4(`$#X"` ``H@Δ쀢 2 `` "` "@#@̒ 09`  €H `  @  `  "`  `` * @'@`` b "ch` @  ` 㿘1a!ؔ@ !؁㿘@א    S@ 㿘@ː  ` 2`a@ 㿐'#@U㿘a!J㿘L@ 2&@u &@+*`: `$ "$ @썐 2 N $". -  & &.   &@@N8@*N 㿐  L -2    ?А  &%?`'#@#  А  * .  @*`: В@ Ѐ$&`2 㿘 &J `, b# " L d2 bcД( $ $ $ $ $ $ $ $  `"  "@ "  €  $L b &HJ@   `  4*`P  $J2J ? ?* 8-`? 㿘@ @ib#d   ' 'b$ "b$""$ '"$  Ј  @f? "?㿐@㿘@W@@ ]@ Z  &@@A㿘6`.  .`@B2`* @ *`B2*@* @  d  @ d  d@  @  㿘 ( >@ S @ 2 @2  @  d @ | d @ 6 㿐c  b v"ch M >    0    Ի       Գ  Ԑ  `@D 2    c"  c" Ԏ cԡ cԴckc" 㿘% '(a!袢@ % ܀    @Lb "ch$(㿘bc  "c! '"(b!瀢@ "("(* $"(㿘N*` : N x% 4 ' & ``/ @ ` `0?, @   ` -?,@J @s!Hx% 4 ' & ``/ @ - `0?, @ h  ` -?,@ @@!P㿀% 46 '`2 /@  0?,@(Ӓ ` -?,@ @!`㿀# 4b'Д [@b @!hx# 4b' B@b @!x㿘N2 *`:  % (`N n   s dN2N@L`  *`:  L`   N@@@@`N 㿘@ p q D   ?ݶ㿘b## %`ܒ`"#  b"쀢  b#H`܀`b"쀢  ' 0"0 b#0Vb#Pb "ch㿘ҥr '"Hnb "c㿘! % ܀ b"쀢 ҈W@  ܀ b"쀢 f 0 b#P b "ch@?b??  'h 'b  b 2 8 'h* 㿘7b   'h.8  '  'h(8b    'h* @: 'h8b    'h*??@;  '㿈#b%bc 耢@"! '"h ?@d@"hc ??c  c $"h$耢?쀢?"h*  :? 'bh4!?b 8?#  6?bh*42 #  # bh?㿘b#  @ 4  'h* 2     ' b  ? 'h*@@" @   '??: b  $ b 6?L0Lhthhhhhhhhhhhhhhh(hhhhhhhhhhhhh<Lh$hh0hhDhhhhhhh8xl`X$$$$$㿘˩!!c$  ˣ!$ ˟"$ ˛"x '"bl˖" '"bp# ː! '$"t㿘@ǐ#bbb"@ "  @Hb@$b*@㿐//x# 4b'p ؐb @#8x# 4b' b @#@㿀# 4b' b @ݐ#P㿘#X㿘? ? ? #b?   ?c & ? 㿘?. > `6p>#<*` b"b! e@ Ð?P LbW#xbX#l %9 @pc`MbM#b# H Ҥ?2C /  $< 0:b8#? 0Ҍ 4+ )`'% @  | `o@ l ?2   % Ԁ@  㿘?`6? *` T? 0b+#x0s  `b#  F?:. B 8 `   |`zb# ?: F?@`ߐB 0 %  % $5 ^͞ B 8 Q`O   H`FF?0gFŞސٲ ? 20 * !    ̐ѭ  ^ 0'bb!@ J ? "J? 0&#h0  % Ԁ x  J:" ?." \ J2 02 0?㿘?* : ` &?!*`  ?* : `2? *` &@?&@? &@? &@b#|&@&@?㿐#ba%b$N 2N1N#p`:&`?`%%`.2* 0 `\* Ñ: *  N%  N '( 2  N  ?'  N 2Na` @&a㿘 '"l 㿘b#bbcPbHc#0 "@ *"@  b"c㿘b#PbHb#0"@ "@ 't㿘N@= ` 5 А@   @ 4$ #* R  N@ ?"@N@ 2 @N`  `N@ "N``, `N@ @(,L? "?,b؀ b2 b" 2 b2 b܀" J 5Є   J  b2 ' '@ 㿘b#p 'bz 0 $b# )bl&$#  ? #   @  拒̱W#  ?$㿘 % ? `?Eb %#?? :耢; -b#p +b&c * n?  c e 4?2c ? 42 c @( c ;ac  ?㿘f b#x 0  `?d"㿘b! ' Ǥ @Eɔ   # '@# ?b "$b@P$b! '" @wb$""b 㿘! '" " '@P '$"""㿈b""  '"@ '"@  @s耠`? &@ & 㿘# 'bx "?@ ??bb:$bx:Ёb%b %``"b %耠2b b`"; 1`b+b-  'b2'  'x"" 42 2" 4 2 ( 2 㿘  `@ 42 ` @   " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@0&@#㿐)  S`   ` `>    2 J@ 2J@> J@ 5 2``'D J`  `'D 鵐 J@ `D` D 'J '`J@D  J` ` 㿀'P>'T ;'PT  $ PT "@@ 8 F :`@ F :`:`5T(N  PT  Pj ''"x`2@㿘b"܀ b#b""h㿈7耢?쀢? Z? @? 㿘~b#b`""㿘 ` V ~?P M&sF b#耢  ` ? 9 b #|` ) ?* '#bc  "? c  0?? ? ?㿈\! c  ? 4 d d 2+:v4 ̔ `D  D?? b #d 2:M#  @, $Pv# @ 2 `  "c  c`cb#  `` 2: 㿀`N@ 'e 2b]#x" "@U#3bc  \ c  bbb b"bb1""(!b#   bU?`""# b""#b""!b#  ( b"""# ??? ?+#c &??#\#`#d?  b#   02bb#|b#    x#bb-b?耢 Ā ?? 굔 ? Ȁ?@ @b bЀb`@ &B P*  : 9FbЀ"bb2`(  & P*  : Fb"Ȁ@"2b b & P*` :  P*   * @ :`@ f "Ѐ 4 (b(&:"Ƞ#\#`#d ! b"Ѐ"?"    b @?b:"b:ЁJ@+`H8 2 H "H`HK@2 `2"2" J@ @ c c c 㿘  H`@@o H`T@k H`h@g 0 @d  @a  @^  @[ 㿘c  Q ""  @N  [Æ  @C  @@ @v@y H`T@8 v 'b "ch #b%bcP  cP  b 2  : b ""h ǃ &` b "`b "ch"#ƒ x'''@؀ ?؁㿘 @D#c "` "`㿐c 4 ? ?O̐ O   /c㿘@K%$+\+\+\+\+\+\+\+\+\+\+\+\+\+\+\+\+d+\+\+\+\&0+\+\+d+\+\+\+d+\)|+\*0+P+\+\+\+\+\+\+\+\+\+\+\%H%%%+\+\%+\&+\+\&+\+\&+\+\)* *H+\+\**  4 "!c$  ''cP''@۔ X5 '1 '!c' FH* L@€  b@! &## "`b@!   =&$` "  @Ϙ  "c @!Ԑ `@$`8s$` '㨐 n"` j$``(f$`"    @Ȭ "c8@! @K`$`4 O$`"   @Ȕ# "cP@! `@$`(8$`` @4$``@ /$`" +'/@-)+ ' '@h"p`4" `"P``@`"D```; > "S``` < M{ @"V`@"M`40@Bj @)e @"N`@@C[ J@OU 㨐 O$㨐 L$``(H$` @E$` "A&#ch@! # "`ch@! & =3$`0$` '-"# *$`  '"c%$`  '"2 $`$`H$`L$`P$`T`$`$`H$`$`L` $`$`P` $`$`T \}"   #@"c"c@ Ɛ i""   @Ǯ# "c@  `$`$ S$`` O$` $`   'I"#"   @ǎ# "c@  `$`, 3$`"   @x# "c@ } `$`  $`"   @b# "c@ g `$`0 $` '"c@@MєЀ?T? 3cē* &@ @@`@{`@ @`@& @  @Ȑ @$ݒ @sh`-`@ % `@@% @ h?'c x@ۚ [ Z`P@  @ۈ @  @ۂ : @; h  *#c@%`  '@Q 2@;  `@  '#` ' ` Ԑ =$`&`'   'ش c 7c'`ؐ `&(9c -a+ ' (; '#  o-  5`   ؐ@֋,    'c 2t`@Z o`# 2`''` 2  ܘ @ю   ''@ܰ  c 2J`@0 E`@IV& $''$'' #\@LL@!`   2c؀` '#`w`@6@;I`@c 2``@+@;>`@ ` @ @$``ؐ? #$`1 '#  ?@&#  ?`@$ @ @@ @ @ @ǐ!#`&#@` <`؀ N '( ( '#`@ @r: ("@(!@:0c 2  &`&`&` cx&`D&` 㿘'HH@9$㿐@t J @ "`E    >  &` `@܄ 6@D` "1 `  ?+@v` &@5 ! @@+ `@"` `2  ` P`  P&@ 㿘   4a @#@ 㿐@a ' @$8 @ `@ 㿐 # @waР "L " n L  o  @ǒ = ",@``"@' 2  . @ @ @`!"aؔ@"  2 &*@ &"`b@  `"(&@ "$&@@q;"@™ # 2&@@q'`"2 &@b0@  㿘@/㻐# 4b' @I ?6  $@~c  , ( & J  5 А  J   2`J  5 А    2`J ݚ`@ ߖ@b @D"H  :+  J  5Є `H 2J  5Є ` 2J   *  㿘 c X@݌$0 p$@݅@  @F&& @I & @ϐ 㿘!cx$@j @   & @ &   &@& & @ 㿘  "   b4 z @ 㿘   @  @ b@ 㿘  b@J 0@l 0@א @f>>>>>>>>>>CxCxCxCxCxCxCx??@Cx@@@AC$CxCxACxCxCxA<CxAdAPCxCACxCxCxCxCxCxCxCxCxCxCLAACxAACxBB(CxCxBHCxBhBxCxBAdBCxCBBBB(CxCxCxCxCxCxBCxCCh㿘   4b@ݴ#@ 㿈d!  %d`d#8 dd "c8d,@ `*``!d",#@@>*`$#@`@J? "d#x Od#T KN ^`?` @J? $`?#dcH   `@@d@*`"  @* !@!HcH !P!XcH&@"#\!`!h#`!p!H#d@7 d@ː`!d#@*`" #@* @ #@* @*da "a㿘l$ @V 2@ `㿐ax@ a@!   K @K 2J @a@!q @㿐  )d%#lJ f g e    dcH  "cHdcT "cTdcd "cd   8 `S,N!*` `d? 5 А    d "!!33 ̀@da@a dd*` * ?А""!c"@ "@"J@ 2 #Aa@< dd"!"!!c"  dd"a"@Ŕ "@"J@ 2 #da@ d"!"adHd d"H"cd"TdTd d"T"cd"Hddd d"d"cT"Hdc "c ddd"#"L"c(dch "chdc0 "c0dd$ `"$" 4#a @  @[ d s"cDd o"c4c"ݤ j 3@ cb$@#l$`%#l^ dd "cPX"dd` "\P" ddd"#L"H"c(d D"cXdd "a>"Pd :"c(d 6"c|d 2"a d ."cxd *"a!c"@  (" "@! " ( "`@ x  (  "`a@\ d "c` 3#Ġ@@   (  ( @Gʘ  3#d#l& *`` @h`@Ɛ 2@   dA?d#H /dda "a@$d"ct@ 3d 9&c   d#T  !dd#@d#t@@"#@d#t@@  #@dc- @@8( "c!d! @@̖"a@ڐ  Ϊdd#`   4@n"  d!  d "cP 2d@ @I`?#$ "?@Ԑ ?  @??@4`? @q @R ?'$@"?  <  Ė $ #\   @   $   $ $ @$ @T@ 㿘 @6 @I@  d"H "   "J  2 "@"dd  㿘@ϐ㿘@  $   $  $ <  @d `$ $d"" d`""`dda  "@d쀢`d  @ "d  㿘0@% -  㿘0 㿘d#dch@   d#0 2  ` @OƔ  @   0  `!@ʂ`!@ @`@P 2`:@k a@c 㿀  "b< bY d#| 2 " @s k   (  3d 3da+d/d???耢'''%`%<#" `@J? 2'`'<@x 2a  2` %`  d#L d#( d B?3 'd! <>%d4 d#P 2@q"("0@q#dcL  "8@q!d#  "8@q 4 2cL 2# 2 (  2 d#( 2"@@q㿈d#8 d! LE 'd ?  d#t @d#  (    ?,`@? @dP d! 쀒@2   2     `@Ơ$d! `?   (  23d`A3dc<`d 9#4 5d#( 1 )!d#p `dd!d @ d! `"d@p"Xd!da $#p`&c<Sd" @u :0@q -c<?&c<㿘@d#x!d#\& &$ &$&$ &$@  &N@   4 * R *  &N@  *@& *  "    "  #\* `#   4#* R  *`" #   &㿘@*& &$&$ &$&$@J? $  ??  & &$ N@ ^d  ?& &$d#x  d#H    *?"   $@b`@  2 $ @ ?bh@s    ?& &$ @i $@ @ @b&  *@ Zd  5 А@   2d  5 А@   d _ , = - : / .d#\ "'    4 * R +  2  :  `&   `   @̐ &a? &d#L 2% d#4 2  2 2  `   ?"6   `&$"@"@?@&   "* "    6 $d " c\*  `#   4#* R  *`" #   &$ "  @ 㿘??>>    $$ "$  &   2@@ ?2< >   :>$ "t @  ? 5 А@   c ? _^    @  5 А@   G@ _C 4 ? @:@  5 А@   2 @ _(  ? 5 А@   2  ? _  @@/"@ ?2p  $  < ; >>$ " @  ? 5 А@   2R  ? _"M     @  5 А@   26 @ _1 4 2.  @() @  5 А@   2 @ _2   ? 5 А@   2  ? _"   $  ? * @$ 6  @@ ?2v < >   :>  "v $ "r @  ? 5 А@   2T  ? _"O     @  5 А@   28 @ _3 4 20  @(+ @  5 А@   2 @ _2   ? 5 А@   2  ? _2      @* @&  (|㿘@ bp@ 㿘@ bx@ސ 㿘@ b@Ґ  :#? @ @ dTd`." \   4*P@"    * ?2`@ 8  @ @ 8+ *㿘d#P    4@b d#X   4`? "`` .`:  * "@17 @mP" d#D   4`? "`` .`:  * "@1 " @m-   4`? "`` .`:  * "@03 4  @ ٖbb`?"`b * &b@0 㿘@`,`````4``D````````````X``㿘@@ %d#(' 3`#W#*` € d"cc" $ ("`cb@ @b d "c@9@@b?Ւ?ē* @   @#   ("` @"Ȁ "@@   @8@ 2 `@ 㿐@ H  2 @  ,`"* * %А @ Z @H @  2 > 4"'@m @Ò` h< @   @ؔФ  ")@"#Ъ @ƒ  2! @   @ 2 @  "@.V 2@  b@  !d@’ @  ,@C @,@Ͷ :  @C, :, @ d#`# @k˔!d#@  #8@lY "@  2S O#@L ,  ? ?/7  @1 ?H'D'H'Xab'\'L @gD @Ü#@( @;$ 'H'P'T'L Z#\'`!А  @*cP   @ @  @l#`㿐@ '   @l;#p7 @64  ``@= ꀢ ` `@b  2`@' 2` `@L  ꀤ@Ҡ! 㿘 ("  c`?  #d@.    2c@ 㿘 N  nc@F  dN  odd "c "# % (  @̭ , ` @   $ @ $@ , `$@  @̖ , 2*@, $@㿘 d# "- @ "( @~ . " *#@ 2  @ " @j . "  *#@   # 㿘'HH@1$㿘 4c@ #@Z 㿘@/㿘   4`@#@I 㿈 @i 6 a@n   //07'c@@ }? 㻀 4"'')c'%- 3 /"@1@= ? oē* & @ @' '`@k `a(@# 8@ a@@ @ 㿐@5 ' @  @ `@ϐ㿐 # @iaP "L " n L  o  @˛ = ",@``"@ 2  . @ @ @`!x!aX@  2 &*@ &"`a@ސ `"(&@ "$&@@c"@m # 2&@@b`"2 &@a@  㿘@?q q q q q q q q q q q q q q q q q q q q q pq q q q q q q q q q q q q pXq pq p8q q q q q pq p8q p(q q q pq pq q p8x @G    @ #????@  6  -@i" -@iݐ"8 -//e" "e#"#"` #T+ 3`:O[",*` € (c  G"c  (c  B"c  (c  "c ! (#/@J 6$#c"bp@&܀?! (bx@Ԑ # @7$#@!c@b ("cc"J`"@ !cb@ @""@g@   @8b @@ @@ @, ??`㿘   @b耢  @b   @ b "   @ 2㷀 4"'@ c@@  #H d'@ϐ!'P$'@z (*`"  ` '쀤`  @X `@@i (*`"`*`'" ! #p#x#X@g  6#,   @gc쀤 &@g#@ ? 0K@hx#@t@rl  " (@w #'9%㘘$@@f@a` `#@hO @hJ  2@```#@h80#@h3@1 @.@,耧 "'@g3 @h#  `2  b0 `  @ #@)s  b @"#Ё㿘e# # (@1  2 c`? 2c@ 㿘e# "1@  2   21#x㿘@ȳ : 2 ,@c@ 1 @V $ e#  `@  "   2@㿘@ @$@$ $   $  "& 㿘 'DJ  nc@    (J o ( ( "c'D"#D!#ϔx @fe e㿐 N  `@$o? bx@ @q ' "@N㿐@'")@ 2@A, N  -,`$@ = `,` .$``,`$$ `@f 2ܐ?&@&&㿘   4`@ͼ#@   ( (  $ ( ( 㿘 4'H'L'P'T'X#@ϔH@ 㿘   (#$` (#@f А@ޒ  (#$` @e    (@e @Ӑ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@_`@!㿘 'H'L'P'T'XH@ (@h0 / @2 <   L` r`@> `@+㿘@h / 1d$#@j, /,a$@## @$# H ("# !! @~  ! @em!(0E@~ = '< @@#0@#  %# @~Ԓ  ~@eI!@!  @e?!P@ `ˢ @q `2 㿘 ap@8 @6 ap@0 㿘`a@& @Ґ  @a@ 㿘@5 a@ 㿐e" "ec" "c   5/ 4-@6  `0; 7Y`@dΔ   `2     0  `2 @=   @E@ À Ϧ``@`) (#,#,@4e  #@R eu#`` 2@`@&"80e  2  ` `  "H  @d^ ` `  4 # b` @ ` "`$`  "@$c $  "" @! @ @ (c(` $`?"c(#,?%#, @ Q#,e"c " 2@T2e 2c 2 ""# 4b@˃c  c"%#    b@q 20 !@&%a @P 㿘@d %e J? 5`А   ` " @G  @ɔ 2 J` 2 o & *&  & & && "@" (c, "c,㿘e#`)'`@cs#`  % @ck 2 @ce@`2`㿘` % @K 2@%0 2 # H$ E$ B$ $ $`$ `"@$`㿘` % (@Ԑ  `  @  (   (c( "c(㿘@㿘c8@&  ` @c@`? 'c%+ 3 m@m 2cP@ K @!@א@@6H?倢 ?cē* @ @&@`  `J`p  &` @ "!@3 @`@~@@~㿐 J c b @@ch@  @%  @"J@ c@  @%  @"J@ c@ې ?# * * 2 `@ ? 2`  c@ @N c@y  㿘  #@6g 6 @c7c   㿘  !    4#@ђc0 # 4 `@ʐc c@Œ`H@~ 㿘@"̝㿘 4`@ɠ#@} 㿈!n+n7m)m#% 35m-m'm%/` b"ܓ*` €c"$ l %`` &̐ %#c@b ) "`c@b )"` @5a?ؒ?Đ& đ* @& %  l`#$   ''1m'#ؖ @ݚ ?a@ Ő   #ؒa@͔  "(! $ l#Ȁ @a!0@a!@@a!P l@a!` l@Á(  l%``@ya  l@sax  %``a@ʐ @Q蠒 @}R  @t a@ x @ @}@ @̀`2"@a@  @S a@ W  "@ 2ba@ J @53@%耢 a@ = @Y ( ( @c؀ ! ` " ` ؀ " `` `"@#R 0@  !@aݒ @b "(@aӒ0HaB + cB + 3`  *`  @  "8@#'01@zK: Ā@a"P0@n``      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@" n    @   nn# d" h"`p"`"  "@`@@ؐ2 m ncȢ" \ @_" ``"##@_"@_# `\#@@_|&@ `@a &&  `  㿘. >@ 2@ch@ s @xєc@ h @@U a@ Y @  )c@ O ` F n p"" ) n" `h * "`hn\ c@q m#Ȁ`#@_ h @c)n', *  d"@ cȀ  @^h @cȀ @^#0 c@   c@   c@2 @" ` @  @? b(@  @ec 0 Q@0 2`@@  : @ @→ @* @@ E @ :`D @X2@x`* @d@zD  0 `@X xn`p* 0"0 ;  @ C@⅕8 n \ nc@  hm"@Ȁ   h@^[ ( (  c3n+d,`d*"@ cȀ  @^Ecئ   2dcȀ @^3#>cȀ  @^* X0 tc+n)d,`d*"@ cȀ  @^#t 2dcȀ @]#c@L  㿘@x  ?  ܘ @  ?@ܠ  ܘ @ ?` '''' @w @y @y 㿘@[\ht\\\\\\h8hhhhPtDP,0hx|T, ,\ dhH@lt|4444444444444444444l44444444dp|xxx$xxx0xxxxxxx<xxxHxxxTxxxxxxx`xxxxxxxxxxxxxxxlϸϰ㿘 " @#  ! 4c@##@c@xI 㿐 ' 5g/o+n)n#n'c%o!9 3;n7n-o "* \@€ % %c %#  $c@ w $ @/ ?ߐ?#ē* @ @Vr&@'cc耢`&`(@) %  @ݔ %?2@`8@&   @ ?`0g*` €&ܐ@6'&ܐ@\0 @@0w@@wpn#ܤ ` `@@5 oc @/ ) %`@J@ - @ c` o  o0  o0 "   "`o  "` !"`=@;@ )!Ī   ?'''''  Ԙ @Ě `h@  "n@ `@  Ԙ @ `@ @\_ !@[s0ync䀢  @[i o` @ @[``g b  2Z䀢 " @[ ,No ` X  2G  Bo#`2? . & a 6 @@n#쀢`+`䀢 " @-# @   @ڒ @[!  ? @ @ ݐ @[a @Z!0* @㿐`*g!*` €o L  o P a8@8 noc "o  o`@` "` 2"@&@㿈n#ah (  '`@@  @M@ g"?oc@.Ē ? #o/o5og7n`@J@ -o@ 3``3*`g" €o  ) o o  )  o  ) $o ! ) "8"?2o@  `!"`ap@Ð @@ &??2o@  `!"`a@ @@ ?o `!oa@  *co `!oa@  *co `!oa@  *c` $` 7$o "`o "c< %<ؠ ՠ ҠϠ͠!ˠ"ɠ(?2`@ @ ?2`@ @  ?2`@ @ @ ??2`@s @ @ @?2`@g @ @@?2`@Z @@??2`@P @ @ 0 z&0?2`@B @@pmi,d ?2`@, @ Z??2`@! @    ?@ך쀢H @a@ܐ @      @6  @0?@ ?쀢 @@\b  "b@Y[(  $`  쀢 2$`@YL"@@YI"`$`@ @h ? 4`< 2 0 2  o `b@   ` "  /  `2/M@L *`"(M@` ""`n#`@0 @R"M@@86` "M@@R`3o@R`oM@ g@tӐ @R{쀢 J"H!"@XؖL` "@XВ` o ` n#@'@X"  @X"  "  7 "0 "0 """@Ð@X"@ 㿘? ) `@J@ -@#`?`g#d*` €     !  o "`@ ? 4ܲ` )!@o   '  ? ( ?* ??* ? *  ? ??? "`o4"`(4*``H 8 *@㿀 4"  ' 2  2   2    2    2 "    ?? @   # c@ o `@Q" b @s#po  )  #!"o`?"`h D* €o# n#o#4n #o   n#c(@ ! ,c8, @  ",   0  0o0 "0  ð ,`g#ē*` €  ??  ??''%'ܐ@Ԁ 'ؐ@Ԁ c@@ ` "`c@@  "`cP@  @t@ ? ?  ? ? ?@    $ 4 ؀ 2f  c _@rrZ cp@x  $,@O 2& + o <`' @+1  •  @- " o  * o#0`c@B  @!  @.  2&  @ $ c@) c@$ 㿐 )o !o o ` * # ,` %@  `@Q*@   #@`cؔ@ *` 4` $` 4`$`㿘@o  o   c@ې o`` "`@c@@͐ <`  ` @- "@?o* "4 4*4" * " " " " " " " o *44`*`"`& &  &  @͔?#:,@`?x   ?''''  ܘ @W `h@?  &@: `@3  ܘ @> `@&  @*@㷈 4"ocn "'+o@qՐ )'c@o`(? @Oq`"c@@ @ '@{@Uϐ H@ؐc㿘o'H'L@OU!"? @B"X`a`c `g  o     o`  "` *+ no`@ )o`@'nxo`( `` ` ` * H" L* " " : (: 0: 8: @: H: P" $2 * $x" oo# c4@ o 'no # ?   c @닔nc  @`po` n # ?   c@n䀢`@`xo o #4 ?   c4@S䀢`@ɒ`o` n # ?   c@8䀢`@`o o  ?   `@䀢`@`o` n # ?   c@䀢`@x`o$o p ?   `p@䀢`@]`o`' 2`@o#`4 oc @w n#쀢`'?@U "?` 'n#@n "X  nx@#㴀@#?@Uc  @=  @@*@ J "*@o % !  @  ( @? * @  @? *㿘  ` G   `  `   `1+1" "%1b "".2   2 `4   2.b1#(㿀n# 4 `'b `" @8#0{b )ȑ* @Sې#`  "    &W * "6Q @Sɐ#po` 2   @禒 #@S | @S  4 )"@ @ @b@S#  4 )"@ٔX @r 2b #@S    "  @S# @S# @S#@S"b@Sz#    @Ss  4  )"@X@+b @op 8 0hć( H P  `  h  p x#8!h㿘o@# @S4       ` @{#00@ @s "  @< @h 0ђ X /53 47 )96;  ."#  "  @" " ` @"  @  2 @ ` 2  @ @ ?` @` р  ,  @@Rǐ 耤 !o  $ @@R!$     @@R! !0@R`"  @y@R!H ;@R`@Rx X@ʐb@R"!@Ra@R (@R , 0`  L 4@Rv 8`" 0@  8"@& 8 0   L 8@Rdn#䀢`" @0?H@RW!  )h@bb`?"`b * &b@' 㿘@R>! 0! 4# )b@r"@R5" $"@kb @ X㿘 `O' 4@R$" )h@Y`?"`Ⱂ * $@  @2 `` 2  ?  @ @쀌@ 1@``, @@Q" ?  @ @而@`?"`Ⱂ * $@ @=Ⰱ㿘`Y ?N>@ 6  , < ?`&  @  * & @N !  ?`&  @  * & @tN 4 N 4N  ?`&  @ >* &@P >㿘 )  " @Z 2  㾈 4  b'   40   4@l "( @|'"8@Q:  4 @샖!"H@Q/ 4@ԟ"" @m1"X㿘@@ @砒    `А *`: ?А *`: ? *`: ?ɀ`2    h!,  €* ,`  *  **".@㿘o " p* p*@ ob`@! `$"`㿐    @ )"bp @  0lllllllllllll`lllllll<lllllHllTHp\ܘ܄ܬߤߴ TTTTTTTTTT@H(P08p   '''''''  Ԙ @m   c @T Ԁ "@N  @H  Ԙ @S 6c8@; @P#P ` 2 @ `X 2@@@@@*`@  P   '''''' Ԙ @ ? @I}`*8c`@   @  @  Ԙ @ ?cx@  @OƐ#  @. * @@` @ᚐo  !  " ! " x  !0,##\#cКc@O 0S!# `#\#`#d;h `P`p x@Om`08  o `     o ` `x `ࠞ#\#`#d#h#l#p#t И@O5 :  `" @`` "` P 4"' X  z ߔo `   n )  ""@ _  ^H  @Z   o `"  @L  @` < (@Nِ! 4`@NӐ! 0!@N̒a  0   L 4 b`?"`` b* $b@  @ @N!(b`?"`b * $b@~  @j!8! )# 2p # $#p@ @Ġ` ̢`@AȠ` ¢`@7 `` @Y@N^!H㿘?`t *` €!P !` !p!x! `@N=!0!@N8㿘` @@    o!@N 0 `!@N0 !Ș@N  㿘 @N!؀`  @h?@M!" " @M!@M!@Mߐ! @Mڐ"@M֐"?`%*`t!8 €@Mɐ"@MĐ" @M"0@M"@@M"H @M"P@M"`0 @M"p0@M"x0@M"㿘   ? ?   ? ? ?@& 2@S `@K@4o!@Mg 0 `"@M_0 "@MX h 4" '瀣@" +    +@M4" @i9"p 4" )' n""@~! 2," .@" "`@!,"  !nb!@ޔ!c!  `!Rt!P*` €@` T  ???ؠВ'@  /Ѐ/؀``ِ ``ِ  ` ِ   耢 /'/@_!@֐@  " !n  @  @ `!n!@0!! @h"㿐 'D " o `D @%  @O . nb@n  ". D'@稐1n!@B!!㿐o  `  1n#\!! @ޟ b!@!!㿐 ` `o `  @  2  "" @L !"@`!n!@!7!` `!n 6 !@!*! `6 !n ȗ6   6 6 !n#\ؗ6  `!@!!6 6 !n#\#`6  `!@~!!h  4"' '  '  ' `' ' ''T @`4 `@ A ؀`@ + 3 "$` "` ` "``"` " ` ` 2 `````2+ +  IJ` * (* ` `؀ ܀    䀢 $"@ "o `2 #\Д! @ݣ @!!n!@ؒ!! @gL#㿘    !  ;@:@p @ 1n!(@!! nࠄ Q(ࠖ ?n:* c80  .*  ?** *`㿘 ``  2   1n!P@g!!   @ @fx "   "#X#`#h#ph 4"  4 '@މcx@̀?2  @ c2 @Ȁ?2  @ !  !n!@ !@a@_b! @fz#,(t؇("` "` "`L "`T"`X"`D"`H"`P((" 2㿘@.a㿘 !!@!0@` ) `!0 @` ` !0@3 ($   )!0`0@6"!L#`"@` 2  2  !0`@`X?"aL J  @ސ p  @ِ   @! zz"""b4㿘!z " %z/`"$" )##` "2   @ 0!hJ!h @ p @ "$$"㿘 *#`"`Z 㿘 *#`"`P 㿘 *#`"`F 㿘!0y`@?"aL㿘!0z`@8?"aL㿘!0~a@?"aL㿘@ 㿘 'D'H  'D` &`D  8D@3ҒH D  DHD@3ǒH D $ HH!0@aX ``@5M` H?O"aL`H`""`H@a "  y ؀ !!!  # H@  H"`   H@  H"`H` `"` `@` +  H:!``@ڪX 4" ? 3c"#'H'" 'DD@3KH HH!0@7a?"aLH~ "~##ԒbX@  '@! H ~"""Ѐ H@4G !P ?JJ 5 А    "J ) *` !/K 5 А    " K  4#* R +  *` +# @ R   @ ѐ   y ؀ !!!  z"(  @' 1~" +   :`! H@3  &"H @3 2mND @ z" N~"Ѐ H@3 # H@   @ s   y ؀ !!!H  z"(  @Ȑ 1~" +  }:`! xH@3j s q&"В  ,@H, @ H 2 H@@ א!@XD RM"Ѐ EH@3? ?# "@   @    y ؀ !!!@  z"(  @a 3~b +   :`! H@3  &bа  ~@jD`@= @Ͱ ~"" 4" @c%!㿘 +!`!``!!@ 㻐% 4 'D''H  'D` &`D  HD@1H D  D8D@1H D $ HH!0@ja ``@3` H?x"aL G !P B  J  5 А    "`-   *` "/K  5 А     +`:   4#* R +  *` +H"   # H@  H"`   H@  H"`H` `"` ``" @ +  :`@; @bW"( 㿘@7 !!0?`" * " @  !0@ɥ!~"Ѐ !  #@1 !@̗ $"А!@̒ 㷈 4" ? 3c"#'H'" 'D0D@0H HH!0@b@?"aLH~ ""А@HM$ ~b`@ bX@t '@C! ~"""Ѐ @2 2 H!0bp@ar@1 l!P 'N     5 А      4 #* R  +K@`*# @   +@ 3  +!`!``!!@ z"(    " @ 1~" +  :`! " H@1+ " &"  @1H 2tN@ݐ ~"" 4" @aR" 㿘!#Ѐ`!0" ~b@ !0@?" y@& #Ѐ  ~!0b@0!0@(#@% y ' J 0#Pz"@c(z",0@cX0yz~cpᐘ"8@sbz"#z"(z"0c@\y ؠ#Ȗ0c@Oyv 0@G`n!Pj!\0`(@:#  y0`H8@.0@ߴ h  0`x8@0@ߢ #<'#7! 0`@#,00@`z$" 耢 !( @a%z 0@p!H  y0@ @גaX `"!L㿘  `? & `@hb   & `@\b  &!0@@a`?" !!0ax@㿘Ė"aL㿘z"aL"㿘z0"aL㿐  # `?9"# !0@@aa(`@b 2` %"c@b 2`"#   @#􀢠  !0`@:a? "aL " "3cW1!0@(bc  !0@b!0@ާ"0c"!L㿘zB8"aL㿘6H"aL㿘*`"aL㿘z(p"aL㿘  !0@@ݒb?e"aL  y 䀠 `?1"  `@sb  y $"` `@fb  y" 2 `@X`z "b @0 `!o#X@!#Xy "`"!y 䀢  쀢 "J   !0@b$  a0 J z#Pc(@z y "!L㿘z"aL㿘y"aL㿘'H  'D D@-\H HD  H!0@Ec8?."aLH`@#X`!L!`z" H!0@ݶ#`H`@#` `!L"&`"! "a㻐# 4b '  )# &`  !0@@c`@.` ?("aL@g`  `@C?#?"aL@D$  !0c@ݔ`@C*#"!L`b@#b @^?#㿘'H  'DHD@,ŒH HD  H!0@c?"aLH`@ 㿐'H 'D0D@,H HH!0@`?B"aLH~ "~##ԒbX@x '@G!&H 3~~""bЀ H@-  @ВbЀ H!  H @-  &bH @- 2N@E ~""Ё㿘'H  'D0D@,IH HD  @D@,=H D  HH!0@&`H? "aL`@ h H`@ p㿘   &`   x&`   !0@@`@@]`   `!@Q x " `@-` 2`?1"aL x@B "``J |"`@-x` `@- 2`? "aL` @R @Ĝ!0`@ @㿈'H  'D0D@+H HD 8D@+H  DH!0@`!H*  ?`x''"?@ HJ |H@- @, H?J"aL~ "~##ԒbX@[ '@*!~"%  a w/H.`@  @ޚ 1~"Ѐ ~!  H @,v "А &"~"в` D?@؀`@& ~""耢@@y 㻈' 4 '@  @ @i I @ಐ   @  @ @֑! L@ !@Bޒ / " -/ @4#@La  +/  #@>Θ @>Ȕ ! @A$?"aL@\ @Հ쀢@ƻ @Ƹ ?@A !("!L"!L @\&!8@# 4b'H' 'D @D@*HD?  H!0@aP?^"aLH`@! ? D  H@!H"`D 'DH`@ߐ! + D !H!!0@!!0@E1 4 P@"X "X` ?2` a@9C,H" D 'DH` @!   !0@ϐ!b D 2 ?H` @!?"cb @[!Ё㿘!z" $"@!؀ 2$"!L!2 $"!0@ڠ!@z"$"㻐# 4b'@A͒$  !0b@b@@L"0b"aL@[g"8㿘'H  'D@D@)H HD  H!0@֒bP?"aLH`@6"p !L!z" H!0@I"xH`@!"㿘'H  'D@D@)H HD  H!0@bP?"aLH`@" !L!z" H!0@"H`@"㿘'H 'DD@)H H!0@kc?"aLD @#H㿘'H 'D D@)`H H!0@Lc?"aLD#@@H㻐# 4b'@$`@;  $" @q @0    *@ . ! /@} b@ b @Z}#H㿘'H  'DPD@)H HD  XD@(H D  HH!0@ch?"aL`#@@`㿘!z"  $"##@0`$"㿘!z"  $"##@`$"㿘!z"  $"##@`$"㿘!#Ѐ  @  @ #Ѐ  @ @Y 㿘#cЀ @#!" "@  +?"aP$"$cz""㿘  !0@@kc? "aL2`@ @Ɛ!㿘@.  @ #Ѐ  "a"!@ z"\@" 㿐'H 'D D@(AH  HH!0@-`(OH@$ ? '!!0@ج @@!0h"!L !!0@؝ X@!01J`  z!!0@ؐ p@!0$@ɐ"\ ``@ @K J #Ѐ 3~!!0@r"@!0@9 @א ?)"aL3~`@6bذ  !~"٠@אbؔ"bؒ@ÔDH? €`#Ѐ  "a"!@ @ì 㿘Pޖ"aL㿘\Җ"aL㿘  !0! @$##"!L ""aL`!8@Ȕ  y* ` @ y` Jp&`XJ!$J 8J@` J2`@  ` @* 2  * J *`X㿘'H  'D!0! @$  C"!L  DD@'4H D   H!0@`?*"aL1"aL# @O"``  L " &#@A ,##@!8 L " #@# !8   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   K +`" Jc1q  X. XcJ [  \ $"J+2+J  +J $7 J 5 А    * J 02?L  @`+J@  l +` f @ "`  +@  W  *`G: :  \ $?27JJ 5 А    ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J d  J2J 2J  ]`\J BKJ ,V ]":R 5 А    ")+J 02?L ! @`+J@  +`  @ "  +@   J  +N X  X0!0@!㿘z" !0 z,"aL㿘y@"aL㿘P"aL㿘@ !```!L!`z" "!0@!h@ !` "a㿐 !0@խ!0 `@? # J !0@Ֆ!0 !0a@ +:!`㿘@ d"(㿘!z"'H 'D!0"0  D`D@$H D  zH!0@ؒbp"( !0@Z""#y*`H * `@  "z ""@ !0@A"z"!L" " `$"q"L*` *  @* *  "@"`* * ` @'%~X`? "`@ X  "X?̑. :  .@"`*` *   @ƐN "Ė.@`@ 43 4bX`? "`@Ր bX  &bX ?23 4?bX`?  "`@  3 4bX  ` &bX!0"@?"aL㿘'H  'D D@$8H HD  H!0@!c0?"aLH @% ?  H!0cH@ "!L㿐'H  'D D@$H HD  H!0@c0?"aLH @% ?'H@]?@b!0cX@ "!L㿘 #`#h@ 1`㿘(? !0cp`@`㿐'H  'D D@#H HD  H!0@c0 H @%:  ?;"aL@# J #c@?% +c@= ` ')z  <`"$H%" "  @ @ʷ< H<`$%" @ʫ5 4'H' 'D  D@#PH   H!0b  1z" Hy`  @~ 2 "(H!0b@?"aL~bؐ@\$-y,`* ` @ NN  5 А    2  ~`k"ؑ*`:  $ \"Y XN    5 А    .   ** :` ?а N  5 А    , D?.?H,  ~ؔ&@ $Ȕ" @H *:  i2D  H,~ؔ&@ $Ȕ" @H@Ο@.@`N 2 N @#.@#a`@ `!0@"S"!L2N` !0 "耢 #Ѐ  z!0#@?;"aLz"  !!0~@"!0@ a`!` €## ~N`  !0`?"``@* "@@ ~$@t"@#a`'D@'H* `@2 2ND&-y @S#㽘 4"?''#h''@''     'cp@ݴ c@}   c@}   `c@}    c@ݏ `@ /  L 2, 2%#Ф L  2#'0@Ӄ'  J  `  @Rh``e`@0' `P@F c@}B    c@}7  + &L ! /,@ / L 2,@ @ "-L (,@ : M@  x@K@Đ *@E@Ю *`@s :,L @ *`@ '? @7q%@ ?2X??:@o`   4&@}!' 6R"'!'@ b@ `   ':cر; @#ې?@h V' `@ܠ ؒ@ B  :آ@ " ' @ ƀ`# 6# 2#؀ +#2 @&!0 #`?"``@* "@@ #  :ز@ F @(@k!0@Oo '# F# 2C#؀`#2<  (8 #ؖ :` #2 !0?`"@  #* "@ #!0?`" * " @ @!0 @6!>@#( zL [@8 ] " J ``:2* @8 : ,  @  +! ' '~"@c`~"`8  P@@c  @] !@@?'`T` `#\! @nj aH@!z" !0aX@Ĕ``@` '?*!h`@B`  ``#\  @`  @. @.@:@."?'ap``2`@yI !x@5ג@Ga!z"`'!0a@s *" !0a@g` `!!#\  !a@) Q("@@ @z : @ܐ bP@ @l % 2*h @@w x @  bp@y x@  !!@ z" !0@b` ' @ѐ ?@5@" @ '      ?'*@ "   J? "  @  ̠Ȣ` @  Ȑ  !@q `2/ 3- r"r X `  " X@]""@X@ ??: @T '      ?'*@   J? "  H c@z3   `  ?@b: c @z z" ` !0c0@F @p?@@Ŋ@ň('I @`  4&@!'  @4l  R"'!'@   @  bl@ `   ':cر; @ ?@H @v ' `@ٮ  '  @cؠB :c'$  @̀`2@ # 7# 24#؀ +#2 @&!0 #`?"``@* "@@ #  :ز@ F @(@q!0  # F# 2C#؀`#2<  (8 #ؖ :` #2 !0?`"@  #* "@ #!0?`" * " @ @$!0 @3#HG@ 1 ##?z z##؀ z@ z" (!0@ͨ#`#" !0@͞!@ '@ɐ#x@3Y" @3S #@`@$ 0?@Ҏ@> @;@8 4" @NR#؁㿘@# !!0@\#@!0!@ 㿘@# !!0@N#@!0!@ p 4"'D''H'L '@{  #Ѐ    c@ c@ @&  M " @ y M "u t Ԫ H* @@$   `0@9 c@x5   c@x.   r" XLY?F0Bc@x  l LH?501 /@ :@@~ @ 6 42`/`*  @,@l @g @ 2 + +@!H0 M  H*` @ΐ X0@@` :@B@> /  * ` , @' :`N@ ǀ`,@``L@  @3 /  * #Ѐ  8   '''   L "!z'' !z "X$"X @#Ѐ  $"X  @̐ 2  h@Z0s z"  ` L@ `@{Ґ@  `L `@{Ɛ 2 `L@   'ؐ ''! J"I?L zC?"  `!a0@M`  @>$ ''܀  '` L!z"( '$"(  $"( " ''  z!L@? d ԰ @lԐ 'Ԁ D 6 Ԓ :H* @E #Ѐ ? n  4" @Lk Ё㿘 F @@k   `@d N 5 N + (, %2%,@J 5 А   D ",J 5 А   D `@,`,`N Р $, * : 5Є ` : 5Є ` "ɐ? * (:8  5Є ` * : 8 5Є ` "??ɐ?Б* : 㿘c@v  c@v  c@v   @Ya   㿘   @q 㿘@6 0 㿘'P'T'X P@B 8+ 4b'"`)  @"L  @ +!  ''''@]'?-a /@P a0@J  (В @ٖ OВa8@<  O(В @˖ POЀ @\ߖ ?!@@| @,!`@s?"aL `r `@!r `@!r `3~&bԀ ^?     #\! @D @Δ!z" !0ah@}  @ 6 2!x@   @(h "  (`     #\! @ a@!!@/@(F!@@(A?"  `6  @/!?@r"Lm "L @ @r'a'@1 6 @/p!E  '  @k  @/]!a@ϐ!$" a@ɐ" 1 &"`2z@!" " !0b@b@ " ""@" @ ?"aL '?c!@' ~"@i b @J6" 㿘@ !!0?`" * " @ @!0 +T +aX `"T!@| 㿘!"# +'H'L'P'T'X  $aT@H"(?"aL' b@y "@H"@"P@T"y "@ҒbX@p`?aT `@ @X 㿘# +a +!xJ !"@$a@/"a  +al$a "al㿘 +!h @Ȑ  +"ap㿘# +a! +"!x@ȼ@ " +al$a "al# +al   +@% al  +"!l㿘# +ah ! +!p @ !pah" $!p0@ $!p㻐; 4by'b('D @$9 @"ܪ    "!L  '@" `݀` `@" !"b`  4!@" !"b`  @@"!D  @,z" !!0@7"h@!0!"aL ` >z"`45 541z" ,!  ` !0~!0b@|!0`? "`` ,`:  @* "@@  5 А `    L*` * ?А"L  !L?    !L " d   5 А `   2   d`  `) z"' d--  d`("  `- "!L "!,!@" ` `z" 4 !? 5z" !!0`?"``@* "@@'@!0 $8$"@ !L`"#ٴ 1,y"  @!L!a +@( +!T  "܀@`"?П@ ?b  @H"@  "aL 㿘@Ɛ !!0~ +""T@"@_!0"$@^  4z'  :?`'T#  ?? 8;c'D'H'L'x  LJ -!0c@NL`!0c@EL DH@ [L 4zzb4"  ђ 't'l'ha'p'\@"$ /y$ y 1 +!P @˷?&!Pl l@ h h@ p Tp@ T?"#k"Lc@ 'lb@ 'pH@Mc(  H 4"X'|`"c"0aJ@ |( @ϐ H'ha@('|| !@,l@ h@ p@ c ""c#'t07H@tVa'|| +H@+#0l@ p@ "'t|@vR  <  "H!0@c@l@ p@} |@:@  l@n p@k h ?h@d ?"LtT"c@,"$ 3 +a` a` KD@cX D@c` @Lz"  ?| a`@t-ad ? ?| a`ad@NR ?2 ? ?  +H@+x#0tT`A"#ada`#h tT`3"##x'\L D#pL .l@ p@ hT`"#^! l@ p@ hT`"#h@ڐ t S 4t|@M 4\@ 'xx @Ð? @ zb'h`H€`` 0U#ؒ>`B;#ذ` xR @ 4&@# ;# # 3#ؔ#` *`  d !d!0 #`?"``@* "@@Ð #  :` B?`#@F!0|R @CH$ @#V'P# M`# # C`#؀`#<`  8` #ؖ :` #2 !0?`"@  #* "@i #!0?`" * " @Y @!0` @PH@뼐#P 0` ]#3 #ؔ#` 8`  d /d!0 #`?"``@* "@@ #@!0  :`# B?`  # # x @:x `?"``@* "@@ ؒ`B :x`? "`` .`:  @* "@@Аؒ`B :|@Z| @x @@"g'P# B# # :#ؔ#` ` d d!0?`"@  #* "@섐 #!0?`" * " @t @!0| @ @PH@Ր#x @@"   P@@Ð#??:@ tT`"#t|@x@" l@ p@ h "h@ِ #؀`#2O 4  K 4@ G 4l@ǐ p@Đ hT`"#h@ y 1 +?."aL!P @V?&!Px x@ t? "aL| "t|@#؀`#2  4   4@[  4" @C#㿘@ !!0~ +""T@#@S!0"@R  'H :''Dy''?'@??'D  :# ;'L'P'X`'@`?'܀ #z"  H X HJ -!0cH@-L`!0c@$L  ܀ HD@ 5L0'!\'䀢 ' ܀@ '@Ӑ" +y y ! +!P @ǘ?$!P䀢 @ 耢 D@ސ D"c@y?"k"Lc@ѐ 'b@̐ X'耢H@.c( sHJ |nH@|  \@   @  H@(#00sH@) / 2,H H0  @T   /,H@'ߐ#00R#Ȁ @   H@(S! H@'ʐ#00=#Ȁ @ m H@ 'HH 0*#Ȁ  H@ 'HH ܀  z"   0zb4"   L@ :@  @/ @, ?"aL@" k܀  +` `  `d#h L  D#{  0cs! 0[@!' >X 2XH@Zc( X 4"y'5"``#HJ | @ܐ 'H @#a' H!@''`0c ""c#y"`H@olP' +H@'#00"'X@ՓR   1r$'1r!`@!r@!d@) $!d@& &!`&!``<  c ""cy" @?Ez" "  +f d b +` `  `R @Žd H@&#0Dy@"#"`+@^ a"F radR @镒@?2 @L  & Pcؒ >`#B <;c# # 3#ؔ#Ȁ *Ȁ  ̀ !!0 #`?"``@* "@@[ #  :Ȗ B?#@!0rrR ad@>` @'H# M`# # C`#؀`#<`  8` #ؖ :` #2 !0?`"@  #* "@ #!0?`" * " @ @|!0`H  @}"@O ??:؀m @}HH@?#0bH@; 00^!`!` @ @o "   @H?  @@[""   @o  @J H@%#00H@#0Dy@"c" @` q` Ԑ 'l` #3 #ؔ#Ȁ 49Ȁ  ̀ 0!0 #`?"``@* "@@R #@!0  :# B?Ȁ  # # cؖB@:cز` ؀ `  @< `?"``@* "@@ `` `? "`` .`:  @* "@@ؒ`B :@k @ @@'HԀ  !!0@`@!0@ x# B# # :#ؔ#Ȁ Ȁ ̀ !0?`"@  #* "@瞐 #!0?`" * " @玐 @!0 @H  @{@ ??: @ @{HH@ݐ#@ Dy@"c "@@ @  @ @0 #؀`#܀ ` y y@ y s+"@mL@ ?h'L@w` 'PLPH@'T?]@G+L@Lx!0`H@ž<Dy@"c "@  @ y  ?"L@ @ 03@}1 +!P?`"!L@< &!P쀢   @ "@#؀`#  @F @n @k 㽠 4b  ''P 'H ? ?@?@z@ z,  h!ؔ @ݐ  @x  + "aP@#!x*  +@P? + Pz"",$"   1 Mz" %'耢 "!z"!?$"aL$"@3   !0 @! $耦!!8!caL@    !0 @t!!@K!~"   +@zaP? +z"P ,~$"!0@X!H! +`a8@' Dbh  2!L @֐  h !0@8!! +l#\#`y"(aptx@| h  @sw*`* k@o*{*@  (h @ 4 , *$ a@@ߐ !L @” 2  !0@"J! +"h  ? + !x|\hl#\#`#d#hy#l"(b0XTp@t PX ^T Z\ V  @'s w* *`k o*{ * *bh 6.&x|\hl#\#`#d#hy#l#p#t;x;;;;"(bPXTp@Ft !0@!! +X  T \ !0@p!`! +  @͐*(*+ s* w {*`, @k+`o@(+(@+ @ (h, @$ @6.&$R$a@ ! +!L'h@  c !0@!q! +#\y"(b`ab@Κl O`Oa@ Ob@Oc@!0@"Q! +"hbL@ n4 @`  !~"  @!!9! + +!aP "h@ޒ"h "h  7  +P 'P+bhaؐ@є )# 24 # +aP?" @  @`   $aP@!{!xH %## bh ?c P@r  bh@!d"! +     # + 'PaP  P@Z  # +@!L"# +'PaP ) P@K  # +@!="# +bhaP@ bh  @!1# ! +'LaP@"ΔL aP@!$!! +@"  6#@!#(# @R  `    0z" ) 耢 & `"'    #\!@Q  #0 "` @bh    9  #@ #\*   #X#\#`#d #h #l#p #t #x #| # ## # # ## #? %#'H'@ H` %#    'PaP  P@   @ v! ! +@!PH?$!P "c  4 @;#h !% 4z'b,`' +'!P# +aP@̠  @ E#@aP?$aP @aPр $aP 'Ȑ  @9  6aP@ +!aP@ @;D#㿘@#؀`#  @ @"㿘@  +aT "aT㿘' +b$T@    tr "" h rt!hb"#%~&@"#В  @ǔ!`. `!"L$Ԓ @! a @ !!ؒ @!a @ &!<a<z" &!@a@z"4"&!DaDy#"4&!HaHy"&!LaL "&!PaPc# &!TaTP#c&!XaX!"P&!\a\!8" @|!`!8a`@x !y  @s!q  @oaq!&!a!8"$@e!!8a@a$!#$@\%e$@X# @T $T 㿘@< !!0?`" * " @@ @!0~` +"#""T!@Œ 㿀'D'!'H'L'@=   #Ȁ ##X'z"4  1zy ܀  !X 2 1z""V !8 !0@8#0 #Ѐ  "!0@+  ?"aL4 y b( @U! ; a@{ '!D#L @o ̐ 0@ ǐ #`'H  ! +!X `d$!X ` @Q  !0$!XH`(@OL0@D  +"!XD@`    !yD@`  !y   !y 2!y 2 !y#H &0 "@  g`? 2#!y 2!y#lH "!yU  @Ӑ M " ?"aL@ 0B "@  7`? !"  R  '7@f  6@ @" ?"aL@9Ð       " ?"aL@ 㿐"  R 7' @1   `H@?@ "aL    㿘@i /  1,   @-   /,`%w@#0< !0 @ P04$@~x@^xx  .* `&   d,,:   9, 0x@ ,:  02 ?L? . ? 1,?`,??`"ߨ 1w x㻀% 4!"' @ِ x" ?"aL@[`$   @"R  @l  ""@O @"`@ @""  R  ' 7V 7'   @w 4 6@. @" ?"aL@J    V @5$ 4V ǐ !L"(   @8( x00000000000080000000000000000$000000000008880000(8D|000p 4"a0'D8~"T#"'H'@!@z  "bJ  !P"b zzzyz$3z#~%y"`#b ( X""##&b,$b@$"a`z"b"@!X . L * a`@} 2&b,$bah@}| 2&b,$bap@}s 2$ax@}k $b&b,!@ݽ  @}]a 2y "`@~! "`J !y!"`!y 䀢   J 2@ݖ!$ @a"  L b @}- b(@}' @}!b0 2 4  4"X@xT  "az "b XR@l"a0 `@m } z"c`Bu#*`  + n"a + j"a~z""e"b, a"cz^""z[""zX""(!c"   #@h' +J"h"3"X?B"cz?""Xc"bx@| 7 4#2"a0z ~"",+"c"&"!T!c"   #@gz"""@ @z  "b0z "bz""@D8@\H 3#yD* "@"#H  'D'H#`"@#!\ @/ @ @} @|=$ )"#@  b8@ D HH@  "cD&H &<@6.@ @6& c@Ȑ c@Đ H'  'ؐ '`''D@ 1z" !#Ѐ  !0z"@8"@"#Ѐ z""@l `?  c@ c@ @H 㿘@ Ȑ  @k 㿘@#@  cЀ !" " ! +R @ @"$"! +!P & $c@ @!P?$!P$c cЀ  !" " $cR @ @"$"$c"! @P""㿘 !0?`" * " @݇ {L dƀ`", !0@""X`? "`@ "X  &"X` v"Xs@#c쀢 P1!`@r? !0@"B2 L !0@"9  #Ѐ  !`!0@u#+!`"c €c# " L  !0 `?"``@* "@@  "@! " ~j!@B!0@!0~"1 4$@`i"X   @ nc@ c@   *- $   `"$J@ KJJ@J`J2  "  " `2J@?㿘~%"ؒcy`""#"#`#$c $c@ `@  ccyJ@ `!$ ⴀ J@ `"#cJ@!fd " J@ "` ?`ⴀ  J@ "" J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " `* ` #c"    """"  㿘 T?@d%`!0#X#`@c(3 +aD1 * $* `  L aD@VaD $*   *@<@d 0!@? !0ch !0c@w ?!0c  @n? `㿘   4   c@]#@3 㿘@ܐ  ’`@Ր & & @  &’`@ʐ 㿘  @2 *@j&  &’`@õ  * "  & 㿘  `  @ .` @i` @*@c@aÌ                                 ä                    $㿘#c'H  'D~!0` D”D@ĒHD  H!0`@~?"aL!y 䀢 z"!TH  䀢 H 쀢"J ’a@O x  t   䀢 H`!8 z" !0aH@~o z’ap $c@x"8~"y’a @x "~’a @x""’a @x!h "'’a @xz"Xzz"""b4H  @b %z?$蛐! "!` 1"@xf  "@x`  L? ."? ,!0’a@~" 2,!’aȐ"@\    "aXy "`܀` !0a@}$ "!Xy" ܀`"b@\w 2$!0@h"$) 4" ' ` *# $!!x @ !@@z  !@@6 2²"h!@Z|–x@|! ²"h53"@\  @ǻ@ 2` !0b@}!0b@} 4X@]; P  ’b@e,O 2`@1Ð `"Ӓ  2@Ǝ""Ē  `@"Т"絒 €`"稒 @"耤27 #  0   *"~’c$@wj" !`#@"3zb? "cа y`"@wm b   " @1r#㿘#~@bؠ$!0@w#Z!0”@|c8bؐ , $# 4"@@\bX bX` ?B2` @א ?L ", ` #@$ $!`&@㻐~"- 4'`z" 2y@" x > @{:&" 2yx ""xx`"x` ""x !x@#@ N °#H@J? /  $d @l ?@'#P @v$?L@ / /,@ $”"cx@v@@zc #@ @1z"?&"&"'㠀`$ `?€`# ## 춚 €`#!L@; d "&` c`?’c&"$@]&@А 2!x !0@#  & x@[$ @{&b@ ϐ x x*@  @0P (㿘 + 㻐% 4`' # 2Z z"( "U ` !0`8@{!!0`@@{!!0@# 4$@[`bX +O  4#* R ?`:'!*` !0@{`Xр` "!0`@{ z!0"(@  bX ~ 2 "  !0@{l``  @/ِ!0hz" $ Ȕ ,@D, @2 2Ȁ  @!8@  @` & @ @ 㿐#zb?$bà哐!H ?"?"@u` %  @a?J  5 А    2$b? ?  !!0@"!0@< $bH%z+aL?Ð!PW$ i`1"L 5 А    " LL 5 А    2 ÒaX@YY  2!0@za`  2 0, ,, Ĕ#\#`Ôa@"Ȓ  ,@?'''?Ēx''''@;y 쀦` !0a@z"$ @ !!0@ "!0@ $"%aL㷐# 4b'$@t@Ր@tɒa # @; OÐ!@ /2 @Y@Xߔ 2  N /   b @."㿐! +!?@$!`w @\? ! `?㿘@  #?@ @ "`7 4'!y @b    + ya`|"|y# :@T # / 15 +#`@ B `5`-  -`@B2`* @ *`B2*@ *@Y  d & d4 dÔ("@x!?․`@@Ւ d@@ÚcȒ""@#\0"@@x$@  4`  <   4  a"@, @@Òb J@"` "@#\ B#\ÐЖ@xqy| |"@'ؔ" 'А"@''y  y`@y|"|쀢" ; y  "@ # 'y  " `'" `'А"@@''ą @`ĉBA?ЋD.'@B @%@"""@Ð@x.@@""@Ð@x.@,@@"$ <@ <@+Ð@w%#؀ #`  H  `@(@Ր@Ґ""@Đ@w]% @Ő@""@Đ@wM%` @b #؇!@?В. ȅąB'@ @@""@Ð@w.@@""@Ð@w}.@+@@"$ <@ <@+oĐ @wc%0R @j@Ԟ `aL@O @ 0@ 0?`" * " @ԏ @0 @, 0z"+ 4b`' b@䈒 y  " `'x" `'|А"@@'x'||ą x#c؅ĉB@?pp ȁ B3? ?  @r  ccؠ cئ  c  #Ĥ #p#\@;`  ؁ B ;h Đ #pP @v d Uc؀ cP ` L pȁ D`@ +!`cؖ@ D 49 2@ @b !@?hp. hąB'@.@*@@ d$ <@ <@*sĐ@vf  !0R @j@Ӟb @+ΐ 㿘   ,@R@4 *! @[ "  @ I 6C, !0@  !0 `?"`@* ("@@] %@,`!0   ?`"@ * "@@ 逤Ĩ 㿐@!0`hR @ ?   P"! P"a@"㿈'''' @" 㿘@h                            LLLLLLLLLLxxLLxLLLLLL` "?    ( 񀠠"     怊 ?`       򀊀  H+ 4b '@a +!@'(? @,  + b ` ` "a  0o b0! P` b`  b`   'ؐ@ ؒ @ +aĔ @@ b'  @s  @o@ " 2zb  dؔ @]Ԡ  `@V@~R ! P` _b` 4 Yb! T Q@!@!!`P@2Hb` 4 `   T: !0Ē!8"!0!8@4!!@ !Ѐ #"`T!Ԑ @"`b` !` P@bĐ!@@  ! `@ !H@ f@( b @(̐!P㿐   @[W  @[c  Ā`#t*` c" +"!Ȑ "ac" + "!  +"!@NĔ`@a?ݒ? 3#ē* & @ @= @ X1Ȁ &!@9!h @& 'Ȁ $@/!xb4@ %Ȁ $@$!!Д @@n<  @!3 +a a!Đ a@G? @!Ѐ  +"!@/d#@`\!a  @? $ ,a  C, 4 @ "a!@  + !Р?@p &!А@sa/!Ā   4Đ#a@s  4 4#@sa 4#@|" @ @ !@ !Ѐ "T  4Đ#@sb!Ē "@  +?"aĐ"(@"@ȡ"@  @ѐ"H@ș"x @"@!?@"@ @"aa" @͔ ?a@x"@ a@Tb "ba@j"@@ސĐ"@  `@ڐ!H@ e  @]  +?"a@N"@@s#?2@C#@# ?2` @:#(` @3?2 @0#8 @y` ?2`@'#H`@?@#X@ȡ!Đ#h@ `! T Ԑ @"`0@ @ϰ 㿘   4cp@r֐#@'' 㿘!!@  02  @`@d"`!"`,@@! + a@M !!Ԑ""`4"`<@|"`8㿘!!@! + D " ,a@2 ! !"`"`4"@"`8㿘@q#@n#l%   ` ,@#Đ#@ @ ~ $@@M@0@瀤`Ԁ`#  # 07a܀  +! "# $` c@  "   c  "  @# 0a @ѐ ! !"4""@"8ԐD@j",@㿀#a,D@     @@ِĒ@ @@’ a@#0v"`@ݐ a aЀ "*@a` "`a ` a#"`a ` ;aԐ <"`a  "@a`"`2  : "a  "@a` "` 2`@ : @:@" a!` "`` a#"`a!` "`` a#"`a!`  "` ` #"` @㿀#aԒ <",@ a    2 ###Đ#a`@`,a`" a  "a@ a`@ a `@!H@Sa "a@a aH"" @aԠ `@Ȑ@a@`" @ aԐ @"`@ E㿘#a@oaD",a䀤 2  +a@ a" a@ !aԐ""`4 "`@"`8㿀a  8Ť H',D@  @u@Œ@c X)!   ! * @ y` !  "  2 Ԑ `P@Ȕ  i 2  @A@j 2a@-#0` # 0 $ 0a`<  @$ ,Ē@2#@!b@?aԲ   4@  @  aa`$"`a  !4 a$` 2"`@ 2@"@!& &@  ƞ<Ő h@ؒ0  @0@c@*#l㿘@Đ(4 @ m  @$(4 @`" ``$ 4$ 8&`&@@q K``` !!Ԑ & `P @ !Ԁ !! 2"!!J l "!@ A & $+ !Ԕ @@`l $* @@ $ 2 ! $@S!@E $& $!Ԁ !! !J @e  & (!0Ő @7@ !Ԕ @b` (* 㿀#a,D@+    ! @G@}@6!Xa @.!h0 @a"@@ aԐ "`㿐!+4%a"@b  @ 8`b  3` !!`< "! "`<! < !Ԁ" !Ő!@`" @ !" <!`<`@!!`<@!@Y !Ȁ`-%8 !"@ "8@ԑ2 `8@B, $`8"#a`8@@a2 @2`@@-< Ԡ "`8!8 !"@"8!'"@a84@ "@  "8?# 2 H2 H#`Ha2`0!Ф` '@`8`@oa!ܒ' @ acl 8@u㿀!!@@X!!` XȀ`o%)! C!Ŕ "@H@~@8@"0@`,@@E  `@>!H@ "!`6  "`Œ"@ @"8aH@! 0"@"X_@ g@` @"@"`  @ 2@ "@" "" " %@ݐ"xĐ!@@ !! `@!H@N! !""c@Ԑ @Xx+ 4b%'!!4"@!"@ !Ԓ "@ ib` 2`< 2@ ,` @:!@ `," <` ,@! @&Ő"@# @@  `@!H@Đ"@  `@r!H@Ԑ ""`b8 !"@ "8@^ԑ2 `8@“, $`8"#a`8@@Ka2 @ԓ4  `8@< $`8`  !@ `8 "  "`8  ??  ! @$?' C  7//   ` 2?`0#42`H2`H2`H!Т '@Ŕ@ݐ" '@z!Ԓ`8@ b @!"؁㿐!#Ȣa`' @ې`@"!ܔ '@P㷐 / (@ 'Ԓ %@ @!)$@ ! $ a!$@ b  $ Ԓ  @& ! $@ $ "&  @ 2 ?! ?"@ $ `Ԓ!8!,@?Ԑ!,  @#Ԑ 퀢!+"f!,"fԐ *`@!! * A! * B@^* C!"D2H2J"L"P"T"X `\@D`㷐 / (@'Ԓ %@ @!)$@ ! $ a!$@ b $ `  Ԓ! 4! $@ $  ``2 "&  @& ! $@$  @ 2 ?! ?"@ $ `Ԓ!8!,@?Ԑ!,  @}#8Ԑ 퀢!+"f!,"fԐ *`@!! * A! * B* C2H,?"D 2J L@Ē !"L!" P" T" X ` \@`㷐 / (@ #aԒ %@ @!#@ ! $ ! 4 #@ $ ! ! #@$耢 a#a$!aԔ!,@!8?aԐ!,  @#haԐ 퀢!+"f!,"faԐ *`@ a* A a* Ba* Ca2 H ,2 J" D" L" P" T" X ` \@X`㿘 $ " (@ (  @ ,  4  8@   , @㿘#b @ǐ#b@x%@Mwb " @   @ @abb@R   @$ b@ǔR p`2  0!" `$"$" 0 % 2@#@kXc 02  "@kOc!c@kH  @֐@ @k<c (@k5` $@k.` ,`0@k& .` 4 ʖ㨐 8   @  Ɛ`@@k``.`@' !`X#\l#` #d "@j@' `l#\ #`#d "@j@'x `l#\ #`#d "@j"@jΒ`@"㿈`'쐆`" @' '@Đ @'@͐ @  @ܒ쀢`@Ր@'@Δ @ʒ!@ޒ㿘!!Ԓ d&"& @+ d!"f!& 2@ @P#!!f"@!& 2!@ !&!" aА!(ƒa0@ϔ`ƒa@@Ȑ!(Ɛ!(aH@Ô㷸- 40`' @@Ɛ@aP`< G `@@Ӑ`<'ؔ @͐ؒ @ǐ#@@ - @@Ɛ@a`a 2 `( @ @#@@   @@ΐƔap@f`(ƒa@_`$ƒa@X  )! Q `4H-` " ! J  !0H`D@  ʐ#Ɛ!@(a!Ȕ @S!`8@@  ʐ#Ɛ!@a!`8@:!@@@2,@  `4 `8 ʔ @!   @ w @`` H`ƒ @hlƐa@Ԕ @ܐ!㿀`(''耢 '@a'`$  @Z'耦 @T' D@  @'' ,``4   ``'@U "a@F@Y @U(4@Q `(@L @H `$@C @? @;@7 `8@1!@B㿈@U "a ' '@  @1!@,@Em !ؒ@Z `@" @"(!ؒ@J 㿈@UR ab$ "'@' "H@k쀢  Ɛ"X@ '@Ɛ"h@ɒ@㿘@#ȦaԨ &  Ԓ&@G  a&J =aԠ &  aԧ- f "f@d`2 @  a@&a"f"@"fa"&"&a&" @Z@W@T@͐ #aԥ- f"@a&  @e"  `$``2 Ɛ"@Z @5*NaԐ@.f@+@(@`@g㿘%&  Ԡ&@[&"!Ԣ`& "& 2 H-2* _* H* 㿘! " +؀  + "a"@ ?! +@#! +!?@ƒ !@Ò !@ @^!?$!㿘 4.` 8 @  @`##.` @h  Ɛ#@ @ 2 Ɛ#@@$@ Ɛ#h@ +!㿘N .  = L .4 .`.`?? 5 А    !$  5 А     _ - _2 _ 2 Ɛ#@  2L 㿐  N. 5 А    2 *:    N " @D "  㿘1"% `@.#А@ `  5 А@J     @@2 "$  ƒ@eݐ@$@ " ' $ ` \2 ,@ \,@ `,@`` @* 4,@@#1 "㿐@? @ @Ԑ @# ?2@ː#(!! +ǐ (@`!@ԙ !@Ԗ !@ԓ @1!@/ 7' @?? @} @ 8    @ LD`Tt\(  4$$%,%<%<%<%<%<%<$%<%<%<%<%<%<%<%<$H$% %$4%<%<%<$'((((((&((',(((((('((((&|((((((((('(((((((((',(((((('&㿐9 +@ M!"@ " <"@" "@!" """""(!,"@ H"$"@"@"@ "@ "@ "@@*"@   * `"   * `#  *@ "  *@ "   * `#   ( !" @GJ`` @ Ւ?@-@ @dĐ"`?㿐! +@ !!@G+`` @ ? ! ǐ@~ @ Ր h@ΐ@d㿐@ z>`%*`Ɛ  !@Ll0!!@G!*`(" !!@;!*`( " !!@.!*`( " !!@!w!*`( r" !b  @5 0h!@0c#a!! @a"Y"@!!# @!!@@0L!b !b!b!b! b!b!b @ڐ0&@pab$" @0@Ւ 0@ђ 0@%0@ ʐ @@ ϒ ;@  @㿐@ ~ ! @ > .@ @ ) @ А`:@ `: 'a2ǐ@ @  !@0 !( ǐ @ w @ː㿐 @ v!!!? (!P  ʐ#,  @B 2 !.@ !@ U ,"ۤ ; 0@ A!h0 @ <!0!@ 8@ 㿐@ 9!"!!@^   @ * { ǐ!@ @m0@ !0@ @? }@ 㿐@  {@ !@M0}@s(4 2 @ "  @Ԕ(4 0 * .`@$ 0@ ?Y }@c@ ޒ!Ѐ `0S#!N" aԤ  `  2 @’  2a "` `!` $+"` #a"! 6А  aԐ@   a @ "80  "@" !"㿐@ ~>`I*`Ɛ  `0 D&`0@ m!3@ ]!0 a@]  3aǐ"X@ Q`@,`@ /0$`,@Q 0(@ΐ%&`(@ʐ!&`$@.&`@*&` @&&`@`40@ &"@z@ + ;@ !@ph- 4'@ ̠ !  !!?  @ " ;"?@S? ʐ#, @]Q̀ 2@ "0ؐ# ,* : `2Ɛ!*` $@"@ ؒ!@̔  $̐@M @q؀ ؒܠ $@={@ !" @ #H ;"?@ ?̔ @ז  @ !Ǡ̔ @ǖ є @ !Ǡ̔ @  @ {!!!?2 @ d#` ;"f?@ b?@@cx @@c ̐ /@@c @@c /@ >#ۀ ; L@@ #0$`L@` @`AK?@ 3L@`A ,"<ʀ ;   "ǒc@ #0ǐ#(@ @ e?@@ $ @ (# @&@ @h 㿐@   2 @  @ 502 ,( ;@ߒ!2@@M  @  8@ǐ @\$$&@@ڤ ;@ !@ p% 4'ؐ@ [ *@  2@  x @" !b0 $" @ ,؀ ;@ !@ ֐  @ @ v `@ ʐ㿐@E @  `:`  21@%`@[  2)@`  2`P *`* В@  @Ғ` D 2@@! 2`@ \ `@[u " D@`2`!`D Ȑ @ I`@@@F  ̝㿈#a T ""耤 ! @  1 @"b$"bȐ "@ @4*`" *  * ?aЀ " (?2a@  a + ( a''77@h @MY!?@ #"#@ "#@!  a`T  ` `(?@   aЀ "̀ ^""̝8' 4'@,#a@ @QȒ@(aL`@"L  a`H "&`L "aȒ`@ϐ!Ha ( @ "a" ( '@  @@ @Ő!pp% 4 ' @u ?@f!xВ  @& @Zz0a@~`? `A A`7 a@~S?@ ?@ @  @!p% 4 ' @3 @$!xВ  @ @Z80a@~?  ?7 a@~?@}@y @G!H' 4 ' @ @!xВ  @ @Y0a@} Ȑ!@ 02 A A/% H .  (@ @Yސ0 a6@}Đ @  @ Ȑ!@0А  "`H  @ @  @"㿘a耤  "   2"a耤 bȀ  "b"@Đ 2$ @d" $ 耢`$ `  $""  4$  2"$ @`"`2 @ "耢`"@ ȁh% 4 ' @- @!xȒ  (@ސ @Y20 a6@}?@  @ Ȑ!@@t  @p  @   @6"HX% 4 '`Ȕ` 2@] @! 6 #@ @Ȑ"p`a  Dbl@|Ȑ  aȐ"`@ @"㿐#aВ  ('" ,  @ ?2@"Ȑ  @Ƙ ?2a@"a" 0㿀 '!!"(bq@| 6@z#  !@o# !#  (bp@|q䀢 6!@c#X!Вby (@|f䀢 6!@X#! (bf@|Z @L#!А @"8!Ѐ "`4`8@?# +! +"4a"<"@ D"`D''(% g@|6 6 +@(  +"8 +"<#@''#"<!Вw (@| 6!@ 0! (bv@| @ XP% 4`'?'#Ȑ@Ԓ#aԠf```@#\@a'@''` '!В ,@̔   @!Д  ''''0@ ?@ h @ x㿀 #a<@@a8(@`4 faА  ?"`@"`<a`@`<" 8`4U"`< @ @a< @ @ E"<@` ??"< "<4@͔ aa/ < @ " <# ' <@ 4 a< "<" e'!!Ԓ %@ @a`<!`4 @@@ a<   ?"< <   ?"< #Ȱ FGxGxGxGxGxGxF GxGxFTGxGxGxGxGxGxFGxGxGxGxGxGxGxGxGxGxGxGxGxGxFGxGxGxG8GxGxGxGxGxFDGxGxGxGxGxGxFDGxGxGxGBhC4C<C<C<C<C<C<C$C<C<C$C<C<C<C<C<C<C,C<C<C<C<BxC<C<C<C<C<C<C<C<C<C4C<C<C\C4C<C<C<C<C<C$C<C<C<C<C<C<C,C 㿘@U@``O` `@ ʐ#*` @ @ B *` 2 @`  ʐ#@ Ȓ@.& @ @ ` 2 ʐ#@ @@&.@$`@@ ` @* ` 㿘@8̒`?ɒa@͔     @P`* @@` ` ..@@@  ݴ .h 4b;' ? b' ɐ! @$  ,ʐc .  [ jʐ .   @+ @?* : `3=ϐ"d*` +;  @ ` 5 А@J   &@  x t+?+` : *?ѐ t+ +?` ` `` @ ɐ!x@ʐc .   J @ʐ#.  ɐ!@ɒc` @ ɔ@ݐ!H쀥@@ ʐ#.  &@͐!Ѐ@ @!ʠ#. @&@!耥&  bТ @ΐ  ?* : `6*`ϐ!  > "- : `  5 А@J    @@2 "$ ɒ@Z@$ " ' $ ` \2 - \-  -  @*  "- a-@'@̒@U.x$S@@ɔ@Yђg?e$@@* : @* 2 ɔ @YR?P$+L   ɔ(@Y=?:$0 "0ɒ"8@T*$0J@"@@$`@  : -  @8А - ' b@ː"`ɰ! 4" @ؐ"xh!Ԥ @ ` @ې"0!   @Y \  (@2ɒa!,@M  #!0$Т      `   lx @ɪ"` @ "  !! !ɦ!bɦ"bɦ!0 b`  ɦ!b!"0@ @vȒ @q@   @h@ɐ"@V  Ȓ@S  ,   " @  , 㿘ĺ 573Ȅ09&&&a "#"a*0*'"㿘 ? & @X  &c 2("c` Ĕ"؀@ Đ#0"a"Đ  "##*㄀Pa*?a*@ㄐ "㄁ 㿘<? 5 А    Ȁ - """a@Ӓ0G? 5 А     """a@02Ę"""a"*А'+ ## ? 5 А    Ā # "@\ """a@\㿘c#" !"!##""!  #ca"a #$㿘)#  %'#$c!$#g%#c !"!$#$c$$# #&#㿘? 㿘  #* %%`@#%Đ#* `\`" Ā%2@x#(%Đ#"c*!㿘#,c  Ԑ x  5 А   D  c@ Đ "cc* %%2@?#X%Đ#"c*!㿘!,#! -_ 5 А     @S Đ "c 5 А   D "! #* %%2@#%Đ#*"c@ 㿘@@6㿘Ԑc" "@v  2 㿘!'H'L'P'T'X!@$1Ɣ!$H@Dx!ʐ b8@>!! +! "@Ð!!@ ʒb@ @ ʐ @>bH! ! 4bX@W#@s#@  㿘!'H'L'P'T'X!@o$1ƒ$H!@DB!ʐ b8@>! +!  @!!@ ʒb@ @  㿘!'H'L'P'T'X!@G$1ƒ$H!@D!ʐ b8@>[! +!  @e!!@ ʒb@ @  㿘!'H'L'P'T'X!@$1ƒ$H!@C!ʐ b8@>3! +!  @=!!@q ʒb@ @l  㿘@$" %`N m`@Gʔ8@V? :&@(. *` 2ݑ: .h#'H'L'P'T'Xaʒ$"!aʚah$@U!!H$@Ca!ʐ "8@=Ԕa1!"8@=ϐ 3a쀢P +ʒbx @=Ŗ ^ +! "a'@ΐ !!ʠ"@'̢  ?@'a'?P   +ʐ"b ''''  @{ȒȐ "b x# 4b'@' @@) b 'ؐ `  @ * ؖ @ b @ " x# 4b@'  @'ؐ@ b 6  `  @ 2@*   'ؒ@ b @ " 㿘@2  @J``?㿐  ʐ! b'@Ґ Ȑ!@Pk 1ʐ!b@Pd 1Ȱ!     @ ?8" *@  ? @ (8"?(㿈  @ Ȓ @ה ! ` `@r @ @ɔ @(7@f @ &@x<*@ * @\@'   7///''777  @7 @< @ *  D&@7ؕ2777ސ ~ z@7ސ @ @ &@㿈@ @   .. 㿘! ! ` ,`$!Pk 1! ! i&!@y 4i?!"!&!\$!`@ʐ"` &&!!@  @ $!1! ?&!@O 4??!#(!$!2&!" ϐ#P `   6  3Ȓa  &a 1! &!@ 4?!#~a&!&a?`6㿐@{ 㿐@s  g( 3f+gf# g( 3f+gSf#㿐'@T 㿐'@L 3f g2`* *#3f g2`* *#㿐 ג } {`0 ; ` ` 0?ޠ㿐 ; x!`̐ 㿐x! h!x @e@}ߐ  !@[ @Nѐ @~ 㿘 &@`  .@L 㿐E! "  !%!00  .` .@  .@.`#!w0`` :@%    ;!d㿐!!V0 @; x㿐` " @6( ` !  ! @@ `@`@ Ő"8 㿘L@ -  `2-L@L@ 02( L`x !` 5 А     `ѐ"X"ѐ"p L@ `` ? @ /??Ѐ@ΒL@` *  *   ' 0""В" ""ђ"ѐ" "ђ"ѐ# #@  #@ %.| 0!h 00, #@  #@ .Z2`0F0h`! #` ;" R  @/v'! # ;" ? @/cĀ'l'ܐ8'ܐ / א# ;" ( ג! ǐ#Ȁ ;"԰ а @/<Đ?'ؐÒ / # ;"  !   ;"  @/'Ԑ!  0 ;"  @/'А : } H ;" ΐ }! m x ;"z v @.'̐j : Z ;"g c Z! J Ȁ ;"W S @.'''E ;6!`B ܰ. * *  ,ؑ: `  `?Ԁ`Ȓ +#*`   ?. *  . "*  . "*   ?. *  . "*  . "* 㿘 @u    @{c &@|. & 㿘   (  @T & 㿘` @ #" ` @ ?` @`@ @" ?ʐ!? ?`` " ?!(?ڀ?!H@{@@{ݐ㿘@h ?,!X@͐ ?!x??@k @e #?!07 4'ϔ  b  < 7 i! @ Z!``@tʐ  N!    @ 6!``@t  *!w b@{H@{F@-w(4(@!^(4Z hD `!``@tn  !? 8    `ې!``@tK  ϐ!    `!``@t)  !     ! $@&@`  2 ! @s` $@|!@Ҩ ''@z@z@z   @z ' U!_'  ?: 2G G C X8! @~!㿘@rrrrrrrrrrrrrrX 4" `'J -'HҬ  "@J@b       % %!/ 3;795Ҁ * @€a   `  @  @H@"??Ā@@  @@+ Ҕb@\ @Ғb @ .@J  @@ b( Ґb @6 "`0Ғ"P@6g  Ґb  @6t "Ғ`@6[ ҐbpҒx@WB∀` @ @ ?2 Ғb@Ӑ @nE  @nB "@ ?W?@?Q ?!@"?@舐"@ml?2"@耐""@q ?2 @v"Ȓ @" @@  $@@j Ĕ`'Ē @E Җx "Вb@"@oa @a `  2 ?2  ?@?@䴒 ? @`@5b$ @| `@H@|  @|,  ?@䖒 ? @` 0@@% @䃒 ? "@v 㿘" `#XҖ"@ 4Ғc@@N#@ 㿘@ 4"  3c'"b"#'|)c'Ҡ|#Ӥ / o"`@\@P@`؀? ?ē* & @ @A@`@B' |``@ ?`' ''|@ "@I " - "0 "0  !!8@4@>Әax @@ 㿘 4Ӓa@N&#@w 㿐@3Ɛ ' @ @ `@x`㿐 # @Ja "L " n L  o  @H, = ",@``"@, 2  . @ @ @`!!ӒaȔ@  2 &*@ &"`b@o `"(&@ "$&@@ߠ"@0 # 2&@@ߌ`"2 &@Ӓb @H  㿘@ F㿘Ȑ"{ "8 "8Ȑ  "b0  @"   b4  @/F="8 6 @E| R"8' ,  =% ,# ,bT  $bT" @xs 2bT@Eb @ "PbT? $bT! ,"`  @ "` 3 @O / $?$ $bT! ,"`  @ "` @: "4 @l  "8@E+ Ӑ"`@ İ 0 >  B="8+㿘@vv   @E @ "PG N 2 #&@*"x)"0 !"4 @0  @D "8@P"4:8%"0"4 @ !Ȕ??:"8@Dܐ Ӑ"@ u @w0 "8<@ $"8 <`B<"8 㿘!@0 T&"` T"& `"$ T㿘Ȕ"@  @ @  @@@ @@ 5"?㿘 ,bT ,!  )"bTc : ȀA! ,!`"@#!7bT" ," /#!! "@#!%bT:! ,! "@#!bT ," "a  #!  `@""bT? #bT1 ,"`  @ "` !@2 !㿘! ,"#t"Ӓb @FC! @J ! ? @hbȀ "b4?@@D! @ "? 㿘1"4 "@K    ,@C! @ " ?&"4@嚐! Ȕ  :"8"b0 㿘"4 @J ,@冐! @ 㿘 4Ȓc"X@G   Ȓ"""@"`*  $* ,!4!4@((  #!4    * DLTh|lllllll0DXllllllllllllllllllllllllll0DX㿘 , ,#@"|"x+#@Ȣ#H*`*`*`*`*`*`*` @w,@  㿘# ,! ,a|!x@Ȑ#P@$a|$!x!x a|Ȑ#P `$a|?㿘# ,a| ! ,Ȑ#P@c $!x$a|!x  a|Ȑ#P*@`$a| ?㿘# ,a|  ! ,Ȑ#P @H$!x$a|!x  a|Ȑ#P@>  ?㿈 4"'@# " N @z  @y@  ?  b @1#㿘 @ܮ@;<@ p?Ѐ6Qȇ(K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?㾘N@ 0}N` x X25N@` N@@ '%ӑ*` : , ?$@   N@ @ *`  `,   "@` *  ` .  B  0AN` b B;` N@@ '%ӑ*` X: , ?$@ F8 N@ @ *` ? `,   ?"@` ,     *` . ,  $X@ؔ 㿘#X` ,!p     ` 2``$  . `$ @ #P㿘`0 !Ȕ#@   .``$` ?@ ؐ#`#@,#@ ( (  (  ( ( ( %(Ȕ "@xcH. !Ȅ#@  .``$` ?@l #`  @~㿈 4"'  @視 J  / / / / /  / ?//@< s#`Ș@   . $ @*@* * * * * * * @2  N  K#p?@;A# ? ?9#?b @]#؁㿘#cJ  @#9?@J cJ@`$c@!Z#Ȣ#c# )F # `    @ `?c@ݐ c@ 㿐  c@B` @ ? Ԑ 8@E?0Ԧ @ 1/+ ,ɬ`" T  @0  4"X#Ȑ ?4 @'c@J?` 2 &?΀ @B` { @B`0 aO@ ) ,!  = # ,bT $bT% ," @sX 2bT@@G @ PbT? $bT! ,"`  @ "` C?@4 ??%!?$ $bT! ,"`  @ "` "@ a@va"cL  @R & @ a &  T@ #  #J`@ U 㿘c\%h   9#1 ,"T`&"Tcl@r,  2"T@?ِ @s P"T? &"T! ,"`  @ "`  ?@Ɛ ?$h?$cl &"T! ,"`  @| "` \@ \ cl* "  $\㿘.\ 6%3Ȃ;Ȉc`c`l. c\ c`c\  ! c\ !\Ȗd\ l(#\  #d "#d(@#d#\d@ l*``"d㿘! ,"T#Ȓ`cl$"T"`"d##\@qh#ch"T$cl? $"T! ,"`  @ "` @) 㿘N !Ԓ``@Đ @\@(`` 2@? h@. 6N'? ! @J   ,"\@F   ,@>Ԑ @?0"\`   4#@F`T&㿘Gc ,@ #t`?㜮 bL  `  ##t"U" TRbTȒ`p&bT bT? K&bT1 ,"`  @q "` z?@ v?`$``T @) TbT? +&bT1 ,"`  @Q "` Z?@ V?T? $T3 ,b`  @= b` "@r @C 3 , :?    4 @yct      4 @yc t  "    %t"%tbL`&  " 㿘 +O- ,icx  ?/# ,bT  $bTp" @q 2bT@>  @ bT? $bT! ,"`  @Ő "` ?@ ?%cx?%p $bT! ,"`  @ "` p@ p,*`Ȑ "cL " ? & @E  &  @ cx  = # ,bT $bT/Ȕ" p@p 2bT@= @B bT? 4$bT! ,"`  @` "` B?@ >?%cx?%p $bT! ,"`  @K "`  @  2 #p*@ @ @=q @  ? /p *@Ȑ "t p*`#t` ?㿘N !Ԓa@ @@&Ē`2@=?!@1 6N*? ! @y   ,"\@D2   ,@=#Ԑ! @?0"\`   4#@D&  㿘s ,bL  `'@&L-+)Ȧ U @ `c #t *@ @ 6@?`@L   " 㿘"  ! ,#"L  N@`  N@@bβ` @< @Ja@?"L 㿘#J "@˒  ,&?& b >+ ,# ,bT  $bT"a@o 2bT@+! ,"T  c$"T" @nt 2"T@;c @ "T? G$"T1 ,"`  @ "` K?@P G?$㨐?%c $"T1 ,"`  @ "` c@; c,`*`Ȑ "c` 2`X c&`X*@c"X @ ?@;!p@!x %㔐 ?6 ?6 +c*c%㔁㿘 @B! ! 4Ԩ!'Ԁ  ,#`@ @vP" " ^*`: \"`?"`` "@ "` \?"``"* $"@ \N``Դ!@<ː ""@?M "`  "]* @Œ ^"2  0`"@  "* $" @ " 82  0`"@  "* $" @ "  0`"@  "* $" @} ``N?"`` "* $"@h J "`?"`" * $"@V  `````````````````````````p````p((((((((((``````````````````````````````````|p֨\,T 8XthD|T˰Tl0㿘 ,#@;!'('D'H@o"@H"`L@p3   ,H J r`? ,""X1-'c% , ! ,) 4+ ,"$\ x p"0 0 %H) $"LH#ct@@@P H"HD@4?• s 3H*@'HD" 'DD`HJ@-D , `""\"H 'HD'D@\ ! , $"d @   <      @uؖ @  4$"d@X"@ @\t b@_ `@_  @_ a@_ @_i   4"P@t#cW"XM 4 , ""hD+HJ@%H@@ H |   ,"d` ) 4HJ@!# 4H ,"p@:  4D  4c@s"hH@J2 ,"p ,"d` 4  4"# ,3 4! ,5/+ ,)%';9Ԁ  bP cb@@0# H @s@\ ?'  ,"\`c@sh֐"bd 2 bP " X@@#B  ?&< # J  " ? ?5 @T"# ?@c & ? `T@ ɀ?" c??c0%$c  c&@sTh"bd bd  bP "Xc@?#0 bc@?# c@s6hbd`o bP "Xc@?#ڐ b 㿘T"c"#"   # #&#$$#J`,`; #`;##$`T@ # 4  &## #$ ?㿘 T #J@ `$ccJ? 5`А   ` cccJ?`U!*` €c $c 5 J@ `$cJ?   ` cJ? 5`А   ` cc@"p  @$Ԑ<#@y" - ^2x v& ? 5`А   ` ` - ^2 b?Ycc@"C  $Ԑ<#RL"Gc . 4$cGT?@@ / @`? 9cJ@z `w$c+c`$cJ``@$c k (?c ;` $c" T"c#c ?#@ Ԑ"N?C 㿘   !J@ `$##J? 5`А   ` ##J `p%$## *` € J`n" `p`l   2  $# $# $# #J ` $###`@@ cꀢ `T @  J`n" `p`l   2  $# $# $# #J ` $#ɐ##`2@c@ b &?@ T ?`T @  J`n" `p`l   2  $# $# $# #J ` $###`2@lc@  zTc   2q$T0o#` ,"\`"g?#`]# #J? 5`А   ` L#8@ I J`n" `p`l   2  $# $# $# #J ` $####@ Đ  &?@q &?F 6L@?  ! ,"p@7 L@  @ ,J"p`#X ,"p- &?@? - -"!""a#`ސ# #J? 5`А   ` ͐#8@' "˰?L@ ! #pJ`n" `p`l   2  $# $# $# #J ` $##L@ ! ,"p@7 @ 5"p@0#`##@  g G  xG V` `& J`n" `p`l   2  $# $# $# #J ` $#I#㘐`%6 #`:#  J`n" `p`l   2  $# $# $# #J ` 8$###`#  J`n" `p`l   2  $# $# $# #J ` $## ,P " "P ,Jc耢 c 4Ԑ#@<b0#`ϐ" J`n" `p`l   2  $# $# $# #J ` $###`c@c@? `T@   J`n" `p`l   2  $# $# $# #J ` $#s##`@X#c h@ V #J c $#U" J`n" `p`l   2  $# $# $# #J ` $#0#c@ S `T@+ % J`n" `p`l   2  $# $# $# #J ` $##c@    ?`T@ )## #`c`#@6%#֐" %c ̐# J`n" `p`l   2  $# $# $# #J ` $###`@@ @ `T@  J`n" `p`l   2  $# $# $# #J ` $#q#c@ e  k i?`T@g a J`n" `p`l   2  $# $# $# #J ` $#;#c@ /  5 3?#`)#  J`n" `p`l   2  $# $# $# #J ` $##`H  `Hc" 2" ,#p "#`#  J`n"  `p`l 2 $##J ` $#ϐ##`Ͱ? ,"\`Ȁq0#J? 5`А   ` 2#8#`#"c@  J`n" `p`l   2  $# $# $# #J ` $###` ,@g ,J"p"p` L@ ! @3 L@  @L"p c#X"p# &[?Y# UȐ R"c#') ,# ,-J` >#J`g" `p` "0+`9*`0&`r 0$# $# $#@  @@c%#%# ?$cԀ#  ,#`2#ؐ ,"##J@   ,J` 2 ,#"T ,` ""T#@  #T? $T! ,"`  @  "` а?@ + ̰?@  ,@@cL# , "cx%#T? $T# ,b`  @ Ր b` @   # , ,c@ ]c &?#`c c ?$cc $cc  ?$c% ,J@ n" p l `2 `` ` ` "$#`T@m g J`n" `p`l   2  $# $# $# #J ` $#A#㘀  ,@' ,#c@ ) `T@5 /)##c (#` c`#@6%#"$c J`n" `p`l   2  $# $# $# #J ` $###`@@#ۀ #`ߐ#  J`n" `p`l   2  $# $# $# #J ` $##@ #J`q`Q2J $#?#J? 5`А   ` #8@ #` % "#"c@  &? J`n" `p`l   2  $# $# $# #J ` $#^# ,J"p"p` L@ ! @1Д L@  @L"p F#X"pW  #Ȑ cA 3/"##`+ ,"\`'`q%#?#`#  J`n" `p`l   2  $# $# $# #J ` $##M ,"bL TȐ "@` # ?ϐ # @t  @<#@  ,ː" ,"#|ϰ?"#| J`n" `p`l   2  $# $# $# #J ` $### ,#|c@&|@  ? J`n" `p`l   2  $# $# $# #J ` $#l##`##@ (0a#`X# @S U J`n" `p`l   2  $# $# $# #J ` $#/#!#Ԑ"@ʒ`#@lא  ,b\ "@ 00 TȐ "@` c @  ? 8#Ԑ#?㿘#`"#"c#c 4 Ԁ #  "?㿘ɦ T3?1?%)Ȁ`  ?, `T鏐胢 # ` W   @O  `Tڀ` H?㿐#J@ A 5 J@ `$cJ?   ` cJ`  "p: $cJ@ !`@r$c ' !#Ԑ"@ `c# Ր X][ ' ,㔀 9% ,1 ,"T"`&"T@` 2"T@- F p"T? &"T! ,"`  @d "` 6 @ 2 $㔐?$ &"T! ,"`  @O "` c@ c'J@  ,# @c`* '##J@ #*@@  㿐 ,"X`'  Ȣ `"c? , c  =- ,% ,T  $T" @`G 2T@-6 А pT? $T! ,"`  @ "` ܰ?@# ذ?%c?% $T! ,"`  @ِ "` @  !*@J@ f /ը 75J@ !T %c < ! ,"T $"T" @_ "T@, ~p"T? $"T1 ,"`  @ "` ?@ѐ ?%c?% $"T1 ,"`  @ "` #@ # *@#J \ %# *@'#@ Ic =! ,"T  $"T"@_ "T@, *p"T? 9$"T! ,"`  @H "` 6?@} 2?%c?% $"T! ,"`  @3 "` #@h #  *%#㐀 3J  2 c <%! ,"T  $"T" @_N "T@,= ؐp"T? $"T! ,"`  @ "` ?@+ ?%c?% $"T! ,"`  @ "` @   @:h# , @㘢`*c@@ [# ,Jbp bp@= @b٢c <'! ,"T  $"T" @^ "T@+ |p"T? $"T! ,"`  @ "` ?@ϐ ?%c?% $"T! ,"`  @ "` @ ?? ' , @㘢`*@??'#`%#J` ) P B3% ,T  $T" c@^ 2 T@+ " pT? 1$T! ,"`  @@ "` .?@u *?Ԑ#X ?0$% P?&c $T! ,"`  @& "` @[ @acc"#*@L@ ! % 㿘 4 "X"`T /-' ,  ?" ` ㄐ J?`  ` ?5` u s?cN   J ` "㔔" TN .TN  TX   $T! , "T? $"T1 ,"`  @ "` ??@ ;? TS T$ @ q "T? $"T1 ,"`  @ "` ?@ΐ ?TȐ? " $T! ,"`  @ "` {@ w㿘#     @T%3 )`"@ =/ ,% ,T  㠀$T" @] T@*~ `pT? }$T! ,"`  @7 "` ?@l ?%"?%㠀 $T! ,"`  @" "` "@W 㠒`@``@@@ %` =/ ,# ,bT  $bT" @]E 2bT@*4 ΐ pbT? 2$bT! ,"`  @ "` c?@! _?$?%㠀 $bT! ,"`  @א "` @   㠔* * @F ! ,<?"T?`#$`T$"T `T @| "T"T? $"T! ,"`  @ "` ?@ِ ?Ȑ? " $"T! ,"`  @ "`  @Ð  㿘#Ȯc   #  ,  ,bT   "bT "`TS @"     @ bT? %bT! ,"`  @> "` N?@s J?ڐ ӐА̐ɐ@ T$@" "@ $$$㰐" "#`bT@陒bTȐ? " %bT! ,"`  @ "`  @*  㿘!#䍦 #c "@ ` U"T S`& "@N` E1 ,)"T`@$&"T "T9T$ @ "T? &"T! ,"`  @ "` )?@ %?"T ?%# &"T! ,"`  @ "` @ΐ  T0  ` 㿘% ,T $T @B )T? $T! ,"`  @j "` 9?@ 5?#`@  ?#`##&@T?$" $`Ȕ %#"T##`$T! ,"`  @6 "`  @k  㿘 "$?#`@  㿐@" #⮐ `$`T @ &?@@ 㿘 5`А`  ` `Ő ?ȳ* c 2"c "c" 㿘? 5`А   ` ` ?Ȓc*R@  ?# Ȗ  # "#``$ 㿘@Y;     ":@'Ӑ m p 㿘"  N \2 `?㿘' ,㨤 9) ,! ,"T"`$"T#@Z 2"T@' D p"T? $"T! ,"`  @b "` . @ * $㨐?%# $"T! ,"`  @M "`  ,@  ,N`\  `* #* #㿘@= ,"T`  ,`? * @"`@@,"㿘@& ,"T`  ,`? * @"`@B@"㾐 4" ,'h  ,I  ,`? #c* * %"`!Ր Ж  ͔   L`J@ /@)1  Ւ`ؐ@y c 鱔 @O; 㿘 ,"h` ,@O3 ?` *@* "` @M?㿐@°? ,` **@"``h @L  ` ,"#|` ,"#@"㿘 ,"X`" N ! Ւ`@( @(Ғ /  Q  㿘J@  2  `"J`   ! -! :!3!5!@5  -. !  ,#x`@T  ,@Wܐ   $!@&y Ր!0 0 ,"cx!@J ! ! ,@f!'!@X $!㿘#L@! ` "c#Ց* :  [ \  L@p   _a@L Y L@ ` * c) -$! =' -# ,bT  $bT" @Y0 2bT@& 칐!0bT? 5$bT! ,"`  א "` 2   . %!?$ $bT# ,b`   b` c c@\^*@# %cՐ!`   J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&#cJ c" d5 @7 c0?J` @ (&c $cc @ϐ  @  @<#@$&@!x&@ ?*:  g2 `$c & 㿘c "cJ % J*: @c! l`%c! l%cc*J :` %y)ɦ \` 7 ! ,"T l$"T" @X4 2"T@%# 뽐!"T? $"T1 ,"` { ې v"`% \?$l $"T1 ,"`  ̐ "`   l* *:`$㔀` `J `\'c l**@: $㔀 `#`c 4"X!Ȑ ?6 F " #J?` 2 &L c=J@  \ \` # ,bT   `$bT" @V 2bT@# '!bT? $bT! ,"`  E "` ?z ?%`h?% ` $bT! ,"`  0 "` e  $ ߜ  `@YÔ @Ȓ R$?`h < # ,bT $bT"  `@VH 2bT@#7 ѐ!bT? $bT! ,"`   "` ?$ ?%`h?% ` $bT! ,"`  ڐ "`    F  `@Ym$ L ?"`h  < # ,bT $bT"  `@U 2bT@" {!bT? 0$bT! ,"`   "` C?ΐ ??%`h?% ` $bT! ,"`   "`      $@2 `H!?    `@Y  ` !@*@! @*`  㿘 d`l -+/M &A \` `h" , % ,T ``$T" @Us  T@"b T?$T%h?%`` $T! ,"`   "` @K @ ``*@ lMh M 0H 94G?Ѐ4C* @  h"@@ + % ,T b$T" ``@U&  T@" 谐T?u$T%h?%`` $T! ,"`  ɐ "` @ @< ``*@3 l )# ,bT  $bT"``@T bT@!ِ 8%h?%`` $bT! ,"`   "` ``Ɛ ``  *@ l `d% & # ,bT $bT" ``@T bT@! Ր!<bT?$bT 2'?! ,"`  Y "` ? ?%h?%`` $bT! ,"`  D "` ``y ``*㿘% -# -a! -  !d*@  *`@Tn$a $!*` * "Đ*!@ *` "ܻ*!@ *` &  $@!B ܐ!@˰ @Si!$!$a㿈 -ᨨ `T ?  -a? "? -a  Ȑ "c܄  ,bT ! "bTH -(!@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?†!2  : * -!(@2*`8:@ @('`'`*'  #@ #` #`# # # #`TGT!?%T%!%c$ᬀ $T1 ,"`  D "`  y  㿘 -a ??!"a) -a* @*`!@ ᤒ@ ``@ _@@R@ᤒ??$ T -#$ -"a"!㿘@/㾰Ւb@+h "`    -#!'9%5 -') *$* x@€          %` $`$ @Cz $  $` $ࠐ ' @L@ ?Ԑ? 3cē* & @ @<  `  Ւb0@fT Հbh`Ւbh@fI  `  2 @q?"@  @ "`. @ -@!$#(Ւb@f%  @Vg& .  -*&,`$ &@@<? @F`?ՒbȔ@kĐ <  -  ?@?%  2 @`  @ @ @@qD <  2  `   " @&@[㿘@ / 2N  2  N /"?* N /2? (@8   @k]  -<3/7Հ "    0   @O@y" ;' -V8 2 "$ը" @! b "  -J$`/"L? / /,  -a$#  ,Ր#@E а  @rK$,@h?:  H& 2@  `" @@| 2  @@/0 @2#(@@`  @. 0<    2 @Ր#P@x @ @   @S @(@"@?X0@LR @`?Q  2 `2 @#@ @   @\a 7ՒbȔ@jl  .@ " -bȔ@j]  @ @ǒ`?    @`? @Q -@~0  @3@ 2 @a 2:@`Ւc@j- @:  " @:  `??㾸 p` @O@ %pՒc@i `t  @N@ &tՒc@i  @TW@ @Gܔ 2@@# ` 5 - ``@`2G `2B `9 4ՒcȐ#@%> 4 bX`? "`@$ bX  $bX ? 4"X`? &`@$bX  $bX` 2` y Y@] $  &@G{?2Ր#@NV@lӒ     <   `?)(+p@St p>`  @Y ? "?@p@@c pc@   p@֥@ Հ```8@i^<` @#  @]H@]E 06 `@ 2# , @ @lj @ 8 o@, Ր#@̒ @]@] Ր#@ 㻐 4" ' @Rє#?` #, 3 -@#a Ր# aa@]\ Ր#@  b ` @ @b @ة 㿘` 3 -@a  # @a ֐ @na   ` @( 㿘` 3 -@Րa  # a@HP  ֐ (@Ka   ` @ 㿘 ! /& $ x $ x@\#$  (#$  ,@\ $` -@X!  ֐ 8@a `  @%   `0 a@gr  `@`֐ H@a   1& ` @T 0 @va ֐ X@a @` " L@  0 L@Xِa @`- L ֐ h@Βa 㿘 ! - @[!   @j`֐ x@! 㿘! # 4 ֒`@#[c ֐c@#V`@ק 㿘@T,-(-(--(/--(-(,P(X(X(X(X(X(X(X(X(X*X*X*X*X*X*X*X*X*X*X*X*X*X*X*X*X*X*X*X*X)`*X*X*X*X)*X*X*X*X*X*X*X*X*X*X*X*X*X(x(((*X()*P*X*X*X)$*X)T)p*X)*<*X**X*(x   4?b#ؐ?'"`' J g  ' a ִ!?#!)֒a$ @;% Ԁ 2    $ % $ J@ u?J` n ? `  '$ % ?#@a  @a "֒a@ao @ #?֤c!'@Q+!Рc؀ '@c''֔ `@F'  !"@ ?# #,`"@֒a@aA !?#ܔ  @Fؠ#' `??#@,`"``` `E  *` ִ!@ |?@}!x #c!?#b@ J@ k bb @a c ` ^"``ܐ Y"`ִ!@s Q   ` "#`E# B" ʐ >"`c"$@Y#6 ֒b8@`ΐ ʐ?."`?##cb'J . ./' " b@;" b'ʒ` ""`̐  "``ؐ "`@ @   .a* @֖P@ ?i? 3#ē*  @ ?# " ֐"P&@&`  ؀ ր ʒbX@`q  Ѐ  @ ) @ ֒b@`_ `? 䀠`?"` @L    @f  3"&`L -2 :L  2  :֒ "k&`i"В?` J  *`  ؀ ֐"@|"@N 0  + @> .?#؀`' @ ֔$@ ?# @@+  < @  &@ ֐"@{ @<  (Ѐ # Ѐ "##"#`䀢 `耢  @ Ӑ# 23# Ѐ ֒cH@9$(#`䀢 @$ 2# ؀ ^֐#P@{U֔$@Ϙ#֐#p@{D#`̀  耢  Ȁ   4֐#c@  䀢    # @@    Ѐ  쀢  耢 @a  `̀  ֐#@ݒ0 " @/ 2  Ȁ   @t @ɐ㿘@{0# 㿐@Q   !`!  @2     2  ?c ; 4b'`  @N @B   5 ̀ %֐#@;?܀  @;  ̀  # ? ̀ א @zВ@X?#/ ג`    - ̀ ֐#@J@X   O @/$"  쀢 A? Ѐ #?@NQ %c` @ ch< @ ܮ`?  &@3 @X]ư &@B. `? ̀ ֐#@     ?#  ?@{є? ̀ ֐#@ْ  "? c ̀ @u @o@ (֐"@z'@d  " ?c        ̀ ֐#@z    Ѐ  ?# "%' (' ' $' , @K @Wѐ     ̀ ֐#@u  %  Ȁ ?#   (' @   ̀ ?# # #@ b@Ðb @e 8㿈 X Ѐ T 쀢 P 耢 " @q 8@ a@j0A &@, "@ "א H@ 3&@e א X@L`"  @ א h@ #$@W''(#,@W''@L耢 א x@㿘 4#@:LT  1 `@?P`? "`@ ?P  $?P ? y 4X`? "`@֐ X  "X`  4 y`?㿘J` !`L@@0  ' .  , @   ?,  , `L@ 2L@ 㿘֐  @g$@ ג`@| ג a r.  . `@q 2.? r. 㿀!   ̀ &   4א @Qb@b   X$  ̀ $@ J *  0*@! @E d @8ɠB B  @7F? @8 ,4 4@8 @#`ג!0?@#\%'@ B ดB@C ;<.< ̀ )`'  4!P@Qb `d@ @8vD  B@8o?ׅ!p'#\@֚㿐   4!@Pc0/ 耢 2ʒ@8If!聠 B@8B? 4א#a?@Aʢ@ D   4א#@,aȁ㿘 Ԁ "   0! @L$  4 #a@#0  4#@ bX0  4#@b@V㿘 `"d N@ r w N`  !@ "P  @@ `  L& P&  & 0& 4& 8& & & & && H @5  T& @*` X:  w.ה ?@< @  L@G$ & @& "N w&@   @  @   @  㿘  2? ,  XN w r?`@z ``L`T&@ `P&` &` >` >` @U @U@F㿐?#@?* @ .`@2@ 6`@'@x  ? 㿘 H ? 2 @: L"@ $  $ H ?$   ?$ @`$ 㿘ݐ ڐ * Ր * А* 㿘  Ɛגb @ p   e`bҐ`P`L&  `&* `&`P  & ??`?`` c@.@`~`P  & `2.@``l`P  & `"  H][`P  &  H  @? O"p ""! 4 ` "/'/ဦ`///666///瀦/䀦 2/  / P  /'&` ''@Jl @&'܀`  @@w? ?" @Đ"㿘`H$` \$`Z!` `@7`L"@@ $`  $`H$``@F  6 'T`@@" $@`@ @  `$ P@  "+?@ `$@   $`H@7  @X $@  !`H  T` 2` ! T`@@D" `$@&㿘?4`c @@c@@ ? @ ? `  ?@@`?c@? @@c* @!G?"P![@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@ϲ`!?@n#@j#a L(7@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@β`" !?@@`!?@#@#. @㿘?!? @5J#   @QU@##6`6 ? @#  @& & 8& #…8& 8& .  . % .   ׄ    (``    00*`ɄȒ``  . 0 .㿘 ." 1 ȁ㿘` .` " G8@ɐ ȑ* `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6 @`"8@ɐ * `@`6 @8`  `2`` 㿘  $ 㾘:;n # '  *`$``*xݐ`ʐ.6 > ː`.6 > ޒR````````````````ST,TxTULUV<VZ [\L\^^_D_h```P`X``` ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8*" <" 8 㿘 N 12:?@ 5?2 (1? $  \$ ($ 0 , 2 ( $ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 نb  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4<  ( 2   $ * $ ($ 0$ ,  (&@@    4@F"@  (#$ 0 0" @8 4  @F"@@   4@F"@ ($ 0 0 ( $ 0$ 0 , (@@$ , 㿈  $`"Ӱ?  "ϰ? 2@  2ǰ?@ 2  $@   `8`< @`g"@*` `  $@"\&  @?*` * 4 @  :ِ  6٧4 `$  . * $`   $`& 8  $@ ¤ ",&  @?*` ?c4 4*`  , $`& 8   $@`   & & & &$`<$`8P   $`& 8 $@`"& `  $4 $@"&  @?*` $`4       4    #&  $@4^ $ 4 "&  @?*`?c4  $`@   $@`@ 88 @E`@%"$`@@&@*"&  @?*`  a$``4  $`d4  $`\4ak򀢠h $@$`h`h`\@0 "o&  @?*` `hٓ*#` `p*  2$`h4`\ `he0ٓ*#` * `p2@ $`he0 $`L$`T$`l `p `l`T@Қb  &#ِ#&  $@ $@$`h "(&  @?*``T * ?`L * @@7`@7 񀤀  "&  @?* `$4`h* `p2@  c$`h   "&  @?*`` $4`h ?* `p @ 4/! `"&  @?*`` $4  4"&  @?*`` $4  4`h```d@ n??" ```h`p* 2  ??$`h```d`h *o`T@ "@e0 $`L$`T$`l`lb`` `p`T@ i`` `l*``p$`P$`X`d@  @`X Xِ  $@ "b&  @?*``T * ?`L * @@7`@7 * (7 7ꀥ ">&  @?*` *@ 2@  `L* @@7`7$ 4 $4$`@   $@ @ $@2ِ  $`H$@`H` :`H "&  @?* ``H *@`@  $`@4$  $@ "&  @?*``X * ?`P * @@7`@7 (7 7ꀥ "&  @?*` *@ 2@  `P* @@7`7$ 4 $4 @ $`D $`H$@`H` :`H "&  @?* ``H *@`D  $`D4$`,`D"@i $@`u%`D"`0 `4`($ ""@`@8`@&8`@&@"$`@ @?.``@ 2@ $@`H  `C.$@ײ` 68  ":&  @?*` %@B > `$``&$`& 8?c4 4 *` ,` ِ#&  $@   $@ ?M?& & && $`8$`<`(  @ 8     $@3?  ' %  B@B > > ``` $` `M"@$`& 8` `<@@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?   .?      ?   $? ( @ 4@BU"@  ( $ , 4 "@BL$ , $   " ? $ " ? "?" "`0   0    ( @#㿐 N?`$ 2`0H 2 < B?   < 8 " * %% 8% < ;*  8  <2`?% 8 % < % h h@ h```@ @B "  %`%@=` h ?` `z  =`=`  % "? $ 2 ?   <`?㿘 `"\?`$ "X?`("T?`, 2`0N? 0  2 4E?   $ * `( `0  `0`,€?01@A @3 @A|a0 L%0@ a,@zА" ?%0@$`L P:А" ?%0@$`P l:А" ?%0@$`l $ * 4@AX$`4& $ P .ж6 @ Ѕ(`@`(@ 6  +`"@ 8 `Є @ // 70 0$00$%  +"@*  .@( S(.K`2?7  .@1  @(`@((6 12`@ (`ڒ    ْ}!<|? (?    ?%(` ?(` &/7 /(/@7 `/7 ((&1(70 ( 6 26  ?  .( 6 8 @(@( @" "&@+  (. @  ( 4` (%< ,`(('80//7 #   /1(7 (06 26  ? ވ + $% ځ!   ڄ(㿘@H @H@: 㿘@;㿘@Brls8s8rs8rrs8s8rs8ssno4o4o4no4o4o4no4no4o4o4o4o4no4o4o4o4o4o4o4o4o4o4o4o4o4nnno4o4o4o4o4o4no4o4nnnno4nn؝xڒb8@  `Jʐ o`?#`Jʐ g`?"Jʐ m`?# J? f`?"? ''ܨ    '# 3%37ڀ 0.* @€ )  &  #   'ܒ ' ` c@+ ?J`-cJ cJ ? $c@@|ܔ@ɐcİ&*  @@܀ ` ڒbP@OL 2    6`@' @?А @q"@kL @j`b@T J`"'b@O p @Gg耢 b@O  8a'耢 9@ @?А &@;"@  @1 ""@-`ڒb@T J`"'ڒb@N 3 @L 'ڒb@NՐ ' `  @@ G :  @@ A .  @@  @, @@ @@`@   @Te ? :* @€܀ `@ ` *0r  @SbД @j` c   @@ @jm0U R` O`M   @L "L @L "L @ L@D 4/ `  @@K@R  ؀ " `  `  @G  0 @S  ؀` @ز @ 2v :@P`ڒb@SА @Ý㿐N "?@dn     ?@􀢠 `?b@M  㿐N ?@T     ?@ʚ􀢠" ڒc@Mϐ 㿘   `  #@ږ#H 4#@c0  `#ږ#@ 4ڐ#@ߒcP@0 㿘@Ɣ㿘@        *    "     " 㽐 4L4"'"0ڐ#@$Z  B + B+ 3` @; 2* @ * <̢!(`(4@Eؐ@ *   = b<9 $,@@ "(  @<$@  @3 , @<", - @ 2         @ª 㿘!D4@E (@ ,a8  4  ,4 (/  ,6+ @}@ 2$  $ `ے`@25@ܔ" ,`@6 "@. . .  ,   ,~B?< W$ ,  4  ,Q  M ,I @ $ ,  @ b !=< 9   3 /@/ * ,  ! # ""   < $b$ ,`<  ے`@1Ԑ@{`@ 6  , `,  @"". `*41 2. 2 `)   `` `` `  `J@/`  &J@J@`?㿘@㻈 4"'ے@#7 (@ Đ@ 0$@0`! @ ې 8@#-b@ @,, !aDF\!T@ <     X<   P Xې H@"bې 8@"b @k `㿘 @ Ȥ̢!( F\.`aT >`T !T   @Ӓ rې`p@ Ҕ 0l!  a(`F\!T@ <  "  <  2 P X ."$@" x@ . a(`F\!T@T  a( F\,aT:  + : "ے @ `܀  J#``܀ 6 `@ 0@"h `܀ @ `܀ 2a(@+ Ȁ  a( F\aT T > " @ a4 㾈 4" '@;_  /`  `    " 67 4   $ 쀢` 4   2 , ,  ,  @: b @ Ё㿘    @;'    ` $  2 , ,  X 4"  ???????'@ΐ̬ a(`F\T@ < `?" P X@!Ґ @ _`܀  J#``ܒ(`F\!T@2     `܀ 2 @*  @ a G @ ! .+c|"$  ''/'@ -$@!!`܀ 2 .@*Ԑ! ! ."( @`  $"$@   `܀ @!( @ `܀ $@ؐ 0 h!8@@(F\aT  <   ;<  3@!8!p@*! 6 ."( @  $)! ."$@  !@ .#<ca /'ȡ- '`*`1:`a2@   ې!@  V@Ð@p  ې!@  @g!hB!.  ?82 !@>" " @O@( F\aT   @ 4 a* "(`2 @ ǒ ے@3"@a.`  2 `܀  @' 0  @+"X`  ?  ??aP?/'А'''???@w'@P 4"' f! b``@^   ????P ???/'''''@P̘ a(`F\T@ `aB * 2` @ 2 2* @ * >`` a !( F\aT "``aB * 2` @ 2 2* @ * >`@ B@(  $@-@ @  @ b @"`㽐̴ 4!( bF'\!T@P  @%> Ҫ `̀ ˺(` 8ǰ `F\!T@ -`-` (  ;   p   @ (`F\!T@2    @( @,`8: 2   (-``*`"" -` ()"  @ : C 0>  h8   @ 9& hF%\aT  p-`@`+` : ( F\aT ړ-` p :( F\aT 0 @: C > ( F\aT "00;   ;  B> (`F\!T@.`.` (@ : p `G %(` 8!  ` P@"G  %\F!T@2   (2   (2  ( `0 F`L!Te\ e8e@   @@ @ @ ("@7(`0@ (@7"``0# .b,@7 "`0   , (`F\!T@.`.` (@ : p @`G %(` 8!  ` P@"6G  %\F!T@2   (2   (2  ( `0 F`L!Te\ e8e@   @@ @ @ 7( .b,@77 ې"p@ ܀`"@" @'ِ"  @, Z  (.`-`"" .` (+"  @ : c 2>  h8   @ ;& h( F\aT  p.` -`@ :( F\aT ڗ.` p   ;( F\aT 0 @: c > ( F\aT "00;   ;  b> ( 8@+  4b @"㿘 @C ` . ."D"\&@&` @̤ a(`F\T@ (: p(` 4@ܒ   ? @6 ` `4@ # .b,@6~ b`4  @  , ( F\aT  @6 !̐( e\F!T2`@0g @ ? @ I\ @@}" "    ` @*   ( e\ F!T. 2 !-   2 @q( F\aT  6(`F\!T@2p(`F\!T@2t@x@Q( F\aT "&p&( F\aT "&t&@a㿘@3!DF\aT ?@M2@א㿘! ` @<  ?$, @= 0?,@<  #,㿘!! ?"@'5$!㺈 4"`$' 2&`$̮ &`0a(`F\!T@2  >`(`F\!T@< @@h@e(@1(( e(Fe\ !T : 8U (   8M ( @F( %(`(%\F!T@2  h : @3(`F\!T@@5J (@5E!( 0F\  !T::`@@#B F!(aT X2e\e8 @  :@L@ C 8T @ @ &`( 8&`(%\@2 : "N`48@=: )>  @2.N`4 2@``&=`` @)ے$ې"@:@%# 2.`@ `e\`0@=: > @# ̐ @3"a`%\@2: N`4 >@`@ u ` ` (F 8T&`( 0*` * %\@ : @b( `07F: T @;9%\@2 2 N`4 @"N`4%\@2: >@`@U "7E 22 4 `2-`8`(@b>  @)G$b@@$# 2@`%\T "  @b> @# ̐ @"a  t` @!;  @d `   4" @#@㷀 4"M4' 2 '@ 2 4#'@(   !̨!(  0@%z 0` : t@!<  F@B@Ж!(  `t:   @ !(  `tF@B@ 5"@N !(  t@ I@F!T.`9%\@2 ``,`  + @ $$@#H`܀  @#h`,`"@@)#  %\@ ` : -` ` t@ Ǩ `@%` @6y`̬!(  F%\!T@ 2 ``` (M4@ @ ! %\F!T@: @`=$ "<B`M4 264 218,@b: @($ې"@s@#Ȑ# 2@Y%\F!T "@b:@ڐ#  @k"a`  f` @ `  ?%` 4 @͐#p㿘% 2$ `(! aa2a@a@b:  ̀@ 8  !( `8̘ >; @ @  ;B  (@(  `( 8ے :`@#x@nڰ   :@  =@ < @;E- :  @ :`D @ D (2s @(p  @ =F 8@  @;"- :  @ :`D @ D 2 @ (  `(  :@  @:-  `: @ D @ 8D ۘ@# @ :F@є  @:ْ-  `:  D 8 D ې#@ژF `@ F 8@8426 2 `,( = @;` @:- `: @ D @ 8D ۖ@# @ F ܐ  @   㿘 ! ܐ (@ג! +̀ a(a( `x ?!̨a(    :`@8h @H @8^ * @:N   D:` D @@8N x `̑* axD  ?" 0@" $!xx@88 @:)x%a( F\aT x@!x * x@!x * 㿘! ` "!! +ܐ H@ea-̀ Pʢ(`)!༐ ฦ %! @7: @ݒ`  @7aȔ* @9   :`DaȦ  D @@7 x `*  d@ΐD̤ !@ò !̒ !̒ %acp!!@$!"!( F\aT  !"㿘!̮ "!""a V"̚!( 8e<F`H e\̔T "!2̓2"!İa( %)!Đ@;8$̒@\F!T@%!**"!ᰀ ̐ $!a""  @+ya %@ pḀ 1!!`㿘!! "$!@,/$!㿘̨!( 0F\  !T::`  @@>B ` 8 `,` ( 0@+8 2@j !@ch* `$"$ $ $ $ $ !( $ $ e\F!T2  $ $  %'3 F\aT +  (+  (@ : p @ : `   !(` F Т!(aT  X  `%\@+ : @;@ ` Ԁ@آ`dct@,},` 2$@ &ctct* "  $؁㿘!ܠ@?ch*      2 ܐ @ߒ㿘ch  !t*`   @+cct?@+\h@+Zct$ct$hx * 㿘 "aDF\!T@ <  "  <  2!!ܐ @Ғ@_ 3`܀ @ ! *`܀ @3!aB:aaDF\!T@ ːb@/F ̐c@/@!    * 㿘   2   @/* 㿘  "  @  2  ! 8 &   㿐ܐ!(@ b! ^G@Ӑ!0̠ a(`F\!T@2  p@U !(@!8!(`F\!T@2  p@!@!(`F\!T@@!H`܀  !(@@!X!(`F\!T@2   ܔ @!`!(`F\!T@2 , '@Pܔ`!p@}`㿘ܐ!@@p!`  `" ``  ̀`  0   * * ܐ!@ `㿐̬     ``]  !  `  @  2  ̪!( @5 ; @=  @7-  : @  D @ :`D @@"U@  a(Ԁ "a(ܐ!@|a( @2 @"U@"\ a( @  *@ , < @ ?@ $ (@  @    *`$% @  *@%@" $ ( *` a( F\aT @! : < pa(`F\!T@2  p ( : a(%  t@ a( @  H*@@5*'$ p@5.$ tA$ R$ c$  :s< : |$ h F\aT 4a( F\aT @5$ a( F\aT @4$ a( F\aT "$ d$ X@ea(`F\!T@ :< a( F\aT "$ $ Da( F\aT  :< (a( F\aT "$ $ @a( F\aT  :< 0a( F\aT "$ $$ Ha( F\aT 4 :< a( F\aT 4:  : < `B : `6`  `  *`  %`ܒ",ᄐ b@o "В@S0,ᄐ cb@a ''#  #% !,ؐ m@T p&(@"@5 a,!  ,a !,a ,!  @u#@i?? 3#ē*@  & @  P@ `܀ P!@ PL@    ?@@`  @F ?aЀ  '@㿐@ے"J ܐ#`@*㿘 @ʒcx "   @Òc 2  @c "   @c 2     ( 4"`ܺ ' Pb@@1 `@` `܀ @%#@ ? ``܀ @ #!#p?"!@5?$#p! ؀? @5?$  . "#*l̐a( ܒ`@i#@ "@a#@^#@` `܀ J#`"@ΐ @I @@ `܀ @A h@`܀ @9 @ )`܀ @1 @ `܀ @( @ 9̮(8 ; @@ `ȄF`!!#\@ 6`.  .`@B2`* @ *`B2*@ *@$@6`.  @.`@:c3`+ 0 B+`@D4`, ,`4,@ <@@  @ ;`ݒ! #\@Ζ ` ?!@  b b ?!ݒ !X@ `+ˀ -/l9̔!(,<8@ 8@|c  Ȗ@ D4@ D ?:@5B8 @ ; D ̒ ; @_;`!@ F b@ d ̀: ݐ!p@o` @h!  '%  @]  2 @Wb @Q!b  '% @I 2 @C%b# %|a  @U ̘a( : :d0 + 㬀 4̔!(J 0 `,6*̨ + < @;  @2, :  @ :`D @ d@D `ؔ  @ `,& a *lK#l@la(@%!@%'!!@%"` cL@%"@% ˒#@%`a 9`܀ @͐! K#l @" @  "!ݐ"@@C# ``@@ ܐ#"@'''@>   `܀ @"H@g  4  4" @"h㿘!D!,@2w! ݐ@   `̔!(`, /53 . ``@2Y``@2T- `   @2J`  @2D-  @@ @ ̘ a<` ` +@`@* ``,&`( 4?L@3 @@ ̘ a<` ` +@`@*   (5?? /'?????`,1!8 ::&c|G% U a`@1N`=  @ב;  @1-  : @  D @ :`D @ٔ`e\2` x#x-  " @  % @`@ ``,&`w&c|㿐 4"'̨ a(`F\T@ < @`i!(!( F%\aT U˒c(@)B 0 3˒c@X@): + ' @" U%\a ;̒` p@)" ` ̒`@)     !ݐ"@@>"耢 ϐ!(F\aT ˒b@({ 0ːc@(u!  ``* `0Fe\ !T̙:"a@ B C?!(`F\!T@2  &   `-̒!(`F\!T@2 ݐ"@ -̒ :<`܀ $ <@2!!(@ϐ# !(`!( F\aT 4 :<!( F\aT  !o4!( 0F\  !T: :`@@ڐB @@ҐB ? `&? `\-̒!(`F\!T@2  ݐ#@K-̀@@((@-̒!(`F\!T@!( Ԁ`!( z`8x!(!(;s!(`F\!T@2h :@c`!(   \F# aTd#p `(:   p@?  @@ "@#( `!(`F\!T@2 *!(`F\!T@2 ݖ #@@'!(F\aT  $h@'=(!(`F\!T@  <!( e(Fe\ !T :8(!(!(   !(!(@!( e( :-e\F!T@2 h : . @)!(`F\!T@2B*2B*2@  -̠   !D`t@/?   4+, ,  t`(F!(aT`%\@2 :@ ฀ >`e\9h:     !D`t@1/   ., ,  Ԙ`XF!(aT`%\@2 :@฀ `e\@O ޠ   @ ̐!( a̒`%\B FT;aሀ . 2 !(`F\!T@T  @ @!;  2@ #@# 2@ ݐ#@ `c"""""@&!(`F\!T@2  @ @@ @   @  *@ )$p3$t @  *@5` *`  *!(`Fe\!T# Ԁ` ? 5`%\@$<#4!( F\aT $E4ʐ  ::&`%!(  4`0@.:` &`0 e\FaT  : h:    !(e !( ]!(`F\!T@2h`0#@ ܀ @p 0$h@E  @֐!( F\aT "`0`0 :<-ސ @ Ӓ @  *@@#"耢  @  *@!(F\aT ˒b@%[ 0ːc@%U! @0 8㿘  (^ / `H `B :2  (` ( ( @  P ܀`@ h @ΐ#  @m ݐ#@ ;c ($+-/3)7ހ   z ̕, 4` !K@ `:  <  Ȗ `B =  * ( d xAa `B =a  @ 8  ܀`@} N @ @ c@  2@  @k < @  @ ڒc!|`:#!|" "@""@!|!|@ !|`2@` 2@!|@2  0`2#!|` " 0#!| 0`  D w& 0㿘!D!,@-9!,ސ@Ԕ   `  6?Д? 'Є(/?????6`, ."0ʤ  "a("| ,  `@6 +)̦( %a,~   ' @    ` @  `,&&#|㿘 (  ;5ʐ*  2 (/ʀ +-ޢ a| a| Va( < : $a(a|a| 2 a| (@ D? ːް߸ߜ,ް뼝㿘!4a0@)H   㿘!4a0h@  @$P 4 '  ?`} 7 *` €@ !@@!   @ߐ ސ!@ a Ɣ!퀢 i @ !@ Ґ!@'! i   챔!퀢 T @ !@" 2L @ ސ!@ a@ "@! H   쐔!퀢 3 @ n!@"8  @ ސ!@ ba ̐a( F\!T /3a( F\aT  3   ސ"@@ A ` `  *`#!ct;!ؖ@o !ظct  *97# .?al:? ʬ "0/' |?????؀$a4F!(aT314  `%4`!a b`"$ @"8 X `%\@   ; ,I ; B $@ J#` bx"@ "#̒ +;  ;<` ""@ "#`܀ @i" `ܐ! >`$ @9"耢  `%\@  ;  @"Δ!`e\7`%\@  <` +` ,+``( " %\@+` ( @`p@ <`  @*`` F!DaT `X`Ж \+`+`  <`` ' ~'Ф*Ct7!,&|K%4+)'1/a4  :$a4  "7  2?0   "'$ @b8 %#   ሓ*` ?2  @b8 # ሗ*  3  ሕ* ?3    $ *!&|t* @  `"   "  $  $ " *N b @#(x  4   `'" 0 !    @ 2 , 0 2 0 (!ޒ#0@W 2#    ސ 坒c8 $@)"8 "  `"e 0  ` 剒cX T, 偒cp  `' // /#0@!  ?  ޒc@ ސ#@2 0 6, @#( 0 "7@!*ޒ7@!# 0̒`& 0 !* ?2 @!p4@"8 "  0 4:  ' // /+ސc@쨔! 0  ?   ` `@@v"@74 0̐ & 0 !* ?2 @!/4 c@원 2 U$  Q ݒc ,@i"8 "F E ޒc0@{   ̔ߐ @?  侔@ 8?$ $ 䱔7@ @2"8 "  0 & 0`!*` ?2  "  `( 0L .2%!`2L  |`h$@ "8 "   .2 l`x$@"8 "ܨ ݰ & 0a   ߒ  @ ` 7 ԓ*` € 0  D@ː  0 ` @  2   ܀` J#`ߔ  &@ ``=̆!( FaT\ @  <    +@ <  +@ ( *`\F!Ta2@  ) 0 , ؖ @$ @$ߐ ؒ@ ܀`@z!5 @P `0` 0  $ `` 2`   㬔 `"8 2`@., " !*` ?2 ߐ!0@ `2$   @D!P@((@b  ?4  `  㿘!8aؐ@璉   㿘!t*` ; ."  ^"|-8 %8 P? ) ``Gt @  @?  @  2 a܀  1     @  ܀$  Y !a*$ $  ?3  $  $ "      *jt8&#||DDH㿘!<a@!   `  ?a(" ?x2"`"  @#"ߒbĔ ,xb쓐( F\aT 2      bߒb   ߒ "(@Px a( `,@a(&#|㿘 (  D)/̐&  ?3 . 6` ̪  >  J@ `: $   2 2  < @% 2`@>  @  +* +@ ȒB?=Ȳ`F ÐX㿘!@aD@$   ?b 4!(``'?#` @c?b@ "@X $ ! ܀ @" ܀ 2 %$@8" "X%$ ,` "aX $  "Ѐ   ߨ"؀ o `4 %$P@&$, *  `,`: `,`: 0``:@`,``:  !  ܀ !ߐ"@=%$ ܀ @ " 4 ܀ ߐ#@P@%, *  `,`: `,`$:  `:@`*`: @L %̒ (* "L? (L?# T# &@"U$?P?"":`# %P?#a"?b!@`"@̒(`U\!@  $\$T,  $X@%P* $\?" `# ?\:`" $`? "?:`"  $d$  $h$ * @$l`:@`,`: $d@\"Ud?$#"@ ?## "@#(?#  @Ő? Ԗ  "  , 4$ $ 8?  ?? ? ? ???? 8<  ?< 6,̘ a<  +@* ,="!Da ."#| ʀ@  "a@?`   ʑ;`@ #!@  @$ג/@  : @  D @ :`D @ Д@"U@ " Ԁ ߐ#P@P: @  @8E4 82<@(8$$ <,?@2@?44&@$$ $$8@&S $p$$$$$ (@6$($(,`&$,@6$,$,$0\F!T@24$x40`&@&$0x@($x$x$t0  &$0@"U@$4$8$<$@$D$H$L$P\?@Ւ L2@"U$@$5cx/`   ? "` /`6" @ ` = *` € $ @bU? $ <b\  *@   * cxߒ #p@Ycx Π ` @"U  <b\ *  * $ x  - @"U#̞ @ < E 2*@ a:J@ : 28@: ` +@*8 ܄8 $$`$988@%]l: 8@%W   *@ (,&$$$@"U@:c` 8 " $  : :@ 4@ 8 @ :E 48@88$ 4 lph    @  $4*   #  (  p瀋@ %?$4*  # %?$  ; B?   ; B?    ; B?   ; B? L@@  ߐ@ɒc  $@($   $ $$ *  @ ?@ ?c ߐ p@c  ?#@̒  *` J#`?b@@ F?@"U\ \ $@"U  3ߩ,."`\ : 2 `@"|@cТ``? &?" 6F@"U` ` $@"U  3ߩ,."`\ : 2 `@"1@͐c``?"€@"U@\@"U\? @ $?c  8@ڒ` @"U@\@"U@\?# @̒  *` ?b@,@@&L .?"|?%P#?"c@ cߐ@c b@@ @-В(-Ґ *`  4 @ː 8 . . t | .t .x㿘 4'H'L'P'T'X#@fH@ 㿘   ."|` ."t@ @u  ."|` @    .t@ @j 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@{@څ 㿘 'H'L'P'T'XH@8 (@ǒ / @ɒ <   L` r`@Ր `@’㿘@ / 1ʒ$!H@, /,`Ȕ$@I!H!H @E$!H H .""x! @   @ 0E@ = '< @@#0@"x %"x@k  ~@ !  @֐!@ `ˢ @  `2 㿘 a @-ϐ @ a @-ǐ 㿘`a0@- @i  @a0@- 㿘@̐ a@@- 㹰 4"Ja˒?*#|""p  '@   @{@ٓ@l# <   #0@8#P " @ e  'cp@z@s@L#`ְ `܀  #x@AJ!` ܐ@ F   &`ܐ?`&`#@+#܀ @$#˘??"a("!:, :($   ,` $`@)$ @&  $``cpS#@ "" ("a"@  q`Ѐ y ܀ 2v cp@ n@#Ѐ i̢"a( ,@ @l% Ѐ   4@20 A, $D ; @< @, :  @ :`D @ @D % @= D#\#`0P x@`  А   `( J@{!(  `р܀ !8!@!? 2(!H( $81 ,5:a @D  0̓*@ *` t  :` :"   @#<` @ E (  `!p@ !`2( " , (  <`c!@!2(  "`<, (   @ *@!  "@!܀   @Ր! 2( * , ( `0`H  w" `0ܐ "`H@ߐ!܀   @"0 2( * , ( `4`L  T"8 `4ܐ "`L@!܀   @"0 ( * , (  P 0,@ @  0"`@1 0ܐ?`$ P@!܀ 2 @j"0 2(* , (  T 4,@ @   "@  4ܐ?`$ T@s!܀ 2 @F"0 (* , ( , $H0204(04" `:%0@K!܀   @"0 ( * , (`F\!T@ x <(@"``"%(@&!܀   @"0 ( * ,` (  H8%8: @ %< "!(%<#  H8  ܑ:;%8@~!܀   @ΐ"0 2( * , (  L8%@: @ %D "! %Dj#8  L8  ܑ:;%@@~А!܀   @"0   * ,   & 8  ::8 L8  ::@&  2( e,.܀ 2 @~# + +#`Ԛ(` "Ԓ ",` <:%0` "(`H8  ; 88` L8: ;%@*` +`  S( eL2P ܀ 2 @J#Ѐ  #( " #%L "P#\"eT%`"X`eP@@, *  ``,`: ``,`e$:  ``:@`*`: ( L%@  $` * ( ( `eP@, *  ``,`: `,`: e$ :` ``:`*`: (``Le@ B;   "D(`#``eP@ۡ, *  ``,`: ``,`e$:  ``:@`*`: ( L%@ ܖ $`@}Đ!܀   @"0 ( * , ( U\a 02 2 (` x@1 ``" x@}!܀   @n"0 ( * ,` ( U\a 02 2 (` t@ (``" t@}r!܀   @E"0 〒 * ,` L  Ѐ`2 ((  @~`h`@l(  @  "cL cL 2``@}B @0ɤ : 3/57 ``0"4cL`8@ `d: dH@ @B cp  @v 2 `x@P  @ ]  0  Ϫ``B 6+ `B + 3`@; B: 2   B*2@ *` @̀ "a @|0h!  @ ̀ "`!  @|Ӓ`0Z!  @ ̀  "a! ` @|ē*`0K(` ,@!ˀ $#x`,@|!0<`# a2 8"@ "@a̒` "!!̐ $!@Ғ ˀ "ct! !8a@ǒ ˀ "cha!`@|*`0@( eː *c*# @   4" @z!㿘 Ф `  :`̠!(cp @ 2I  Fe\!T@OU!@Ka" ?6U!(a 9̢ 75F3@@!@: p@ Te\ 2`  < c耢 c쀢 b`@?ר b-  2a̠a( $ :a(,  a4\aF!T@a( @Ґ     , @ɐ? aبa( h a0@2 •o@@$4wb2 • 4 ␒`& : !eb8!: @ `d `4 @P*@ : $!@ЀP=a(`,%`?  ; @f;`  ,@l*@  : @  D @ :`D h@c 2]  @ $ `+@{]"`  h ?' x $ @{L:`  b@95 a(F\!T@*  ::0`$ ; ;d8(88@`;8`0&`,#&`8&`@l?@h@Z&?`&<``* &@"* &|?@8?@@:&@4@&@:?@6&,`&d <`` &dP@, *  `,`: `,`$: 0`:@`*`:  8`( ( `(`:`: &&`(̰ "!㿘e!ː`e@!H 6!H  @s{@ q#`#x0` 2v `  2q ` 2l ` 2g ` 2b ` 2] `, ,2X `0 02S `4 42N `8 82I `H H2D `L L2? `P P2: `T T25 `` `20 `d d2+ `h h2& `t t2! `x x2 ` 2 ` 2 ` 2  ` 2 e\%\  㿘̖!( F\aT < @  ("$ 4 0" 0    ` (`F\!T@@y+#ذ 㿘 ܀`#`@`?@y J!` ؀` @y (]*clJa     4J!` 4@x 8L "+) 4@x`H@Y`$@  $ F."X X  ` "X %ˀ   4X`? "`@Ɛ 2 y Y n N˒@x y Y  -*#l 㿘̤!(0"a@ "x 2 X!P̐??:""* $ $  0@8($  1? ?ǐ X$ $ $ " $ % , <6aP@  (`@ }`0 `2 @ B@ @aP" 㿘̢!P`'!Dd@3  2     2P` P  2 Pw x@P   $#   " $ $ "` "  $ 㿘!Dd@  `@˒`"p @G& & >㿘N` F` !@`2  @T `@.` `@&`̐!(@( ` # '`#L@@ 8$H d@ : @C   0"ؘ@` 0  㿘 ܠ`@w  Вe  א 㿐 ' @ Ɣ`ب   !@#p?$#p @  0̖!(F\!T@ 4" 'd<"`$D"(dL"`"c"`"d "` Ӑ *'@ [(J#|`(#a: @V( (    ܀`2 !  a: @<=( ؒ , 0 !,   @7̲!P +̀`'5̀@"aP ` @`@  ؐaP @"$"@;!  %ax(  `р ܀`g!8 !X " (` *  *`  !!#̑*` *  a@q* !!p@vap@? @&p% ؐ @  㿘! :`@ @I  ! @l !@. 6!ڔ @ @vo! L ';༐@ༀ =@< E@ :C  @ ༀ !` :`@)༒@ ; @cB @8F@v3a @ : F @v'a༤@@v 㿘 e! :`@ @  !e @9є̐ C"a!U@ 6!H@u! )#+a@9a  <  D @ :C  @w !@y : F @ua!޲@@u 㿘̴ ખ  ̠!( `8@   %̔!(`8   3/@ ᐓ: J :2  : J :!   : H :" 6h@ @<@C<  @L,  : @  D @ :`D E U " #Ԁ " ƒ@ #=`U%̆  :` `(  *   @:  ` ` (*@ *``Ȓ `8B@ >` ?"%  $"% $``8"@n !( `8 !(8; ; bSP!( `?'`  .cxb@cx     ` `` bH@֢0L  ?? $cx/'?????# .#'+#@''ܐ ''& "@ ?&@@ Œ / @ .@܀+#|bP''' +$cx ?.@|@ " 㿘 Ԁ` @d 㻐# 4b'X$@@ @83 ̐ "aВ @ b @]"㿘@m@   @Ґ  @ϐ @m"㿘 $ '   !# $N 4 s " ܀` @t" & $ "   & $ & $^"p 4"'@m .#|'€$ !"@   .#'@  'Ԑ b'''@ '`  '' @@@mi" @ې"㿘 8 ./  +-.`,  '; ) @@2  8&/@/ 8 /`/  8܀  8    !* * "2@: @ *  (` @*2@: @ *  (` @2@: @ +` @ `? 8    *#+@ *+@ 2@:  @*` * **2@:  @*` *  *2@: @ +*@+@ 8     #+@  +@ *2@:  @* * *2@:  @*  * *2@: @ +@+@ 8 * * `?2@: *   *2@: *  ( @  `?2@: :   㿘@# ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ]ȝX@$`  @ǐ  4#@4aP@ @l "  4#@(a`@y !x @- @Y 6@Ӑ!@! @ʐ! s S#, / "`P / "`L!@@F6逤f 3#Ā"S@!S!, @R   S#\#`#d!\    @E W#\   ! @< X  @7       #\#l;p;x #`'#d#h#    @B  @g   ?''' @  @ @D @B @@  /@ P@ 㿀  ?''L'P'T'X'H'`L?`' '' @  ?`?㿐'L'P'T'X'H L?`(@kd " **@& ?㿘 'H'L'P'T'X@QH@a@] 㿘'H'L'P'T'X @AH@Qxa 'H'L'P'T'X@ @VH㿘 / T `" T@㿘@ ܐ"@% @r㿈   ?'  @ ? @j?@Ɋ"0㿐'DD  ?   D@{ ? @j@lD"X㿘㿘  @S b@૔ 㿘@/@Ґ @5 ?"_@ @?"U@  㷀) 4"'%$@'$@ߐ  @ 'Ɛ"' @8 '' c@kE#@p#cH;''@ocH2@{ @Ȑ % /)#p? @p  ?BS$P ( /?@p ?@? @jB %#〢  #ؐ@m ?P / P 2"   ڐ @1 @~  S#, / T" L" @ Pp@X 4?  ?ؐ ''' @  @  ," / L1 ` h'耢' p '' @ !@of" "{ h@1 ? bh? @p&  ?@А \1S@p ?@h?@i  b]hB1S׀  bNh@mY ?Ԑ?Ԑ     / PX X@?'@#60͐! 2 21S /"L!`ah@I1V!#,㿘1! "  @ "  @iN@!p    @ڧ &!  @i; @!㿈̖ D! '''' 'D  @iD@Ǭ !㿐̒ ! ''   @i@Ǔ Ȑ!㿀̒D! '' 'D  @~ 㿘@ 2  @  # @aЀ & @%  a@ , &  㿘@   " @@   @@ @㿘 ) /  +@# , @ , & &aؔ@, ?a@ @    & ("!& $& $$ (㿘  @@ `a@@,ʐ ?a@ x   $  " @ %$ ` !   @@` $ "  V  $  "8 @ $  㿘%耤    " (P ([ 2 $耢  1S#,`d 2@ @1W!㿐@S?  "X0' @ @) 6 " @mv@ @" @@ 㿈@b ` `? @??@? `"s? o@\@  @S?0b@PO 1`  Z$`  W$` "1`@B` @!?@g @g @g  c@1” @"@ߐ c@1 @@@ ` $ 4 ``"#@y ` `@q ' @ `@l@`@#H`@ 㿘#a耢 4H /o   @+ # $  $` ("`($a (` $"`$c0H?2$ W" /"`P@ $ ?RH(W X ,XXXX / P / P㿘! /$ P  !@p &  ( "1 /  2 (?2& W"$ P 1 / @m2 ?" P P ? / P㿘'耦 D  ?&  ( 2 0;  ( 2 @ ` 2 (  &  #pQ& "     ?&   ="   @jE& 0Β@T @!耦 "1W `2 (`&  @j,  ( 2 1W!耠 W  (2 W!̄  㿘 / X@ @" X㿀!耤      @i$  ( 2 @@ #!`@ c1 h@ߒ ?"A @q?; )  ? ''' @ %  @ ! C" @ ! `` hc@j"#" hc@S @lS 䀊   2  2  / X@ " X #,  @i??#@e & /$a@M ? @l. ?"a{a쀢 @e ?@e "  /  $h# /@  X1S#,㿘@@0 !耢` `  "` `(`2` !`c@v  .  @iR??!@e "%1S$!@ ? @kޔ ?"!+!쀢 @em ?@eg   $#1S#,㿘@ (   @*`2 㿐@ ' @ @ `@㿐  `@kn "L@ " n L` o `@P = ", `"@ 2  - @ @ @` @ H` @  2 &*@ &" `X@  "(&@ "$&@@d"@# # 2&@@d "2 &@`x@m   m m m m m m m m m m m m m m m h h m m m iH i m m m m m m m m m m m m m i i m j0 jx j k kL m m m k m k m l m l lX 4"  '@%a ?    /"!"c"@q!@'㜀 !8!P@>??`5Y#8*` ̐  "c!c"    @ /""@~!p`!c"   #@͚̀""Ӑ!c""#!c"  @@ /""!!c"   #@ /""!!c"   #@̀""!!c""  @@ /"""!c"   #@p /""v"(!c"   #@^ /y""d"H!c"   #@L̀g""R"h!c"    c@; /V""A"㜀  c / /"`/G`!c"@ϒb "  / /"a8"@Òb  / /"!-"a"@")` / $"a!c"  ?@̀:""@ `c"c@˗ 2 `@` 3#Ā`*`@ & #& @Ȑ @ +В?@ 3 +c 5@ @ɒ +c@b &c$@%8($%@@hw(@$@ܐ@hmcP@] c 'c`@5 "X @!  " @$.''''77ʮ?''77'7 /7@k / !#h$cp@Ϝ##@؀?2 #xcp#@Ϗ$## M?@  6 @b@#@ڒ@   )@bt@#@˒#p@   %c#p`@   r,``@ʹ  @ʴ  #@!'c #cĀ "@[ 2 c@# @ 6 @b%@#@|@؀ 6 c@b@#@mc 2@!<  #@^  #@*@@5 ?"J?`` 5 А    2@@7 @M  5 А     *: :` @  B 2 ` @ @@M ` @ h@ M̚##`@2 ` ` @  B;#`  @ @B # 2` # ̚  @C  M @@ژ c  % / ( "c@@͐ % /  `  ? *`2 @*& &  / ((*($ /  ` 2   *@ "   /!*  4 "c  / /!* "c /! % /   /!? c @)ڒ  $c H /!  /!2 !2 "cH @#\ @ 1#  @  @0# @@@8 㿘e!̐`e@! 6!3cĀ  `@Ze" c@'#0 @h!P /!@!㿘# 6e6 e`g@ @h!`!p@㿘'H'L'P'T'XH @      @ @ @@)V@ސ 㿘#     4#@a0  4#@xb8@ɐ % 4'@`mc`,pc@ @]@h@* @`W" @ɐ#` 4'D''H'T'X @%̀  $@@ݐ ̀ "cch@ @㜀 )#: @r#   @`  "cp@ #\   @ ?̀"#cp@  @6  /a"cԀ "c c2 /   /ccx#@   / #@ 'c #@ ?'㨢 㘒@ B? /! / /!Ѐ a L  cȔ@   /! c@ w # ` @ n @`P @ f `@ ^  `@ V  ; ;`8@8 8 88 4 H L 0@ "`P@ `4`0"`T:  "`8 `4; `@ 3 @ "```4@@ Д @$ d<$8@{ 4 /e`$ |$ $%\$ X "$%P 0 2 2 <#$ t $ x?$%,$%( < $%,$%(В?$< < " " $" D" "#X" " @"  0 2` @2` x$%($%,<#$ t$ x+c4? ; @  B @ = @析C8 ; @ B <@擔@P  @$?@@R0@+ @ *` :` ; <0$$  cА t @-;  %0@B?<%0# 4c" %c!#+cT:@& x@!#Фd8< )d<##$<)#`x`` : @$```8@@@ʒ@$`$`#В`?@`x?@@``< @$```8@@@@$`$`#В@x?@@ђP, @$*  `,`: ,$: 0``*`< , :` #} 4 y#c!0@'+ /a#@  #Е:`@$8 4)̀   )#В8@J$x?@E@|a@ 9$<`8@夢<41#2#Ѐ@ +#`eP@e, *  ``,`: ``,`e$: `0``:@`*`:  #)̀ ()#В``8"@$``x?@@1a $`!`@&# & % @ x?@@% %`?  ;`; d8@ @=C$`,`x```@͓: ``8@@@ƒ@; d8   d<  $8a@ T    $8>@͖4 @  @–@2 8+c !@&- /ሀ cc |@ $ ``,"`"`"`c`eP@, *  ``,`: ``,`e$:  ``:@`*`: @c L%@ $` x ` @R:   ,%D*` L @ @; $ <$H$ @Ð ̀ "cb@ ސ c3DL%h "h"h /! /c  cК * c" <" \" "":$P"$X*c* "%Hc@" c*`c"`  4?@   $8:`  ," d@;@ : d `=$@@D 8 @@ :  d :` =#&:  D =$@? >e  =$=$@=# / :ሀ=$0$4% $D$L% (% ##% % $$ % %  ; /c@$8c48 "d"D@?xx?  H#\@b c  4' 8$"D@?x ,x"H?@b˖ /ሀ % @ #ch@֐ 'c@o: @%\F!T@ ce $%\@_: @@c7@S#: @ /a cF!TU!5 / "\@b"0  @֐ ]c@ H"#@ cЮ`0#@4 *`*`  "c"#!#@x#̀ $cb@ &#@t c@,cGc"#@Ր 2=%Ж ; @=Т @%- Ж:  @ :`D @ d@D  'ؐ@ȴ d c8 c?&@b" "@b 4@倐"#Ь , /! 2@a"# #  /@}ې  / TX@d\ b@; ##" #$" $ "  " @ #c@( #cШ @#: @c "Dc T= $H :@  d@⤐C  0" ܐ  @c 0  cD *` % 8 4@  @@b"Р?`8@b,  D 4*  2 @}#㿐'д< >@H 8E 4  7<@$87Ж @.;  @7. @ :  :`D @ d@,D  #@: #@ D #  @c @| ( @  .@ @@ @@ @@ %@$@  4?@ @#! .@'#@| В#@?`U":"  "t x *  4 ; /a&@"x"`  ,?2 22#̐  ""Tv:2"t"xഓ*``"X഑* @"\"\#`#̐`,` \: @# ``,: @# d` $`cP@ %  #  #@"U@= b\  * @*#̨ ` ?"`  ~'А 8@/%@bU `@V a`]" `d`@-̗* @"U@TT @ "̒bU " X`d`@-* ̐  @Ф  d @-@&%P* 'eP $%`d`@z-@`@`Р`d`@z-@z`@`А@z`@eP@`*  4# 8''А8@z *$#̓*`4  " 8@%@#@"U@<`c` ` * @*#̢``$@ "`$͖#̬~8 8@}#c@bU `@c /a `^"!#`d`@b-c̗* @"U@TT @ "c̒bU " X#`d`@F-* c̐  @#Т  d @;-@r%P* @%eP $%@`d`@z -@*`@``Р`d`@z-@y`@T`А@y`@MeP@`* @@ 4@c͖  8̬` # ( "@*`4  " !#@"U@=c`  * @*c̬`$ `  "`$!#̔ @A`%0&'#̒@@  0㌬  x*   ")F%\aT @)$ l @$$`Pa?2)#Ж @;  @ʒ. :  @ :`D @ d@߿D @& /! @# 83* c @ @`$ l`x@ 'Ж @⏑;  @. : @ D @ 8D d@ = @߉Dc0@ 8' x ` @B< +́㾘 @!#' ''@7'h 'l!@7@'h'l /! `7 0   / !@p1͒: ?#@ 4`' # L@@ 8B @ * 2`  '`d+  :@4@ϒ 0 㾘! @> ?(7?@? @'' 7 / @0!: !#? 4@O ?hhl@#а  L%@8@ B @ * 2`  2 ? d@@Q 4@ 0 㿘̦ #"`` `6` @`?$@a, @*` `2` @"㿘#Ь  : d@ޭ# @cc@"U@9#x  2## #@"U@c`cВ 8 ; @޶ @ cc 8: @ F ' : ږ#@Ͱ   cА`@s̚ @"U@`@# + cА?# ccܒB?;c ? "  # c`B ;c " /! !cАd@/c  @[; ̙*`@bU  TT @?"̒bU  cd@c  @;; *`̒` c X d@   @,; %P @; *`@ !#eP ;`d@#  @Օ; #  @; #  @Ε; #Ф d@֒#  @߿; #  @ߺ; #  @ต; #В  D @߮; %P @୕;   @; *`@ @?4@!#`0F`4@q ##cܞ8` #@ #` 8 @ 8C c8$4@"$8"@*`  " 8$͆@ ;Fc̛* 2`@@ "U@ `   * @*#О 8#  :@b d @́㿘- / @)& l@)& P##  :@H dc@ c@"U@" cx@ )6`\? "  `  * @*#  :@( d @c#ܒB?:?",@@ #c@z  +̦  :`@ @ @  * @   D :`D @U@ x `*  d@D  0@"c  #А@U`xc* @@  #А@U`xc* @@!#А0@0c㿘# #: @ߨ @0#: @ߛ  ͖ #Ԓ@`@Đ "㿘# #: @| @0# #: @j  ͖ #ؒ@9`0@ $㿘 8>"># 8 2 8@ `?>@ * @ * *@ `?@*` @ `?@ P 㿘 8 >   8 .@>@ *` @ *` * * .@ >@+ * .@ 8@n h㿘 8 >   8  .@>@ * @ * * @ .@ >@+  .@ 8@A 㿐`h @୔?   @  @ " P㿘  *     `@ 㿘@1 ( (  (  ` ( ( 㿘`@Š ͬ "c )j'#!%/ 357̀ "*  @€ $ $c $# $# $c %c @@./Ȁ??ē* & @ c䀢 @@D@  @ݞ &@0@@v%㿘#`  #`#쀠 @   @7x  @: ?` Kj!*` €䀢 ``p`! @. @[c`!`@# Ж@T 2䀢 ``R`! @ @=E䀢 C``@Z`@ <@9]  6$` `  䀢 2 `:``@F`@ (`:  @)` #``@| @[` 䀢 " `@S@` `@Z ͐ "c@7 2`:@S.``@ @7( N 3/)ͦ -<+5@ > 0c  c#耢`c@Đ-%#  #͐@ "$ @Ɛ #`@@Z "c䀢 @R`@Z-%#  8 4"' ` ?@  n`<  "` p  `@q!g  @% "T@帒?N$*$@# 2`8a@@  @R :@ 5  @ @-`8 @< $@   @ @`8 @& @~  @@ꮐ @Y @͐ "c@ꡐ  @t!P㿘@, 2    @kﶦf4 8  x# 4b '! 4a`@#02#쀢`_< ( Y@  "U @Q` 2O @ u@ @Ғ O逢  !! 4#\ap@ܐ#@۸# 4 bX`? "`@B "X  &"X `  4"X ? $ @."X  &"X` 2 `y `Yb b @t!㿘 @ %#@Z| ? (J /"*@Zl / J .2 J  .2 J 2    @,a $ `&   &  㿘   4a@S#@s 㿘@h@@Z, /Δ `" `@"@bh   1 bp" X  bx@" ; 1"!c+ 3' 17 15 0/ 0  t "@@+H? fc`X*@`&  @ `  `@ `? `@~`@y@% : $T@ :,@T@` `X@s* `X $@T '@Ѳ`%`Ȓ@ @P 2    "T @ @*̰ 6 @P`  1 T`"@W @r  =T @`7А @ ' J` T@b@=  'T  W@ Ԁ  T0  a@ܚ 'T 1 X`b@ߐ bД@ڐ  @@Ta@{ b@ǐ @ T @@r 㿘 1R \ \T`"V@2 V  @V#8V  @&#X V @!#` 4`? "`Ⱂ * "V@Vx#0 @X   @Vp#h #@Vk 㿘  N  #@V\#@VVu`sN o 4 b`?"``" <* H$"@ <EN * @:`"` ,?"``"* $"@ ,* : %  4" :?`&  @  "* $" @* : 4 NN 4N`"`?"``" >* $"@Ð >㿘 1 X`   4#@gc0  4#@`c@q 㿘@΀ "`c@א o`@G @ 86 㿘@#@ݢ 㿘c@ 㿐 1 `' 1 @m` % ` @ @H@ $`@@ ` @W @  ,@A 2 @qa $  @ P@↚ Π ?"`@qL ,'%?#<'$  `@D   ?c@9 $'   @1 㿘N # 5*`: `В @ `  2  _ - `@r   N  㾐# 4b'!x@ 1 "`@Rb @q 㿘! 1  @=`$ 㿘 1 ` `@/ ϰ  `@{`,`  㾐 4"'  ?!@R @ b @p 㿘@M@@E@p 4"'@E OЀ E F AА@;$ Ȓ@ڔOЀ F? 1" @@J@ "*@ @Ò@Ѱb @pp!㿐` @m֒ OO㿘`* :`` ,, ` !@,@!@㿘@㿘aX@B @%U 8 a` %c'- 3) p @ 2ah@g @!!@@@'Ӕ`?• mđ* @@`2@@@ 5 @@Vj @?` @`J /"*` @@   @@4  a( @@U5?2@@T! @ @o(),@!@N@@M0@L@ `?,@@m)`?  <   / @   <   @M "@Tg!?Ő / 㿘   4a@#@oV 㿘@ʔ ̴ ʬ D ό 0                        㿘!@"""@ @B#"*` @ x* $b`*`@ q!$"㿐 +ϐ`0@(  ' a@  0`J@  5 J@?   `  'J (J@J`#"֐`0`"Ӑ`0`; '@ 4 &`* * $`J"@ j @ !  @$` ' ' 1J@  5 J@?   `  'J (J@J ,2E$` 'J  5 J@?   `  'J (J@@ސ  @$`  'J  5 J?   `   'J J$`$`' 1J`b(@  @,`L@@J@" L  L`"LJ@2 L 2  Jb@@Ȑ   JbX @ ` `0q!ܓ*` € 'J  5 J@?   `  'J (J@` 2  * * @$`' `J  5 J@?   `  'J (J@$@J`֨Ȑ`0`  $`b@_ " 'J  5 J@?   `  'J (J@J`;``0L`b@4 `0 'J  5 J@?   `  'J (J@J`\L`b@   'J  5 J@?   `  'J (J@J`L`b@ @B$` ' !%J  5 J@?   `  'J (J@J`#Hc0@ #H@^ ܀`$` ?$`& @:!? $`@J@HcX@ `0' J  5 J@?   `  'J (J@#`@# $`  'J  5 J@?   `  'J (J@J  4$` cp@.$` ' J  5 J@?   `  'J (J@#x@ה@K$` c@) @UJ@ ;`0`'`'J`  \c@ @א $`@7` 'c@ ?'@b`'@` 'J@  5 J@?   `  'J (J@J@ ;<`0(`` @~' 'J@  5 J@?   `  'J (J@J`;` '`0c@  `0㿘'D @. `:  h'D \ ` @  DD] D`H@ DJ Q . : !J [ @JD @D @w x;D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J" `(8]*@ 2J 2Jn*@J` ]*@J] "`㷈 4" '&  @ &@@  &@@Д " @@@`@ @` *"b @k- 㿘 `  y ,@`$@ @h p&`"`&`&`@M N I/`:  \97*`:  \-"  N` -?@ "N,@N``   @U`&&` & \2,@ ` 2`@? ,@` N $@%@hѫ-`@Ѱ 8@u( 2Na@  㷈 4"'D' ?&@&` &`&` %# 5D`DJ@ 8J`J@?   ` D 'DJ (J@DJ g  p 9 ; 1  Dw}Ds w$Dm뀤  @ђH i&@ f&` @ǒHDD@7 #?@ ax@ &@'D !J `J@?   ` D 'DJ (J@DJ*'DJ  2 *a@ @;"܀`&`& @!? &` @G@cX@m  DJa@g D V'D @i! 4"'N  \a@I  2?.b0c? 2N$bX  5 Б*`: ?   ` ? N ?#@6@3b@  @Ԑ! `*??O#`  +@J &@ @iz"㷈! 4" '@ = O耢  5 J?   ` "JJ ?J `\2 J " J "  *J  " $@(,`@l@(  ,@r @i"*㿐N 9 \ 06  $ /b ` 2&@b@q &@ &@ &@@W &`b@`  㿘$ N< 9;8  5 Б+ : ?   `  N& #;2+  N ". 5 Б+ : ?   `  N 2+ . c@ &`&@Ӑ@c㿘. ?* : `#q" *` €b "b & @I &  c(@ @G  2 㿘    `,` `ӓ*` <@ @' 2  @/ 2  @@ 2 @r $$ $ $ $㿘 ` ,`  `,` `Ӑ <*` "   2  @ 2 $ 2  㿘Ө < *` `'  X @d @ʐ`2 `*` L X p 唝㿘 +y)#!c'/ 4%1 37'9쀢 68 4* `@€ %"ܐ "@$b" @   $@F  4#@` @gV @;?֐?#bؑ* ` @ @`@ `@  @@`@ 0@ @2@Ò @Ⰰ  @D@[ @ @g 㿘% 1 K!  g0#"l#bl`2` Ӏ""Ѐ!5"@`@L`Ӏ  "b@@Dbl@, `@ bl  "$`!"H@  "``@ʔ bl"H Ӕ "b""D$"@@1 bЖ  "bN #2Q N  nM ""I bl"@@"bl$bЀ  "DJ`# J  nӐ "b *b"DJ  "D @"l$`s@#"l*bА #b**"DbВ` #"D#bВ`*#"DՔ㿐"h`?)'@=hp`$pp "M  ! 4X`""$h `@$"Ԁ  $h"#@C`@y@Ӑ h`? "`@Q @  "@h@S "̀ h& f @h `@@C"`"  @C%"Q  M%"@@`@ @v 4`X "#31 '@hbp` $bp`!$h&bԐ $"@.  $h@C"@ @ih`? "`@ @  "@h@R  㿘@  1" " ""@"㿘@   1" "@" "㿘@А  @CD@`@, 㿘@l  @C2@`@ 㿘#@|bx@Җ Ӡ @$bxbx㿘 4'L'P'T'XaL@ #    ""Ԓa@#@$##@a @eC  < $ h ,  H ` p 4 0 @ 㿀""а'3/b@ΐ "@ `?Ƒ* : `C{"*` €`%!"  +ӓ*@ bE*`"%b*`$"*`b * $␒ " " ``O"`aK` ␐ _"`  [ ␔@̎ ␐ M$   ?% " @D$ AbӖ"|"|@ 8@!"| "|ap @ "|@ &@    @"|@` @H!h@@@  `  4`␖@? @  @dS " @ 2@"` `  4`␖@ @d9 ` 2@` 4␖@ @  2@  ␔@  ?%$  4␖ @  2$ @"` Ӕb b 4@ @@c %  +ӓ**@ b"]*`%b *`b * $` $ @ޔ` $ `~$@@w"b "s@`p"b `2k@`?` & @!? $`@Ac@` axJ `@    "M@@AP@` ax7 A@%| |ap @  `'`'` '`''| $| $ "` "`"`$ "` $ $ $ ` 2@` ? ` @- @"@Gv!@`i  `  4`␖@/ @ ␐ޒ  2O$ 㿀 `""Ā   "a   @ ܰ ""   @  c-P? -Ӑ  @q = @   " @k  `@ؒ@`` `   @ "@S " @M  ` $@-"@> ("`  $ @  @ ?2 "␔$@ @#  "`@"  $ @@ "   ' " $  '' "%" $  $ " $ " %"  ''`  4@Y  `"1   2- ` ?␐ & @Ћ! ? "` @@  @ ax  `  @ ?  "  @? @ axݐ  ?c 4"Ӱb  '7' 4?#/-, * @  #b@  @b@`@h  @Ⱐ @M @bґ,  `@"@?`" @?@(a ""b%b@b!㿐 1"@ !В @$⨒`h @˧  < 2$⨐ <$N p! 4!⨀&N@Eɐ!ؤ N`' 5 В `@ J` ` `*: \"`?"`` "* $"@  8"?a \"& "* $"@ n \N@[ ""@?M " `  "* $" @ S @Ej" N ⨒"`?"``" $* $"@ 5 $"`?"`" * $"@ ' " `@@>`" @>@Va 㿘,` w@: & \ ?N? 5`А   ` "?N?Ѐ $)ӑ,`:  \2  N \ &2      $ J &  & &,  3& "* ?2 (?2 ?"!  $@    $  &  & &"@ @F @& ,`    $  &  & &,㿘    $ && & "&  @ @& * 㿘@%?N  w""  { s" 1", - ?" @   @= @ ܒx " ?"& @ "& @= @n Ȓx& 2N 㿘 Ӱ`""  2 y  `"]  2  "( @  `Ӛ␔ `@l  2 _  "` "  U "̀`"Q  * $  &"@  `Ӛ␔ `@F  2 9  "` "  / "̀`"+  @2  "` * &" $   Ӛ␔ `@   "@ `?" 2  `?㿘  "Ā` b%  ""İ J?` "?    ;; ""`b@6  "  0  "b( 㿘@e  㿘 "&@L  &㿘@s  2@b8@I @& & "&@ 㿘 ??`@   b8@I  "&$ `2$@ 㿘 @ 2  2bX @Ij` "`&@ `"@@ 8                                                    @  H   P   p  4                                                          #x " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " "㿀ݐ`J    !#"   P ? P  P@nb? L PJ`* l"@,"@("@!"@ 1b؀ [!S"  2  b@ L!@ 1b؀ C <" 8`J  0# @kF '#  @؄"@@؁ @@|@( `}@ @@@@@#8@G !!($ ''^$' '@#P@-' `@p`@@q @ߞ  #X@G @;@#p@Ga(O`7 @9 J@ @ J@ /  `@qe 쀤`  1@q1@ה @q)"쀦쀤 #x@Ga(` 㿘J  #%"   P ?`P `P@m۔? L`P* `@G9#85  J` @q @[  &  @o  @: @@G#0 #x@G!(` 㿀 J`e3    L - L    L  n e  E`2L  k   f L -b L   \ #6%݀`63#T*` €`#) '`%  @Hr䨒  P@F#  `P L`  @GՔ䨒 6 P#@F P@m$?ƒ?  `P*   @[b耢  P P?$PPݑ*  '(  ' '' {`h ?" @g`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *`*  ` "`@Co6  | 쀣 "@` ` @x 6&`@@9+`2 @`ꀦ @` @Ր 㿘 J@  w`?  ##!"  v ? V  P     P@l ?耢 p P *  `2 ?`2ͮ ̀   ` !ݠ @~/@~  ` !ݠ @~!@~  " @6}   `#@E ?` 0*` €|@E#x 퀊`   1"@E  (@E@l ]Z@E 8 @E @ @E P 2 @E{ X `@Eu h@Er :7@  1"@Eb * @EX      1"@EI  @EE# @E?   @E9 1 1@E0"耤22`/ 㿘㿐J`      r7 s e  P t   P! !$ ݔ P  `"  5`9'  L*` € P % P % % P %@  P " %  $ %  P ` +,- - P@j?Ȓ?`'@h " `'@g "  P `` P* `J`-`+ `J  ` $ P ?#@@C!s  P* `, ,P @  - "* P* `C `" P* `64`"%@@@|@4 ` ! "*"܀h#!H!X  @@  `@& "=`@ Ѐ` `8(  @}c@ "`-+1)쀤-- (aH!X   @J @@C#x@ `Lװ 0@CM!h԰ ( ϰ @}-@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@C!"@C! @C!$@C! @C!@  @C @ @Cz!@@@Cs!@@Cl!@@Ce!@@C^!#x@CZ ? 07 "!!@CJ!  "@C@ -@C; - 1 " 1@z@C." "@C' 1@j 1@C "耥 "@  2i@ BL5 㿈ݒP` ݐ "` ' ''   #퀊  - +`9!4*` € ܐ  '  ! ' P@hܔb2 P * ` "J`-`+2 J  ݬ  ݐ!`?` @B"8 P@h @ސ"ڰ 8@{`/`;9ܶ =5 1@ 2"쀢 'ܐbx@p#`@pܒ+ `2 @p =0$ * $ @il` @Bu`ڤ "5)97 =@ ($@@c``@z`<`2:`27@{ ) $쀢 'ܐ"x@p @p+ 1`2`@p7 =0$` =*@`$`@i  1@B&"P "@B  H'@z`  `$ `" `2(`$ 2"`` $   ` # @3ٖ  `" @b $ `$ ?$+ $8 @@`$(`  2l㿐ݢ   !%" t ? a P  P   !F  P@g?〢 d P* ` %@y@zM 2  `" $  ?$  2@z   $` ?$@z 2㿐   @@ɐ"0  `?   @6Ɩ   㿘   %'"  p ? l P z P  ?% P@g)Ⰰ?• nP* `2 @G 2 @G 2   㿘@Ibݤ `J``? #@@`"(  1ؐ@f`P ?`P * ` @Fk ` "@Fa  J `" 㿐݄#X`+     #\#`@o0   #` #\@o㿈  1 L -.# ݐ!X* 2 *: ? 5`А   `  @zx  2 #$ @c ) ' #%"  s ?`P" `P@zU  2 `P #@?ް `P@fS?ဢ l`P  ܓ,`   c @o #H 1@?"    *ݰ#\ '%@c  '?  *`" @@x  @@   J ` 1#\bآ ' 1%,`@?`` 1@?"u  ' `'@  ݐ#X  ' ? @@4'@Ϲ@4 ?  #   @g >   6+'L % @D 2& %`@bܒ쀢 @?c ?  @ْ  `@67 6 `@2h @@>Т`,` 2L㿘 J `  !ݒ@ee!8!8$!8" 㿐! 1ؐ@ea P ? P * ` I# B#L  @J` @> !(`L`2`0@>А u  2``?@&  'ݔ*`28@  8  *`@@ @8 H@>s 0M$ @e  `? `   +// /` ?///`?88" !@5 p {b& p " @ݘ 8 `@ 0@ @@ J``?    @˜ ` 㿘   !#"  m ?  P +  P@d`x?쀢 l P* `2  @ @ = "*@`@ܖ 2   2 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8Hf`?㿐!(#` 1ؐ@dI`P ?"* `P*   @3   6 @=!   +   "   @ " $ $ @=! x 4" '!#퀢 S"  P@d b? ? P*  2:@{ @y-"b 8  =   , *.  .   + " @ . . .?"(@=Ӓ "0@=͒ ݐ!X* А   * - ВБ:  @N "8@' @%N8`y + g  o a" I N u"@NN`@"H 2N" IbP*`@<` P  ?* : `   X*` €  4 4I"N N`@x"X 2 @Ս<``- `=`+"  N,N-"-N`,  @UbP "NN 2+N "h@< 8@  @Rs"x㿐! 1ؐ@c P ? PK * `D # @.  P "@e""@ < . @7 2 < " @+ & <  @  < (  @  < 0 @   (@   $@   "@ @   4 Ā ڰ  @Y  ' $ @L'@Ē   p @ @  @~@ `? @X @ǒ< @Xڔ 3@5@2 @  $ 0 @*Ӗ    @*̖   r$`- *` €  d`?  ^@  @Y W   ˀ@ @M K  @F D @G > @G @@44 @Gޒ , @Gؒ @@  @Gʒ  @GĒ @  `?   㿘@G(@s  p``@G  <  I?㿘@  2  €  2     `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2m  €   2_  €  2X P  €    2  </   2  + €    2    2     @(? 㿘   ``? `"    D*` @`?   $  ` "㿘"㿘 .`   ` &@2 0 @2 㿘J""`  .'ݐ H-" S* a*`  # **  *"  a?H" "  "@YIP耢SP* `P@2!d @Y/ &%"%"a?󀢠H "L 2  >` @C "< @"@Y PրSP`*` `' 1@2" @w  2 `2 ` @   0 b@2|  @Y 㿀b(@ !#&? @(9 ?  @ݒaX* @2  "8@2.   ; : @Ւ  @$2?耎2? @ˠ  @%t`@1"P  @%j @@1"h㿈 @ ` 耎`2#2  2 @2k"x0 : @Ő @2a"㿘?#"Ж"К """ """ؒaL@m ! ݒcXc "cӐ "c@ @rӄ  㿐 4!4`"- 1c@;`h %    1"b"   @y "@wC  "   @y @w4㿘@v ݒ`J` J` @ J` @~4?@] 㿐  쀢`  @O @lz @K  @Y   @$`ꀦ ?㿘@]Ő#H㿘ܔ#H`2@_ 0"* "㿘N ܠ#H   ?*:  @_ N$  *@`$  N H 4 b@'x p"ޒ#|`!'`("` 1'` '` '`'`'` '`$'' "' ' ' ' #|''` ~Ә >w$"& & & Ԕ& &  ''///@Z/"Ѐ`2 ?$"  2 ?&  2 ?&   2 ?&   2 ?&   ?& @  " @   1cޔ|@%  @FY"㿘@, / 2  \b ,`,  @S  @R 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@4  @ ,`@  @+$`@M,`` %@  J?`/2 (`U*`'' @' ($< , U, @''',`@@"`@' ($< , :, @'''" 'r p @$!(=` @91ݲ N@   5N@ \@ 2.@  .@   N@  \.@ (  @Dp`"" & @< !& b@/ \ ( ϒ` '''a$$ @F ($< , Δ, @'''"@`'("@ 徔    . `2  (@ @Bqx J`2(@/  (崒`  &@  &㿘 @@`@’  `"@㿈`ذ @#ݠ@ a(冒`a( Q` '''ݔȒ@0ݔ@+ݐ@&a(    @ L  #@C@r"@sz 1"؀@5">   &a(@` Aa(. * `    $@@ $`2 @nq "$`$`` ?0@ U   a(,  &@  a(`*@TZ?  @  .&@a(` ,`@.. &@ @' a($< , 䭔, @'''"@`'a("@ 䝔&㿘&' !X \ݖ *`*:  ' " ` = :24Jݖ!X! : \2  &  *` *:  ' " `倢 = 4$ N ? 5`А   ` 2  N @I" ` `N / N /2`?'&㿐\`o '     p!@  `$  $@$'@㿘` A !(`@Nϔ.N '%L \2LL  "L `*`[`?`$"LL  (2L@͐耢  L /"  L  \L  N ~ *`.@*`㿘 $ @v@ @*` @`@K@J    K@ K @" @*`㿘 #ݑ, @ " a(〒` , a(x`㿘`@7" (NN / ?N /"?N /2?N /2& *&㿐@fP @P @` a(`$< , , @&`&`&@a(@M`@"@`&@@f3 #݁㿀@ې a(  ''ؐ' '耦r@ : @@@ `-" @Mې @ 2 @,  @`,@   /,  " @M@ $@< ": 6%,",'@ @E䀢 6@䀢 a(@,  $@l @Y@✒`?`,&M@`㿘 @pU"@p  ) ' ƀ ƀ &@? @`N@m" N@g ƀ 〦`?`ƀ㿐"#("4"c,"8#c$##0.+a, 1"3Ӵ   Ӗ "c\1a##X#cd(h&#D 4#0@Dc#a#DӐ" %"8"<$<  $cH @ @0#DcH"@$cHcH!#D "@a$#L"@@D9 #L 4 !#D$cH?$#L@  $  *  *` "4J ""4 㿘#c0#(@ !#, "@ #,@#,c0@$#,$c0@ \ ?㿘#,'Ӣ@@֐ ?@ >"#X1c,#8 `?"<@ϐ@  #8@Lc,8? %#< 㿘  㿘#,c$!@    #P 4$#P#P @B"#P@ 㿘0,@@ 0P 4"PP@  㿘 _d %, @ ""d"d`@ѐc0?", "c0  )L@M@ ,0"@g,@U%#<#HD`" `4@  @ Ӑ "cX@ %#<, ?@L,?㿘@  㿘@ 㿘@d c,@㿘@[  㿘$#,  @l 0IP??B#P 5 Ј   :  _ $ -PJ?   ` *P c$J?   ` 2 *:  _ $P  P??#P@W 㿘0#,  @ 0GP??B#P 5 Ј   :  _ $ -PJ?   ` *P c0J?   ` 2 *:  _ $P  P??#P㿘#4 cL @"#,0c,  #,$#,@J#, #,0  #,J@`@Z$#,#,#,㿘@??@ ??㿘N  * @ : N`   5Є    㿘#@@ bN`c8   @: N  8c@*㿘 ?@"@0 5`А   `  ` @= ^  ? @@7@5㿘#,c$@)   cP 4"cPcP S"㿘c,0 @   P 4"PP =@㿘#,c0 @*#ӠcP??$cP%Ӏ 0 @Ւ   cP$@˒ cP@ 0??$cP  㿘@#,Ӗ#P??##PӔ$ c02J@ 0 $#P ??##P 㿘@ @  #0 *@`"#0㿘bI   㿘`@6 㿘a,@/ 㿘cP\* @%"@ 㿘cP\* @@ 㿘#T`@`0  cP!,*@ * @"@ 㿘 !, !@M 0!#$"c\Ӱ(#$@0"#$@"c4#$Ӓ@!"#,$#0@+"X#0@@`#0㿘 a,#\`" :"@ `n `㿘#0c$ #T`m0㾈 4"'?/@ )1  "J??..?# %耦*.@ߐ #` `.!#$@n  #$&O`^ B?` @*@ ``@"H@@  #l  `@? @<"X 㿘#\`?`  %@# @ *$@-L@`^ D?0 `?:@o !,?$\㿘J@ ^`@@f   ?@I ?"㿘%0#*c$'0 $ c$@2$,c$,Ӑ "X"8$0##4+@"#d@ 㿘c0] 㿘c$V 㿘@? 㿘Ӳ ?"#<@ 0@ %#4Ӧc$ #!!@?  cD $H@@cD <`!8@?HcD  @@cDH"@$HHcD "@ "L"L$H@"#X4b)4c$@2 cD#0#8  cD 8/#0#8@  4"& /@  cDH?@0#8@  4c$@  > *4c$@8 <@?" #8@ ??#8N,8? &c<㿘1#$#, @u 03#0 J `" J#,J#,J#, J#, ? ?*?#,*J#,J@#,J#, ?*?#,*#,J@#,v  Ԅ? 0 Ԅ  0 Ԅ  0 㿘#,c0#$ T" #@ #P@ @ "#P#P@ <$ H   㿘c,%Ӓ@FД 1 (Ӣcؑ* @ " (  ( * $@ @9 & (㿘 (Ԑ "`," , ,Ӑ?cؕ* @  # ,#,"cd 0@ "h? 㿘 #h 0  1 ,Ӣؓ*`@  `  (& ,@"?" @b c,"  , ?& ,& ,,* `, ,ؓ*` = $ӄ "#X"c4","0##8( 㿘@  㿘)#$Ӑ "X"4##0#c, 8*@Q?  㿘@FN *:  ^2*@ N>  ?`  +*@`?` N *@ Ӕ  5Є     ^*@` `@ ?(*@`*@㿘   1b@$ؐ"  1b@$ϐ"ː@$ɐ"cl.  ` *` # * @$"0 cp.  .` @$"㿘#l` @$ "ϰ  # # *` *   `2  @$b  :  !ݢ  ,``l     2l`  !( 4` l,` @     !(  k``2N@ap - &#  : , *  " @o 2  ; , c*   l"@#E c  l,`  #Ӏ` .cp@ #c l *cp@ "@ Ә#x` :`*"  *@* + Ӗ#x :   ?"  *@ +  㿘!ٮ# Ӑ?"c`# ٸ#ӆ  "cl !#l* #l Ӗ  + cl@* cl   !f  ` l*  ` @ G* ` ى,$#p +   cp*" +  @  @~Ēb耢 @~b ݐ *`ӑ*  x 8("8l( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $, d 㿘#d`@c 0#,@"@"  a $cd 㿘d#,  z"d0@C  㿘#%')+$(c4#0@+c,c4!#" %c,$c4$$@ې$(%#0 -@$$$($c4%#0%c,@ʐ? @  㿘 @j  㿘 @d  㿘 @^  㿘 @X  㿘 @R  㿘 @L  㿘 @F  㿀#0!#,#$#\#`" "  袒 #$@͐ 0* @ А"'% 1. @@j|    V @ 0@d 㿀#0'#,$#\#`" " L谒  @ 0H` h ܐ0;"    $@ w@|’@# ` J /` 1" `  - 㿘#Lӑ2`@,#$ӓ:`#@"  ##@ "c4"c4cD"X/ 1 㿘 1`?" 4` `J@"4J``""4 4 㿘  !Ӡ"#H#H#D  "#H #H   #H? $#H#<` #H`cD?@㿘NӀ`#@*` : N c@*`㿘   % #Ӑ* ? ? 5`А   ` `,    $cT$Pk$P$cT 㿐1#$%#$0" ( '"@c #$Ӑ $0* #$#c,R##4    b  㿘!,@`V 0#T`:@?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' Ð0KӰ N )   " 'P!N    " '2  N  "  "  ""  '" P?`"PNN     " '2 , < y.. 㿘@ U㿘@  L㿘@ C㿘#,c0! 0#P??$#P  5#0 `Б:  _ $#0  #0K?   ` *#00 LK `В `@ `  ` *: ` 4# `В `@ `  ` *: ` 4  *`@ R`+ #0J 5 4 4K `В `@ `  ` U*:  _ $3#P U*: `В `@ `  *:  * : `В `@ `   *:  㨑*  R +0 2K#P??e$#PA  㿘#X`'c4#0  #L  rN0  cL$8 %#X8  8 8 8 8 8 8 8 8 D 8 h  8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 D 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8  8  8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 h 8 h ` h t X H 8  4 < 㿘'#( `@3`$ $$`@,, !"(b@Ð (`D$`a$@L㿈 C!!( ``'''@ a(   '''" '`"  @g  a($< , , @'''"@`'a("@ ۔ 㿈!!( Կ` '''@7":   1"!(ڒ`㿈!!( ԡ` '''@" :   0 1"@ƒ!(Ե`(  'c@#  @g6 ݴ  J`2J 2J 2@!!(  ''V  '' (@  ' ''Ԧ?$@@?^!<- €N  ! -  €ܨ Nٰ N հ   ڸ ظ   $,@` (,@N ``?$@@?' ,@N `4 )@s2@y  ' #  $,@` (,@`,@N``?$@@> ,@N ` ),@`,@`" ?/   @H@x  @b L m?$@@>Ȑ  ,@L `[  @xǐ ؒ@v ? @^"  @,@\ ,@Đ# 2D   !( o`" " $4$@ 444 $` ` %"  = #    ? ,@` ,@ `b"( @]ʒ ,@T T    %"  = #  H ?"0TB,@` ),@,` T@ab T@' T@@( `@@aΔ @aG'؀2@@ @ې @#@#8@ N '   '~ | 'z ) 쀤@|z J  l'd   J  b'؀ W䀢 2  '܀`N' 1"  W䀢 T FW䀢 D  A   ?% `'`  ?"` `  "`@J!  뀥  ? @J3 ?'? @H('W䀢` @!"aT 2  耥  `ݒ !X*`  ݒ !X*` p ml ,@`9$@`@$@ @ @ @ B(`@Q:(@`` `a($< , , @&`&`&@@" &@` `a($< , , @&`&`&@@ؐ @@"@`&@(@  '(  ''Ȑ  ''쀥 {ݒ !X*` r p + 2' 쀤@2# @b<#` 2@ch@K @` `a($< , ѧ, @&`&`&@@" &@  R-`?߀`]O#*` €G [`@ ,@?`< ,@`@6`@3 {`@0 ,@`*`(%` '  " (`'@:  @ 2  ?` ,@`@' 2,@,@``,@`ܬ 㿈N@ $`N@ #cNN` _ } `@v7 [ % *O  * @ *O  ] *@f @^R  @2 '$+ 2 2` @ !(`+@^0@_*' 1bؒ @Ť@ +ݐ`J `   2&#@ &@;( @;`*$@    N : ݔ N   Nݨ * aX@  @2?N  J  2&?&'N@ * @*  %%=#!(`` 2` 1"$@@]$` @ +  @`$`` ``?$@$`4`  @u{ [ w O  * @q O  ]m  %%=#?!!( 0` '''@e=@]  +  ($< , *, @'''@^e"@`'2" :   1"$@O `@  ( &`6!X (,  ,   '''" '$`@ `$`$@O  @`?4` = @!X* @ B? ?@] @^$`$@ +ݐ!X. @2 "@@J` 1"؀@ += -?`J ` `J ` 1@"؀@!X. @2 +#@Ғ㿐%( @.`#`$ @P$(ϩ``$`P V@ -``(``#`   "  @XĐ @#   @C 0 2#6 #@@А @D/ @  " 2 @| @ 2@ @@ 6 &  㿘@tL %2#0Q@0L@8J.@#㿀@`$< !!(' '΀!' ''쀠`  @ Ρ`@&> &㾸@R@2|  2   2Z @q  "  @  L / '< %@(@ @+  ?    2. @ (*L /%< @ (@2   @*  ?    <  2 /,@`,@ %($< ,  , @&&& ($@@8"@`&@ /,@`N /?$@@8,@N /`@r /  ,@ @;m 2,@$ @" @8Ґ"@`@@&@;P @#@ D  9@ ` . L 1 .2LL +L .N .#@:  @k @"@@8@@&@ @* 2J`@Y2,㿘@rx  :$@=@ĐL`- &@)% (2  L  `@rZ耢 2  .@  "&@.@`&@: .@` L  &@ ݀.@@r@㿈 !(' ' ' 'L@?"@$ `@8  ``*@L@` 2 *@L` /"耢 :*@ @   @' N "&@?$@7ߐ 2,  ,N  &㿘N  +@Y#@Z2 NN  2 N@Y#@Z - N  @Y @Z@  1"؀" 㿘@Nːݐ @Od 2 @̉ 2   @7f`$ `$ 㿘  @q  +N {2( N   `N { }   ,?2 "N  逢` $ c$0f   a($< , ), @& & &&"@`L& 0B> "& 4 N { },  ,? ,% 2# `&!(`ؐ@W@R@@M,f  2  $ T l l L L T  ( ܬ P ` P ` ` p p ` h p  X'D'H'D   H H DR` H?D@Ӓ {@4  쀢`@P% DR`VDD"aTD `  *`#`R:`'H$DJ `1`,@X @Y! `@D#H@ #H % 1# 1  ` b@D @ @A9#H` @H ;'HD` 2 !DR`"!DR` !!( @`!( @"` @ے D `%D `#ܰ %' 1@a 6 '`O$c` K@G@ D@?* : `9*`#  €DH@M'0+DH`H `'HH!ݔ 'H@ !(` 2@ !(` 2DR`!!ݠ@. @ DH@` @۔ @8H 'HD`'DDR@ !!( ` @R!( ` 2 HD@ϒ`@H`H "'0DR`DHϒ aD`'DDR@ HD aݒ`l@ a( 2 @  ݒ @ @3 @3I t `   @| @z @ !!(` 2@ !(` 2@耢  @h @3ݠ`t$  쀢`$   @Z @ &`t@P  $ `$ $  @ H a( ?2'HDHx@Gb0ZDH %`D!O'D `D R@  `? DH H!'H07D!2`?D '`!Hb@'''''0 'D` "D !(` !(' 2@!(`?  @2 @2a( @(  'DR` 2* `D@V` '@XIDHԒ a'`0'D@V`@X6 DH a'@| '0!( 2!(`?  @2 @2Ca( @֐  '0DH a'D!DR@@  `? 0D `D!| DE D Hp a0DD =D`'DD`eDR``D '` $ @6P  '@ D 'DD <DR`05DH a.D`D@(HD١ 0D @[@'@M@2DD`@@`D@(@@d @@ݒ'"c@1 H @1  H! @LԐ J `@1 㿈'H J` 'P ' J`    2 (  H"@Ye ?@W/ HL ^"!T@  'HH A P@H b|   J`P 'P*H a <ݶ P@8-  3 P@8-`p p?+  J `Ҧ = P*`   @ǒ 'HH `H ``H `  `'H` " H Ha@Tx`H H ` Hh   J 2  @ "N#ܠ +)  M#`(2  @U @V cH@@~`  `cH 1" 1"  @@m  ` @=cH  @X  2  `  @X   ``!T'0cH J ` @l /  `@P @'HH    0A퀢 0<H@07H`LH `H ` H@b` `@ ~ `@ H  @. H@@b  `@q @I[@M @  H a( @[ 'H'Hh"&"!( `" ` !!(H`"`(`` 8 "` 8 `"( ", "0 "4 "8 "< R"@ݘ K # 'H H2 + # "'H!("2@H   H P  a"cH*H" }H@ #@ &$H` HH@H ?"@ @QH"`#x*` €#'0`@/ @/o@/ aH@  0TH`H ` H@a` aX@? ~ ap@9  @`x3  L `  ( H"@WA H @U  P @JP L   ݐ#@L ݐ#@L HԐ `@2`@"  P""@e?'P "#@/  㿘@SV!@TP L # @  L 2 !  "?& " @@@@aS !@㿘@H@H a@k @㿘!(`    @Hm  L @H& && 㿘 @Gה  2 " ?$$, ` $ @P `2 @H`?@O`$ $V``$ 㿘 #ݰ N = *! +@G@H:`  " "" 㿘@GJ  /@jh   q` ݐ @G ` @2 /`_   @Rh!@Sb 1b؀  & &  @ &   ` @2  ` 2 % `0 ! ݐ!@G #`   @     &` ?&  `  [ W`U `   ݐ!@G & ԰ ` &  & # L  @ Ԑ ` & `@/& !(ij` &`@QӐ!@R 1b؀  @_  ԰`` & "``& 㿐ݒa@G  J`/ ݖ ` {$ ?$@G 2(@!  '?@ `@ <  I ?    "&㿈2&@i7 / Ő 2X 0V"@Q@  !(' ' ' '耦`:@i : @֐@$" @.@P /, "@@.@>y N@ ɲ`Dz  㿘'@%#$@$Ԕc @8  !ݐ P@3$  @@9c$ $$@ ?      -ݐJ $`  Ғ  ' ' ' ''''J`#!'@P @Q. Ȓ  @L!@ H`S#*` €L J" J `E&  @B`@ p x<  6`3.1"   @ `*L@ -  L` 2 #     @ l 6 @Lr l`@@ a ?" `J ` "`@ N ?@M!!݀2z? !!!@?@^IaД@ ( 0_!( *`R  ?@  !(` *2 "@?? <@    @L  @@^b@  +?@'?`@` ` "|@   @ v@  ܔH @7  㿈?''D 'Hb0@  ?1!(  @@  ' '쀢`  `@ ' 쀢 2!!@$@]` bH@ 쀢 R?@74  '@+f!( @   H@+n"`@?09 !(1ݒ`@  D" "& @$!bh@  a$& 4 @:U @:RD@+H @7?0@v?@@]]` @ <bx㿘 + )'% , `2 #` @Ob@PJ`@8@O"@P @ ` n  @Ob@OJ@ ۲ @I 4 1* ? 1"؁㿘.`@ `@:i㿈   @q@&     @{  '#HȖ ''@2 㿘.`@:3㿘   @<@&   #H`@2 㿈 4"  ' `A`?J@ `J@ "`J@`? * J@   : + ``+J@   * `+]`   !T.`  @f=`? b  $ b @ B"ȁ㿘`   "`1 1 "ؐ耢   㿘F㿘 &bؔ@ T   l |      0 h  L L x"'ؒ'@&@p'Ԑ 'D'L''''@)'a( @   *@"@)  L  14 @ "@)T@` (2Ԑ '@"`"@p @Ԓ ("D  @ " @P"D0@N{ L@ND@)x  㿐`C& #p.` €  ''&"  *( )"  * @NQ   Ж @//@ *`"@` a aaHa`@ : 0a@ 4 @(א 㿘 `Y ߀ ```#@ @|`! 86& `"` `?.& 2- (& `@c ϐ`$y  @S@  @F c `;@ @703  *,`@"*`   @ `@  @  ` ` ` s@耢 ``    $   `#*` € @c  @%  @   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@g `  "   8  ?3$  @   $   ?$  %] @9   $   ?$ "  `$ @"@NO@M2&   ,`* `@㿘 5 `L?   ` `2 &` (ݘ aX* @ 4  [ L * `2 [2 ` @S 2 `  !@&`@@ "`!($@)@KN!(&` `Z & 7 _'  _  * !X@2L #"L( $@(@&` }"`" `"` ``@M ( `% '&`" J  2  @G%  M ` 2&` )&`&`㿘@@L` ` & " @Mr @L"& 㿘N 2@@2 .`*  A $ .`*  6 㿘!!( H`!(""" " " * 㿘N`  @@" @b" @M&  @ "$ ` @@ @Kr&@  @ *@&@$            @ @ @ @ @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ x @  @ @ @ @  @  @ @ @   % % % % % % ' (l ( ($ (< (TJ  `       !'<7`C9Đ!̓*` €P b@a )@a( @'b@X `P  @5}" `uP@,|P* K   2 `2"X"@` J@ `@a{ =  !(@'F`$@  , `  ` 2 `6 2  @ה @& `'@h7 ` "h ` 2 `2`2  "(@t  " @ @  @   ` @ @ ݀`@ @̐  `?=`""@ ,)܀@)753+#,":@4{# @$#@4tb@`ƒ 2 #@4ib"`@ @@1# a( @ @ `  @d @V`@"0@ @!@@4:""`@ @(@@1"? @? @V@"0d @IF"`@J  #ݐ`#@#Q $`R`  @/ 2 `@#D @   '`( ' 'x'| "  x|$" @&&xx"@@2. x&  $@0Đ,|@,$@| @Vl `@`#8@0㿘@ #+)' @`   , L "     @# @⨀ ,? `@"А%`㿈`!(@%`0V@@  !(' '  ''$@"  @%@ @@'/  〦$ @#X @g "@$@%@n$u㿐@' /  ` ",* @,*@   !,`*@J. `!@)%"  #L ?   1a,  " : ?@i '#p@  * @㿘 a,  2 ,  @h# ,?㿘`!,@W# 㿘!!,` #`% 1  "``!,`?$!,$ԁ,`": @*`   㿘!,ݦ` "`< ? @ ``. @@ #,@!?- @@C  ` `@@&+ `&@ > `@@ ,@怦?㿘!,@@ՠ" <  ?  ??4? ?㿘 )!0'%,"@< . "@@%ݒI,  %!0$,$㿘 `"! "1@^v 1 #@ "`D&  ݒ`",$ " @S`㿘!  ݐ!"0ݒ`'Д?"a,$ 㿘ݢ `@#@^ 2* `@31a0 * a,  `a0 * ?:""0 *` ?*"&,㿐J `Ԓ " "@F#@FԦw" ݐ @#`$" @! k@Ԥ "`@@?   @  Ԣ` " @ G@,B #\   @W ?"` ?   ?`@@@`` @)a0 ``@I `@`@k@r` @`@_@   @9 $` " Ą܇* "        2    4"a0'|'@D| &@3 !4#Ԡ`Ȓ$@0ː&@L! &# @  |@ | @e@ `@ @@V`@2  @ #Ё@?  0  2? "  2?@" "@  㿘   IA`Đ"* €@ 7`5 @`* 0 @`* * @`* $ @` @ `a, ?  @ `& & [ `  㿘!,`$ : &@@@ "@*  1` @", $㿈! @ْ    @* Ԧ  @ )D"@  #\   @ ?9`  @-00!    g#  "@ %`>  > > // ///@ @ڐ  @   @ %` @ 0@㿘! @ @[ $ 㿘 1b@  @ 㿘 "c"N'H'L'P'T'X  3@q H@/cHcH@. @,cH@ 㿘'L'P'T'X@_!ܒL@/#H @.#H@,#H㿘 "c"N'H'L'P'T'X 3@B  @"c@/JcHcH@/H @.~cH@,cH` J `" @@a 㿘'L'P'T'X@ !c@/##HL@/\#H#H@.W @,Z#H @E 㿘 !    " @[ ؀   J- b#H@.c !    $ `@.#H "`㿘 'H'L'P'T` 'X!ܒ#H@/ H@,#H㿘 'H'L'P'T`'X` ܐ#@.H(@   <   ` `㿘ܔ @* ܔH @* ܒ @* Ԑ "`㿘@Χ  @`  (㿘  @  @` ?ؐ ( @v 㿘 `ܐ"@+ ``@0 @㿐@  H &@  & @ 㿘@@ 㿘N? 5`А   ` "+NN  2'NN ?А@# `+( h(  %` `  2  p N  @G &??݆ t" t   㿘! t`  @@ t?$ t㿘ݠ`t   `t` @r?$ 㿘ݠ t `  @b?$  t| `"@?㿘  1ݐ t ` t 6 t t  t@;?& t   t@3?$   @+?& 㿘 Ā` @ , $ $$@-_@]z  @)f $!4$$& \0 ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], ], \0 ], ], ], ], ], \0 ], \< ], ], \d \d \d \d \d \d \d \d \d \d ], ], ], ], ], \㿘Ԑ P"`  " @Ɛ "lԐ!ؒa@9Δ ) 'ݒJ`  *`  @( JԀ"`J ݢ#X`!T .  * $ @9 ?. J` "J` @l @? 㿘  ')<% 424  2.  2  J` "%J` 2!2   @ 6  @  2  @ ' @  2 `@ @4@2 ! 1"Ѐ 1c@! "@r  J` @*`㿘ݨ `J` "J` J`  @?H @Y!@Nɐ ;$ Ԧ  ` ) 1#耢 #x @ " ' @Ԁ  "`@5@Na` $  ސ!@8 !@ @#蒒 &! Ā@2 ݤ!TcX ,   *  @8Ԑ?,  -Ԡ `Ā & @  #@@Naf $@  `@@NuaV $ 1"" $`Ā`  #aF #耢 5@yc|01Ԁ`" ݤ!TcX ,   *  @8?,  ݢ#X`!T , *`` 2` `@8k ?,  J `@>㿐` aLݒ`l@@ @$@$`$``$` !  !4b3 ` "%"`@m` `2$$ $!4$,$ $($$$ $ $"$$0$8" "`@ 8` 0@;ǖ )`@U,@ @8`# `  @@Sb@ @ה w"P`?"$` @"a4$`  J ``   `  $@` `  ` 1c@ `@`jb@eb;  @ @` J `` 2J ݤ!TcX ,   *  @7?,  J ``@ `! J `ݒ  @7w#ݐ# @7r b"h@ "  @@@ƒbx" "`* @=* @6a` Bb@ @D`7 @b ݐ t $8 " `" `"@# J ` ܠb@*L#H0` %` #H@*D@`2`  @)x#H@'{#H @u  @ 㿐ݒ`l@ ` `@E" @ 㿐ݒ`l @ޔ```  `b  bА  @Ŕ   }@3  @ 㿐ݒ`l @  &@ !4  !4@2 2' @8  !4   @ "? @ ` *` #F?@  @h   &@㿐ݢ`l@Z @   @P  *`  #04 `2 @ 6( @킰 @L#  2  ``2  @Ӓ  @В 6  @f @K# @ 㿐ݒ`l@  @   @  *` ɐ#`  ` @ #Ӱ "`0`N#0`0  +)' 1  2$ $  c8  #@7  2  10"@&7#2$` @s `"` @J` 2>` ` `  1c`<@-  , 1`h#`h`@  ` #|@  @ `h#`h`@ʰ @KX#HK0``  ?@ $`"` @``@  :`@`(` $``   1cޔ|@ג  ! 1##@;`Ā @@K#cp`  @6 @K # 0  `` 7$`@  @ 㿘 ' !4` " J` "J` 2  2  2 " 2  ##耣 ##耋 ##)#  㿐ݒ`l @ǔ`     @ 㿐ݒ`l @􀦠    @O ` @  *` j#B  ``    !% !`  @ @ ?   "$  2   3 "@֒` 2  @W  㿐ݒ`l @N` 'ݢ L` "    @ @ДH ? 8 "$  2L`  % "@`2 @$H @ 㿐ݒ`l @``"` "` @ `㿘   !!2  @k`  2 4` 0B ` Ԭ " 7$`)+%  ਀ "! " @6   ` a  `8  & @&X @ 㿘   0& ` 2฀ & 4a4"@ 㿘```$``$`ݤ J `"`` @! `耢  "` ? @2$``$``"` @2\ 2]`` "݀` ` `x$` $`J` 31 1 `/#` ,`  !@#耢 $`h`($`!#@* Ā 6` @{@I  Ē``# `  #``<# @tA$`#耢&$`4` #` #`$ ސ @t.c|`4  ?S$`#ޒ @|` `2`4` ;$``4J` ` 2`(   ݐ#X * "`(@1 `("#`,#" ` "#x`$#x" `` J `!` " @Y#H@#6#H`  J ``@-@  !4Ԕ   2  2"0 2 @?vd@ ?  0"   2  2 0 h @R HV? ("? $ ( ,l@@ $ ,?/!@$ ($ , (" $ ( ,"@ $ ,"@ $ ($ ,p  $  $t@@ $ $?/!@$ $ $ " $  $"@ $ $"@ $ $ $ @  Hd ` $   `    $@?@ɔ  4h@^"㿘 2 0` 0`  `  4@`2` 4&  ``" &  &   &  ? #ݠ`t 2 8 `$  8`"  @2   ? $ ?`t ݔ @`& L  : 8` 2L @r L  -`   '!(!Ԁ  `"R``2 2  @!C  @0 @"   ` ` `@`J `    ఔ?& & `"ఐ@`8 4"' `' 2 4  @$` 4   ?` '   ' 2 +" - 0 З*'; 1     `0>" `09` ݕ*`  `"./  `@P @#` @@$N `  2 `2  `2     2  /ݔ *` @P @`` 0  a@$; `a@$`` a@$ `2O $` '!(ba @#  '  !Hb؀`!(ba8@#   ; 7  3 )' 1!H/- 1+``P  #\#\@#2 ah  !H@#     ڀ` 27  1@#b 4" @ !!p㿘 ݐ!X* &*@2`  4 "  2 4 |`   z 2 p`:  %`m k&@L`?F͐ \*` €  V` R`0T@1ې` I  J 2 @` 7  0 "  @  `"`2.&@-    2 0`@.    0`@3 2`` 2 0`` &@ 㿘`Ȁ "`ݒ` l ࠀ`" & ` 2@`"& 㿘`̀ "`ݒ` @㿘  `@2 @ax 0*" 0Ԁ` ̐ @"`" ! !4 @  `?"` `& # #`" 2`"`0"""" """㿘 0   "@- &? 2  p( p p p p d i sp ot o r, p r q t t u rh $ 0 0 @ d t \ X p \  $ @ P l D ` Н( 4"''(593ݐ?'''' @(' 'ڐ H ''&Ѐ' J   , B% ,   `J` `\Ѐ " @ . ` " # Ԑ '  `J` `\Ѐ " @  쀦  Ԑ?' @ ܐ``$  ?"`$J` "  ݒ !X*` ?$@ vؐ l- €J ``$  ! [J`  `\Ѐ " @  k i g !?2 a 5`А   ` `? -? 5`А   ` `G`? 5`А   ` `?/()`J` `\Ѐ " @ v    2,@@ @,@`@ `,@ w?1 ` *` ` `@J`!`@  [ ` @P(@`" " <"" &`@  [? *`< *,@:d  @  $ ,,L  ?$@, , L (``` @(`" <" " "_&` @ + ? ! '`J` `\Ѐ " @  ( ,`,@  '"   \ ", \0:9 \`J` `\Ѐ " @  K ,, Ԓ`' Ԩ @  %8  , @ ې %)  \ ` ` $? ,: ,J` `\Ѐ " @ t $ڐ  \ " ? ` ͐ ?Ȑ ?$@  , \,,J` `\Ѐ " @ = (; {`J` `\Ѐ " @ ) (  @ c %  %  $ % @  2 @ N %  % %  Wݐ ,,@`J` `\Ѐ " @  : # ,,`J` `\Ѐ " @  # %@   @  %P @   @  %A  aX* @ 1  , X,?$@5,`J` `\Ѐ " @  * `2, ," X ?$@  , X,,, ,, , $,@ %`  @  %  ,% J `Ѧ @ @ 2% @ 2```~ ' ?2@ l , Ԧ' Ԁ " \?2@ X   ?ؐ X* € ("  ) " ' .  \  (  $%  ? % %  %  % `' Ԑ%  " \% 2    %  '2  % ?'   2*,$ ( )   % 2, ? % `J` `\Ѐ " @ )?2@,%@a   $ @} , (,  % %%  } *?2@Ґ  } |?2@Ð ؀ (0ڀ ` \,2,`J` `\Ѐ " @? $", \ " 0  ` ,  2,  \, ) (  ?M% `J` `\Ѐ " @  )Ő @ݐ6 '4 '  0%  \ '`J` `\Ѐ " @  Q, "  @! %  , Ԧ`i' 9  % , ` " \ , %V & `J` `\Ѐ " @ $  \ " `  , \, ,,+ ) | ,?@ؐ ( , * , , @ % `J` `\Ѐ " @Z c?$@ @3!" < > L@ ~ `ݒaX* @v( ` L`?$ >`?$`J` `\Ѐ " @  <- & >* &  >  $ 28$`J` `\Ѐ " @ - $@$ > <  $$   > $ | @$@$$ $l"!$!2m,2j,` )"߰ ) ; &` ( 4 47 4 | 4`J` `\Ѐ " @ | ; | &!,!!!( &&!@? J ``J` `\Ѐ " @S (!@!~ 4ؒ$ݔ q"a$@ܢc `@$@J@  ` @,@`@ `J@ ` @|$ 2,?L? L? J!@$ݐ Ȓ@%O   !  } !($`. *ݐ @%6 "$! `"!< " ` @( `"<""!(" $&``i?! 4 @!㿘!`   @ a  $a㿀 i  '``Ԑ "`!(!' '! ''+-  $ ` ` L@!?$@ , `J` `\Ѐ " @h`ڀL  `` 6@-%'@<Ḑ?$@ , `J` `\Ѐ " @5` ߀`?$@ ʐ, , $ `& `Ԑ?"`ԁ㿘 'H'L'P'T'X`?  H `<`? (`<"! 1""A ܒ@#H꺐㿘o @ 1"ؒ?$`$ $ $ $ $ $ $ $$ < $ (!$ 4$ 8Y! 4$ 0 $ ,$ ,$ 0$ 4$ 8㿘` @J  $@``t$@ؐ *` € 1s"@h@`   $`$` $`^$@` ` 1 1"$`$@S$`" $`$`M$@`$ `< $$@ U" $`  J`"`<@F4 J?? 5`А   ` "`<`<`$$ 9$`$`$$ `$ "$  ``$,`,` $`$$`$`<$@$$$@``@!(` ``<$@`2 `$ 1"$`$`$@  !@#H@Ӑ#H@J  s$@㿘ݤ J  ` 0  `?   $ @  ,8$@  ,,&` & # 1 "b@y `J`  J` J`  ( & ,F+݀ " a@ɒ ? & ?#+% , @ƒ"@  `$  ` `"@$  ,"  J "   0$ ," $٠?@ T ,Ҡ? `@D ` %`#` 1""@y  0 && @ϒ$ 0    2)&@ %&# D`2JJ!X` * J  *`  2J    &   @ 㿘!*` @ !ؒ  p㿐݀ " D '0*@-&!@. !!(@ ǒ`!('` @ '!( @i_    "aʇ @ "a@  0@-!@-!$!h 4"'N     ިN  2  ר  @ *: ` ` `   /   `  : @ `? *:  \_ !M J ` ߑ* : `V;*`ؐ  €( @6ǐ@} }@DqL`{`$@Do@Dc } 2,@@6@}̠$@3@DS }  $@&ېj .@&Ԓ$0Ҕ@ @~    p`Ӑ #ѐ $ // ݠ @6f@:̠@6]@1̠@6T@(̠ (@6K@̠0@34$0ac#@C `@C `$@C @C 2,@0Ec%@+8@,!@+"@@,@xbH@C /@+"@@,@Cސ _ ~@+"@@,@( L@ /@+А8@, 2P @+Đ"8@,@~4@C$0J ` ``" А   А ( LL@H'$0$*`:`*, : X@H$ \///  /  L@H$@x`( @6W&@!$@0M !ݖ !(  ` @ې@w` @&$@6&@ ܐH@S*2) "%@$ `ܔ#H`2 @ܒ "* "2 "` M ( @Ȑ#H`2'@ 4" @ "`㿘  㿘  㿐 'J  \  Ѐ`" @`kؐ" .` €, :  #^ ݐ aX* @ V  S  P N ݒ !X*` G`, :  [A @U 2."p L #?&@X  .L  a(]`J  \  Ѐ`" @ ݒ !X*` ` `2, .: @\ 0 ?&@.p 㿈  !(' ' ('ݒ '')J@  @ \ Ѐ `" @U?$@,`: , [  ]":`  , Œ$&`?㿘`Ѐ ?"`  1b؀ ` @` "@`( * *   " " <"$  㿘 Ԁ`  @J  7"@`Ѐ    $`J  '"#$`! @J  "@  \ J` "    $`Ё㿘!(`7!" !$ $ 㿘`~&(``W& !t(@3  쀢 "#  `" 9 ؀ #  @)d"   Ԡ ܀ %%<#   "$ @Ւ 2$  2$ Ā@   @$  2 ԁ (Ԥ ` ! `    @Đ$` $`@  <  $` " 㿘#@>`ݐ`@$`ؠ 4ݦ @@Ȓ : , @@ % N? \ @u ?@to  L  @@ ? . @؀ "$؁㿘 %ݠ # ` (ݒ`S $ $$ @) 2 $ <  2$ $ 㿘 @)7" @*   " $"@-T  L L X < < <  ܝ@  1#ܴ @!" ت   ????????'7ߐݶ @'"a(@''@)@m- 19ݐ! @E ݐ  @@ ݐ ܒ @; @I/ݐ  @4 @`'\ ` ;ݢ` X  2 |`   H  2!0$L  @      @$L@' L@)h `ؖ  *b@?* `@?Ғap @tr`؀  @tm``ؐ?@?’ax     !*"  @9 c В  *`!   #`  @+]   `@"`"4    @+K" "@'!@(L /@ @ !@Ѐ  @Ѐ@2 DԀ@ @ H J@ @ ܐ  J@  1"؀@(ޔ @z@'W @)<`@'Q c@(Δ ``    @z@J%pp `!!"@@'*! p @(@> #  J `2 `@(@ha `@( @ p   @y@z   , ,  @ 6L @ِ  ( `. @ $@$` ̐!. @ P\%`L % L  !( `. @  $`   @ 0   $` ܐ @N"c@4` ⡐!` &%`ؠ `, a$` o   @9 $` @_ \@_   \, ,$`$`  $`$`"$` \@ h<     J `"L @ !  L  @ , L ((. `?`ؒ@&""&@ L ,  L , J@ 2  L aZ  L  " @{ L `   ú"(  @o  J` "8  @e 0J` @&*"P@'$á J@    @Q @@ 2  @& @'@  "T  *`  *` J`  @y*`@  㿘@%"p   p`@&ܐ "x@-`"ܐ#@= 㿈'D'H'L'P'  @  0 'v?L  !(`''0''@ a( @a  3L "  @  !(" "?`!|*` €? #P`#`5 @)bǐ L 3!("`H" a( `'Da(" @` " @ @T`  a(" " 㿘!( w`"`"@@ 㿈'D'HD`$ J ''` H@  ' '@쀢 "! a( @aa  <?`/*`! €쀢  2 1ᦐ"J `D `  D "`D 1Db"" " @ @"`@ b- ݠ  % 쀢`@, D <`L  D`$ D`$ ?"`$쀢  =D D@p BV .  L ?'`;D"  3a    D&a "`H '@.   L   D $` ˃"c V  쀢 a 2"a @@Z "`㿘 ݔ J `   #d` #XJ `  !ސ#X@ !!(R`!*` €a(@`o  !(` 2`@ !(㿘#a( D`44  a(`$ $ $ $ @$a(㿘!(` " `  `@"` @#Z` "` ` , R@`"   $` ` R `ܔH @ Ȓ ` 5 T@ ( J `ߣ` #   @f`  ݐ#X, @ @  @  @ @D@c@ @;($(n`㿘!(  "    ,`R@ `@y`$  R$   2 (" 㿘!( @ @  㿘!!(@`@!(`"`@㿘  ! !4@2@ڲ  2 㿘@ / 2@; r  @b耠@ 㿐`J c b;#h`@ `@J@ )#` @ ` @J@ #?# * * 2 `@ ? 2`  #  0@@dђ   @w @1@#㿘@@   @e @0@#`ݖ!X   ?0 !X3!XJ ݖX( 2J  㿘ݘX – @  2@ `ݘ!X  @  2@ `X`2#Ē          ( @ 0!㿘Ԡ! ? H,@ @?,@u\ 㿘   @n @:+㿘` `@* 㿘 @    $  &@ $$ 㿘 \ . @ " @:   $. ?㿘 .`@ݐ J ` # #(@ h "+ަ#0Ȩ \'Ȥ  Б,` "`@n$?$Ƞ @'Ȣ``$,`#0 @ǚ 0~#P `\ !N " `,``"`m#X``$(N 1f"h 4"`\ݚ  '` J@  @K@ " *  $`!(*`5" @#`㿐ݠ J  *`5 4 0    % * * *  * ` @t'@t@` `p@c   *     a4 * $xJ!!`   +cp (@9@m!cx *@8!8@m!8!8`\ J`  ``  ,@`" *  $`,@*`J `-   @q / ",` J  -2,`  ,` !8@  `\S7`A2  `o`?`0* `0'? ? ϐ8  O.  , R @/#i`s \  \ `  $ %J`@2`R`@ %P@>耊 !`ؑ*  `J`-`+`J  ``- ݐ J `2* * #ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%SJ`#_,?c܎ &?ؑ, `2 *`$ @f ؐ*@' ؑ*`" ؔ*`2'؁㿐 @!N J`2   <#$&@  㿘 # P 4"' `+ @l}@lz@@* 2$  @!(o`@7`?@p @#؁㿘   U + M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  c@7I  `  | )`02 `  2 *  ``?㿘 0퀦   @〦   ?" ` [ * fŀ " 4 Z`"° @  ?    @ "   ? 2 @   2   2w  @ِ@˔ "h   ?g 2\ @ U  N 2C  @V@ M?J  @, @ 2        @!*`?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #   ) |?? |2  2 ` `@5c 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@5R "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@4ʐ 2J N :2` `&`Q.`  `   7c耢`:`;<`,@+`?`J  S&` `&`L&@`;2NG&` :2` `&`.`\ :  `   `ث<``  1ظ"A ?`#2=<`@* `K  ݐ!X*` 2 @ @4{`0 2%&`@* ?`@ &`&`  aX* @2 @ @4``0 2 &`@*   &`&@&`<`㿘L  ݔ!X*` !2 L L  *`a" L  @0/L '  I%1܀`'`ߐ$ #ِP # ?L@Ւ   " *@`" L  `ؾ P㿘!( 'L` 1b @r " @@r` ` @$@pҒ@r" $  @,ݠ  `/-+ 1@p@ L X@>`@7b؀ @l@&ڠ !(`㿘`' @Ul  `@L@ "` @UZ& "$@g@ $,㿘 @  @`#@@   @"㿘 @x   ?  @xے  ?  㿘  !($`$@ӓ`  @g̐a( !(`㿘  `  1"N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@gv"@@f@J / /,  $'" y@fהJ / /,  @gA "@`@f "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘     1"@f `H #"`H`ݔ˒$``@f6  1"؀!(ْ`㿈@fa( ' ' @ ''@  @2*@ /*@`*@`"@㻐 4"'&@ d_N /"N Z@1 / $@@fX  N .G 2 N .2 N .  @ (;N@ /@ 4  /&@.@` @" V@e@.@ @e# 6 .@`" O / @ " 2N @n h < < < < < < < < < < < < < < < d < , d 4 X D 댝㿘"!!(0D`!(`0 "$`,$`$@$`(@X   4`  @v@n  ,S 0` 2@\㿘`"`` @u   "`  `0`0``` `xԖ    !!(`&  d & !!(0ؒ` 0& b!(`  & ,& & & & & & & & & (`&& $ @u 㿘`"`` @u   "`  `0`0``` `?     ` (6 `0  & & & & & `& & & ` &&& $ @uW 㿘 `ؐ  1!( 0Y`!(   &,B B `$ @H?& &&&&(&&& &&&$㿘   @H@m &?"$T ,0 ,N 㿘  @,@m &? ?& & & & 㿘   ` &  @  & * & " ,㿘! 3 1? 6`ӄ h@ $?"@  *@ &  ;    @iʖ  & & @ @ 㿘!   6aN h@Ɗ $?s"@ `l * &a `G d@$@2\?  ,*`   &  " "@      @  + & & & & >& @7  "@ % @ 6$@D`  (@:& & $@  &  @b, @& ?ܢ@`  * && &     & &  &㿘!2L  6a Ð @ h=?@ $8"@ X ?2-?  $$      $ @`2  "    ?(@$ $ $$ $  $ 㿘a8v `aP o` 4@b= @"&& &@`@ ?@ @$@( ?㿘ah9 `4 `0 \?(  @!,@@O " $  4@a&@ @"&& Ң@,@㿘2 a   !? ?  $ @`$ 㿘@2@aؐ @('?"7?``@` 2.?i ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@?aё ?"B?@ "-`` /aт @(@ľ?`$-"6` @ķ`@ " ` ?(@Ĭ&@&`$` @  逢 0 2 ` ?2`?`?&`*@`&`㿘 " ?@a@㿘a6 `6a . `@@`4 @`$@@"&&`: ?24?@ $`@G&@&@  @ 6$@7`  ?(@,&&&$` @`@"&&㿘'L'P'T'X@6Lh'P'T 'X` b лȒ P@hȖ'H'L'P'T'X  B H@H 4" '`  @, `:  %"N@ `2  & * &  `   U`* : `L##*` €CA?"<@;N@7 261N@ -+ )ݒ !X*` &,@: , ?Ѐ`  ,@-,* :`@  ?Ѐ` "N@` & , 5 ۦ ۑ* : `S"P*` € Ϧ쀌 * : `Y`!*` €   ,` @4 0,@@f 2 =  u< -7 +20 -`   04  ,@" 0"!"0"H`   4  ,@  x X,@ 0,@'@$@`"`@_ڐ ` // `@@d`%@ @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ò &   @*@`& `  @` x 0  ?*`:  `&   @*@`& ` @  0`', `2 < `& * & `,   `  ?L@r &   @*@`&  ``$@, `2 < Y& * & `4 @, Z(? 4" @䐐"p㿘 !` `?@}$!t!tԢ  "ah $!t "ax!x` ` ah ` @  $ah`@ 㿘@ * #%@   @ 2   @S  @L $ at x$at |ݐ |$xސ $at㿘ϐ "#%Ȑ  !@Y   @% at x$at۸ $x!瀤! $at㿘  )+!t`ax%!t۝ %ax  `@` `瀦 0`* &! ; &   @ 2 2  @і  @ʖ $ %!t㿘!t`  $!tSԀ! "ax #!xa#& a$$!t ! `  @?`?@ b a$& J`  & ݐ @@ `⅐""@"& 㿘t !x@ "t0 Ԁ"ax@ 㿐@X  @ @] P!!(`  !( @ݒ` @'''!( @Ւ` @'''خ !t`!x%!tА`,Ԣ "axaaa sЀa!a `{ a`((  ,( na  00"  aaa( %!t~̀a( %!t`( `(`0 @%!t`ݲ &  V 耠` "@ :` @`! $!t x %!tl%xa"a`(c!0riẐ",%@ צ%!tؐ" :  " :  2 @_# "6 " :  N` #a$@  ($< , *, @'''a$" ' ($< , , @'''a$" '(!`" : ؐ" :   ؐ" :  " )@w  %!t %!t  (Д ) {˔ }ܰ@ː `& %!t ($< , Ŕ, @'''(`@ 1""@`'!  ($< , , @'''!$"@`'@  "b'%!t'''''Ɛ!" @t @W!a$@   (a "Ȓ"Ð"ܒ`S#& @C@I@& 0& @:a   @G @&  & @> !! !$& @ ! @& @@+  @& & !  @5!  @   @{    ( `& * *   @g   !a$ @}!$,Q"%@ ,(` & %@(,& V  ;( ($< , ϔ, @'''"@`'("@ &  ($< , , @'''"@`'("@  & `(`㿘at !x"at؇ "ax! {! }@  ͐ W 㿘 Q!@h   & @ @& 㿘at  !x&!tT ,"ax!!  &!t  @֐ @=  & &  㿘at  !x$t+ Ԡ "ax! {!  }@     @`2$`& t x$t  $x 㿈!!( @` @'''@ !t`!x$at Ԕ "ax( $at%ݐ!  ($< , Ӕ, @'''$" 'at`!x$at׺ %!x|ݐ! $at ($< , , @'''"@`'("@ &  v ) at` & $at׋ %!x0!x!b 㿘@ >L #ݘ!X *ab؀=bŒJ 2 @[  `& 6 `&  {6 Ԑ "ata( ` U2` /& @@ a(& `3  a("`-   ` :"  @* `* `* `"a(`  "`  "@ "  a(` ?2`㿈!!( @` @'''at  !x$at Ԕ "ax;: 8$at% !($< , , @'''$"@`'at x$atА $x߀ ;@W " :  !( ޒ`  , !( ,   '''"@`'!("@ 㿘@" " " 㿘ݦݒ` @ "`" T` "`@@Ő@_" `"T`" `@ 2T`㿐  !x"atݠ"a$"!l!l " ݦ   a$ @ @ "@R` 2`@  //  yll"" "l " l l 㿘!( ~`22 " " " " " " 㿘ݒ`" l""l# !h㿘J `2$ N  a@$  a@$ " a@$ @$ a(   2 <   "  " $ 㿘!t` $!t` @ A՝ "ax!x  J# @ ``H`D `Aa$9\`7(3) (`!$` ` !p!x!( @֒`ܔ  !$ a$ah@#`? .`,$!t2 `!(T.` @``@`*``a($< , ~(`, "``"`@"``@" "@㿘!t`  $!t @"ax!x!"$!t$  @`* `a($< , } , "` " @"` a$" "1 1"؁ 㿘` & `@ " !"x ?#at .` "$PJ@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` }V  @*``@$.`6 @a 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 }z@ב*`}s㿘T  ?%  * @ @N N@@2   @"| 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@"L .2T* `2L`T TX*`T@V֐ |ڐ $@$`$`$`$`@VR`4$"R`"`"      㿘 @!`㿘T` ( `|* T``  "@ 2`T` &"@< h, &㿘!ݦ!a#X   c Ԛ$ " """    #X  T t!a 4#"cT$$ "`"` a`@"$ T$ t$!$ 4$" $@ @ @ ` @! @ݔ 㿘ݐ#X!"!Ԑ!a@Д )㿘@# 1b쀤  @U~ ݐ $b"`0@Uu@"㿐 ݒaX* @= D A 4@ 1ݑ* #X;ݰ#X %  /`@v ,@UА # @  2 @e  @! @U  @@  2  @!   ΰ  㿘ݓ. #X@@ $   @" " 􀊢"   2 " "` `@@w"㿘 `@4"@ݐX  "  @   ݐX  " " H2 @  㿘 1쀢   aĥ"H "" 쀎 @" "" ݠ#X      "  2@ 㿘  & 2L " @ܒ"# )ܒ"#   " ! & ~&  a!# $#  !ݐ{` &  & 㿘" "`" cX  $  "   J@ 㿘ݠ#X  2 ` 0 @i< 㿘 !zْ  奐 & a` & N@ #T    "@& 2 #T J ` π&   &  &  @( 㿘ޠ  `    @   `  @    @  㿘 ސ  @ 㿈< ";     Ԓa|@[E 耢 `` & &     J ` @ "&  & #T  '& ''@[  㿘  2  a ë  ` π` & ` `  0 `  &  &  !` ! ! ! ! ! " " " #\ $$ % % $$ &, %| % % & !X % ' ( (0 ' ( (< + ) ) ) *P * * * +< +T +l +t -| .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 -| .8 .8 .8 . , -` .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 ,` , .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 ,x .8 , 1< 0 0 0 0 0l 0l 0 0 0 0 0 1 1 1 1 1 1d 1d 2X 2 2 2 2㿘 ?* : `l"h*` €   #@a  2 @   K#@a  2@   @`3    @| *:  "0"8 ( @j @@c H@\  @ # , @bP@O  , `2 ȔX `@?V 2   p@5 ` %)x@*   #@ a  2@ @" @  `'-`+)@` "`"  )  |@  2 `@b``` А@ג`! @ϐ @ɒ`    @ ؐ@` `R@ ߀` @ @`'#*:  `## @ @ (`@  0`@8@|'  @ HV  #P#`  @e  h@] p@V `6@   @@0`@ 2@ @  '@   `    .  @(x @ 2@ΐ 㿘 `       4`  @ @ `  @ `0禍?`."*` €` "`@"  `@В @ɒ 2  @0 !#!@㿘 `    ^ $R  @N0 2   ^ $DA ?0>㿘 %N  , @€NҰ NN`   " ` $ \N $ (N`&* : N  ) $ ( (N` * : N  ) )  + " ( "ې $N`{  {ԒN  sN  NN }   }N  ( | )~N㿘'P'T'X@P h'P'T'X   B @P|`N% Nŀ`:~#*` €zzL s *`m:  L  iN(bdd 2 `2 , `? -,L K *`E:  L  AN9! ;  ;. ++ &`  ?  $N ?  N@  Nr㿘 i uߐ 4 4V  @^$В$ ` $  $ ? u$  " $@@@$@  `$@  $   $ ? u$  " $@@$@  `$@ " @Ȓ$ $  $ $ $㿘@  "up@N㿘 #N + * c@€N  N N  N`  ?N  N?@? ` 2Nՠ?N?c NhȠ    B#N  * `$@€[N, N' $ (*  : N`? ) $ ( (*  :  N` )' ) $N`{  {N  N  NN }   }N  ( | )ْN㿘  & ?t  `- t $@$`$ `$ ` $ `$ ` "` %$ ` "`$ ` "ߍ$  ب - &㿘 7  " t  " t   t  " t   t " @  ϒ ̒t{㿘  " tp " tj  "tdta  㿘 1#耢  @W?$##$cx @A 6 @$cx@`o @:    @:   `0\ 01 @^ݔ  $@@j`PK  @^̔   @@Y`x: @Wg?$@:c|@WZ㿘! 1#耢 @WP?$# < =4 = < =4 =4 =4 =4 =4 =4 =4 =4 = =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 =4 = T T U U U TP T U U U U U U U T UL U Wt U V W W WD Vt V V V V U W U W XD X X X X X X X X X X X X X X X Xܝ㿘!!( Psd`sQ$` !(`  $`$` $```$`` $`D$`H` (`$`L"`㿘!(```L"`T`?,` `@!"?@`@ @ ?@ ?<` `("!8`,!8" `0" `4" `8" `<" `@" r(s6`㿘Ԫݒ`!d  `  @@ڐa"`@`" 㿐&@@> @1L@ [-@ʐ ( &@3a(ِ` a(r`a($@̔ 6 􀢧(&!a(rے`㿐!!(`L@ݒ `!X*` h!( "!(Ԑ"Ԓ "ᔠᔐ $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@? $[$"L``U߀` " #$*` € E$  @$ #:$ 7$  =$1$ - =@*   0L 2`@`@f$ !$㿐!!( K ݐ!X*`  !(Ԓ$" $ ;$ Ӕ`#    L   " L" @ $""$ $  @t`@ $ !$h 4"'"@  1Z"؀b S @"("P@  & `" ?.@q ?.@Qǒ `  #?. @W ?` . @Uo ?.@ 0 0? -.0@ݒ@e!(B`" @С"x㿐@ ?2p"㿘$ `"b { T  1Y"؀"6 " @ @J @@ b   q* &  ?` &@@  @ǐ & ` &d  2  !&@ !(p` 㿘"2& !(Ԑ""ᔔ"`"`  "`  !&@i㿘! @  `"?" &@ @2  1"   " `0 *`L  "*` L`x`X@   `02  L 0"     *`: N  5 ШaX-#A : 7 $4?? 4 * `,  ` `  ` `   ` ɴ? 6? @R_ ?L 2 &@㿐d2 b  & p%  `& & "!&@㿐@Iِ0@ "$!( `oА0@[ @3@ 1@(#@K? 5`А   ` 2#@@ #@ @ @@ @aX* @""#\" "{, N@? @ 5`А   ` 2`@ 02`N@ 0"`bV `@H@$N D 5 4J В `@ `  ` + :  `*  R *J 2J0%@#N  5 4J В `@ `  ` + :  c*  R *J 2J㿘    @I@I   &o @& @H =,  $& @H  o'㿘@P " L [ =@ܐ  @  6 ݚ!X * @` &  L = !($Ԑ@  J `a@ b@ b@ h#h6` ` .@ @$ 2""!(n`@y  p/   b@ b"2   bb "       ?$"2` ?$$ `* $ p$ p@2$ "   `"  ? " n? $  ?$`"  n5  2 1A"؀"" ˔  4& Ô  b    ` 1  "㿘 " m @` `"&  ` m m `& `! @ a&!@'㿘 aX* `  N* `2 ` [@| 2J1 X(*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈!!(!m'`!'''!( PT? H? ?  ; ^L  ǔ " L@ ?"@ L " K  y&ɐ ($< , l, @''' " ' 6L2T ($< , lؔ, @'''"@`'("@ lȔ㿘 1#쀢`@㿘Ԓc!  @ 2`㿘Ԑ!R 㿘ߐ ?`F #*` € ~`9&@ a" 1 1c >&@?* !@C?* 0 >&ݐ >&< `Đ >& !&( ?` #ܓ*` €#c !lZ }% $c 0u֯ L 1"" ~&v\   0#`Ā l4`$`VL /}@U  x@ђ s<  mݐ`h$` ~&*1d0!`T&8! 1 J$" G$" ~&!4& ~x&@ 1 &" ~@&i$"!" `& "# ~T&`" ?"Ēa&㿘Ԑ ?`/ *` €!# 1k `Lg $# 0#  1 "b1 Ā k` & { 0ϣ 0 㿘@E<` @ @$@`0$`  "` & " ` 2` `k! `@S @ ~$`$ `$ `$ $ $$ J@ `]"?["J  ][["  㿘 [@ !("@㿘7$`"        ad c| c dd eD i, i, i, c e| f` n n n n n n n n n n m n n m n n n n n n n n n n n n n m | p wH w| p P wH w| {4 | { p r v v0 v w {L ut xd r z zL s { rT s s vp v wH w| {L t w x z x y s  0 d ( d L L \ L 0 L h㿘h(@ΐ@ڐ %   $ `$@?5"(ܢ"` `2`@`   Đ  t   "$` @ ?@(   ?!"$` @ 8`?@"$@B)"$  ."$ "  㿘"` #*` €!"x+  $b ^@ "b ?bဢ 9b݀ @X$b  "x"$ @ '"b@ "@ b  Ԑ?π #!"?В "$bԐ!*  #!@0 $b@ "$ /"` "`## @ Ĕ ?@  b  @!"$"` "`@B##@  0#8  "$`@ ے @b$*@ "@ ʐ n$b? 5`А   ` ` *` * ?Y"Ԑ!* `Q"Ԑ?π "?В "$b!Ԑ* JȒ` l#!#8  6 4$b? 5`А   ` ` *` * ?"!!"$!"@J $!!Ԑ* JȒ` 8#!#8   @$b$b $bԐ!* ` "$b  @c"< J"P`  @Z/$ba*@ "P@ @ ( $bbЀbЀ 2<Ԕa @  @"<b$ "@"" @  0@/$b@  b2 "$"b< "" E"<'֤ Ԓ?!J ?   5`А   ` 2  5 ИaЀ ?K `  ` " <? Ԣ!@ @$? "@" $$<  @ " <'@ְ 0!"<* 'J `$  `@ $@$ M  - * $`"  *@ "  $$  `@ $@$ ^  @* $`"  *@ "   @ $@$  * `" $  @ ^"c b    W 0X  0Ua$b@aȀ "  ?5 0G? ? 0B"x`""8 @ 4@ 9 !$b #$bLbL!@l"H "߀   0%"x`L"H`s`c`C @Ԑ   @2@bL @+@    @   @!$b 㿘""?#b8  #""b#b#|"4 x 0@$b8@?8    .       㿘"Ѐ "Ѐ 2<"x` "$b(`@ ɰ 0"8 ?#"8"` &` ?"  * "$``8 ?"8` `?#   #`@?@#`  22!"$ "b8" @?/ "$` `" "` "`$"$`@ , "$   "  @?"$ "@8" " "8# "8"$~" b0  ""4 C#@.  €o 0 2`" 8 "0"4 "8ڒ aڐ *H"LJ"H s c C bL?@I@  E b$@ ϒ ? J `!֐ @  5 !"$  ?@+?8֐"0* #bx`"8  ` "  @>"$`  "` "$*@bx  ""$` ` "`  2"  㿘  %@8  @@" @8  @ @I }"$ 2$8"  2@"`2@!"$#b("@` @>L"$ b("H# # #bL@>? @?* : `y#*` €@ O `! 2 , 瑐ݐ N` 3? " JN`@" @ Q J @? ␒␀ ``""@  )ݐe   @>`,@␀`  @@>e* ,@ ,@ $" " "$b  ""|`"  # ""x" ""|"b @ "$` "`~"xcȔ @ b$ @"#N@N``c cȐ @u "$K` 8 ` `@f  &a?N@ c.'N` w W)$"$``J ? 5`А   ` $"$ 5`ЖK ?   ` 2$    N` %  N@ c@@_N@ y@|$" N@ cb$"  ""b|   %#b@@@& $? b@$` "? #`"ڐ ""b| %#b@@@   ? 4  "$` ?"` ǰ?"$ b  "|"!"$ @"$ @"$` ?"` "   `""!ڰ?"@V ""|$"" ""|"bxv#"" ""|"cȔ @} b$"d"x!"|#b@.@ "|$bW$"|!"|#b@!"@ "|$b"J$"|"$ `"ڐ ""b|N` 2 @ 6ڐ 4B?  $"$  @ `* $`? "`"ڒ ڐ #""|"x"$ `V " ڒ""|@ "∰#@  @t""x"$ ` "? !$"`$`  `*  `$ "`7 $`| " ?"$ ##  $ @= $ !"$  "ڐ @"∀"b|  @"$`@!"$  "ڐ ""b|  @#"$`@""$`""`$"(""("$#b !@I" """|r$b"|@ ؐ?"|""N ⬒⠐ @ r". %""@㿘" + "@rԐ @ ".$bN@rȲ`" @$"#$b$br b?@&b$b"" @  $bN@r`" @$"$b㿀  )! 2  "" b$ %"\$ " "%""$#\#``` ` v"줒 $@b?0Aj  2 %"" 9$"`5/+- 3ڀ@  1"  2?@,`@@3"w `?"  " `$`"`b %|%x&&bL 㿀 )! 2  "  @  $  "! 2  "" b$   %"$ `'%"`  "$#`#\ ``` u覒 `@ܰ?0G@@԰?sv* 0s ',`@ v6 @+"97/5-ڰ . @v! @   ,`@+"97/5-@3F @u+"  2 " `?97/5-b$%"^ab$"vӒ 2`  2 " J?`/  1"  uℒ &|&x'"%L3 㿀  #\  #`u蠒  rw u 0@<?   H     ` 㿘J `  q= 0   q# ^ @q 㿘݀ !" " 㿘@q  q㿘!"  "`Xג`$"$`$`㿘@  4"'#!%+ 3-ަ/ i  $#$c $c$#@@o8? fcē* & @ @@! . @%?@F  <   $`@`@Y@@?@$#@`@@A @2AM / /-`?< @ /@ 2L ?`? ` L /"?* L /2? @2 #@@]@  @0@  2  Ȳ@D㸰 4" '@M ϐ p#`y@A s#` @A   4#`x@Ɣ0`#`)@Ay  $@ 2  @L3@Gc @G O    4#`@#\` `/ 4 bX`? "`@ X  $X `  4"X ? $ @X  $X` 2 `y`Y2g @T _ @Z` @S  <  @$ @\ ? @J  @ @\ / @LU  <   @8   @ !@f " <  @@Ւ" @r!㿈 @$k    p&@$^! 6  p@2@: @p9 "@Ь @{ sc )H @+H$㨀  %#@ $㨐 p@ 0+ސ@]c@㨠 # p@@q !@@:=@:;g @:7"@", !(@ے 3 &#`2!X@Β@% !p@Ē@l"L@Ґ " @c`-L !@ #$@:v''(#,@:p''@6#耢 !@@9  p @   !@ 㿈'D@'H 2!DHa#\@! p@l!@!x @x ? !@`aI  !@[’a@ 2  !6a@ 2!Da(Ḛ @ݐ"  p@9" @!E @E ? !@-b   !@[b   2   !b @[ 㿘! # 4 b0@c c@bP@ 㿘@ǔ P  d 8 l 㿘@*  2"  @E  "㿘@*   @  &  @D  &㿘 @* @*2   ."@, J-`?` J  5Ѕ*8  + J (J? `2 "@ 㿐  ’ 2  @*s $$ 㿐  bx@Vu? @D  & &㿘 2  `?J@   ɐ "   㿘c  ސ 8"cĀ ."cL`*L   ="@ "#"#L  `<" `>`! 0 0  "cĐ  "cĐ  "c.ޔ "c"ā㿘b@>g 㿘!#Ā   # @#Ā  0` 4b 'cĪ M) VT`@\j "  @8!"@>   @  Ѐ  *@ "    "ƐĐ@g)cĀ  @"㿘#//    b@=ː 2` @6\`& ` b@= @8 & @ & Ā Ҁ Ѐ 㿘#     b@=  ` `" & QĀ ဤ 㿐Ң cĦ sĐ D -? (?` X+#T*` € -@@J H @D B  /@1 3 `^?` -+#*` €  @0 $! 0 @082  @02   @0 4 0  @0`? @0@ ֐Ԑİ      㿘wcĢ ; m    cĀ 㿘cĢ   cĀ 㿘b@g `@Ab耢 "``"# #Ā`"%  @0"0 @,"@㿘@h   c`N""0"@@iސ`M`>䀤<  & ?'Ȑ ̖Ș @+  c@B ` @''̠ c0@<<  @,e̐ 0''Ȑ Ș @+ cX@A @+  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @ Oـ  4"`Oؔ?"`` "*  #"@Yj #p@`@ ` 4`?"`Ⱂ * "@YO  㿘   4cx@#@H 㿘@㾐 4" '#' 3) @6@ic? sē* & @ @'@ " @+@o@ c@AD @ٌ! c@A;  #Ȑ@ . 2*#@@ 㿘   4c@#@ 㿘 I@ 8@ @o@  "?/" " " " " "  ` 4"'# @ )   @  2@ @!@ >Ԓ?@1q@X!, @3!,!,O@4 @ 㹈 4"'@#耢  `n!x@ < @ @ `0#$@X"/@+   ሔ$@@+? @@@+ ? a ,@`;!@VQ @m !X@``@*?,@] X`!x@/3 !x@(, e`e@  `!@@4f @4b. :`@ z` `!@Vr   2"*` J@    @!㿘@`a@ɔ ??@i @i @i  $ @4' 㿐2&@y? """@ / @!`@A5ސ a#\ Ȓ$@T# @̒ &@I ?"`"? @@`5( @1$# @Ȁ &@& ?"㿈   ?'  @( ?㿈b@@ܰ"0 ~ c@)- @; # 2,L@ S"H @ JbP@|  " @ L 0bX@  ` a   @ ` "xb` @᳔0@  b@$ b@ɔ @ J *@$ 쀥 @$@㻐 4"'@)c( @z ?":b"@֒ #@C @f`b0 @V@> O 4@S`Hb@(ܐ,@u  bД0@2 0 4;9 ?-!+@b耢 @" ,@깔$# @" b0@0@ ޠ @u" 4" @{"㿘N         5 Б*`: ?   ` "N N N - +2N*:  - +n? 2Nk  N`-`+*N C 5 Б*`: ?   ` .2*:  .`J $ ?Ѐ`5`- @-`B2*@ *@B `5-@-B2*@ *@B  N 8@ @ N 2l>@`p @\l @Xh @Td  2"b  K@  ` 4#*`@ R` 2L N ? 5`А   ` ޑ, @@x #?@ @  @  @[`    @    E>  (K@@ ""?㿐    2`` 2"@3` + @0;   24  2@İ? """ 2bx ? @3` + @; ,2& !, @@   ⠘@! @ `ʨ 4`,  ,`@B2`*  *`bC eC (0  8  `   &`F F?   c@ 9  4 ?`c ?! 2 " 4 2  2` &`F F? 2"J@*  "J#`#\@   4"'#( @ "@?P  @T@T  @T!@䇐@T:!,!,@<@0 @b#8㿈   ?'  @%p ?   @* J@ " 㿐'D'H   #@-'N] `.`?: -@L2 Ǖ< 2 $ '    ?L@ "'`.`: L@@  @:  ?'  ``@" 2@!u @% .`   &D@؞  Y-: U R@z NHN D..`  L   <,@ L`  2,@L "),@L  $>   < "; "   2 "  ,@ `  ,@L Ȣ`,@@%H 2" 4"ߢp'@o"#Ȁ @%e#H 2L cP /$@%V#h @%N#x 'J  @$#($@㈐@$ $@*@$$@O` J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @ .?'l@?l l l@$@F : ?L 2,? l  l%cȀ ?@ ??  @#㿐cȔ@Ԓ ?㿘cȔ :@В@ 㿈 c///@Д찒  $@[@@ @&@   @ L ۬ t  4 X \  P 㿘߶#Ь 1#* N%Nۀ`M 6!*` €``,`` !`c ސ@. d 0,@ d`Р @.  0, Ɛ@w  0, "\ZN@ N R@P N @``` !c!܀` )c'!c!؀`"!ܐ@ה `` 񀥠 :1,¬ `` :w1,@.C * @  `` ?$@* $@Nf А$ @$@P:T1㿘 z N?  5`А   `  5 N,  N*  ?А   ` , ."*  N? 5`А   `  5N?Р 5 N?   ` 2 N * @,  *` ƀ: N  ca* 2  * 2"ؕ: *`2`:`@: @- 1cN!ƀ? N!㿈?@4 !? 2b @ D 聠"#c @< !"# 聠"#P? '?''   DD"# !8    "#m  ƅā"#\: 'Ԁ 7 Ԓ?'2` @'* ''  * '̒ 'Ԑ`̐" 'Ԑ ̐" 2@@'̑* 'Ԓ<'  'Ԑ `  2 @ @' 'ԓ: ' 2 @ @' ''''''Ȁ )Ȑ ' Ȑ 'А" 'Ȑ ' 2 @ @' 'ȓ2 ''Ȁ SȐ ''  1 *Ȑ ' 䀢   ܒ 'А" 'Ā ?'Đ" 'Ȑ ' 2 @ @' 'ȓ2 ' =c@?c-c@D??'ؒ 'c?ؒ ' ' `@'ؑ:` '2 'ؐ `  'ԑ*`@'''?聠"# t L 4 d t d  4 d |  t \ D $  p \ H 4                                                             t L 4 d t d  4 d |  t \ D $  p \ H 4  h??'T 4b@ ??T  *`9  'T ccc'c? 2b`@ !"Ȑ @ !  2b`  @N@ !"  'T c``'c? 2b`@ !"Ȑ @   2b`   @M@ !" ??ؐ 'T c`8`@'c? 2b`@ !"Ȑ @   2b` H @M@g !" j 'T c```h' 2b`c? 5`? 2b`@> "" Ȑ @ o @1 "" 4 'T c`p`x' 2b`c? 5`? 2b`@ "" Ȑ @ 9 @ "" 'T c``' 2b`c? 5`? 2b`@ "" Ȑ @  @ "" 'T c``'c? 2b`@ "" Ȑ @ @ "" 'T c``' 2b`c? 5`#? 2b`@p !"Ȑ @  2b`  @L@W !"Z 'T c``' 2b`c? 5`#? 2b`@, !"Ȑ @]  2b`  @LX@ !" 'T c``' 2b`c? 5`#? 2b`@ !"Ȑ @  2b` Ȕ @L@ !" 'T c``' 2b`c? 5`#? 2b`@ !"Ȑ @  2b` Ȕ @K@ !" 'T c``' 2b`c? 5`#? 2b`@` !"Ȑ @  2b`  @K@G !"J 'T c``' 2b`c? 5`#? 2b`@ !"Ȑ @M  2b`  @KH@ !" 'T caa' 2b`c? 5`? 2b`@ "" Ȑ @  @ "" 'T caa' 2b`c? 5`? 2b`@ !"Ȑ @  2b`  @J@ !" 'T ca0a8' 2b`c? 5`#? 2b`@` ""Ȑ @  2b` @ @J@G !"J 'T ca0a8' 2b`c? 5`#? 2b`@ !"Ȑ @M  2b` X @JH@ !" 'T capax' 2b`c? 5`#? 2b`@ ""Ȑ @   2b`  @J@ !" 'T capax' 2b`c? 5`#? 2b`@ !"Ȑ @  2b`  @I@{ !"~ 'T caa'c? 2b`c?Ȑ @    @I@K !"N 'T caa' 2b`$c?cD?c@l !聨Dc?$ 5`?cD?c@J !聨D 5`#? 2b`@~ "" Ȑ @ @~ "" 'T caa'c? 2b`@~ "" Ȑ @ @~ "" 'T caa' 2b`c? 5`#? 2b`@~ !"Ȑ @  2b` ؔ @H@~m !"p 'T caa' 2b`c? c@? 2b`@~@ !"Ȑ @q  2b`  @Hl@~' !"* 'T cb b(' 2b`c#? 5`c  ? 2b`@} "" Ȑ @ @} "" 'T cb0b8' 2b`c? c@? 2b`@} !"Ȑ @  2b` @ @G@} !" 'T cbXb`' 2b`? c@? 2b`@}j !"Ȑ @  2b` h @G@}Q !"T 'T cbb'c@? 2b`@}0 !"Ȑ @a  2b`  @G\@} !" 'T cbb'c@? 2b`@| !"Ȑ @'  2b` Д @G"@| !" 'T cbb'c@? 2b`@| !"Ȑ @  2b`  @F@| !" 'T cbb'c? 2b`@| !"Ȑ @  2b`  @F@|k !"n 'T cc(c0' 5`c  ? 2b`@|E "" Ȑ @v @|8 ""; 'T cc(c0'#@/ !? 2b`@| "" Ȑ @G @|  ""  'T cc8c@'c? 2b`@{ ""Ȑ @  2b`  ̔ @F H @F@{ "" 'T c``'c? 2b`@{ ""Ȑ @  2b`  ̔ @E H @E@{ "" 'T ccXc`'c? 2b`@{v ""Ȑ @  2b`  ̔ @E H @E@{X ""[ 'T c``'c? 2b`@{; ""Ȑ @l  2b`  ̔ @Eh H @Eb@{ ""  'T cchcp'c? 2b`@{ ""Ȑ @1  2b`  ̔ @E- H @E'@z "" 'T c``'c? 2b`@z ""Ȑ @  2b`  ̔ @D H @D@z "" 'T ccxc' 2b`c? 5`? 2b`@z~ "" Ȑ @ @zq ""t 'T ccxc' 2b`c? 5`? 2b`@zH !"Ȑ @y  2b`  @Dt@z/ !"2 'T caa'? 2b  2b`c? Ȑ @= @y !""#x???'?'?  @  '?"#㿐'D'DD `D `??'':` ':` '|'耢 耢 d ܐ "# ܐ@'? 'ܐ ܐ 2  @ @'?'?c * $%D?c * &'??'? * '?ȁ"#0c: ' ܐ "#~2 ' ܐ 耢 ' 8  :@  '=耢 3耢$ D"#Q"#J%?2@' "#82 '  8 ܐ :  '''?c * $%D?c * &'ā"# *  *@2@*@    2@ : :*:       @    㿘    b`  ?   b`  8  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  #Г3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         b`㿐?Ё  @  ?@ `㿐? ؁  Z  B 聨7ąB' B'@    ɖ @> . 6`  `6 @3 @? ؁ $% 聨7ąB' B'@@ f  聩  D'…B'@@ F #dd#dd` B BBD# ?B#82    #dd#dd B BBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  !4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@㿘  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  "3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      㿐V  $D`  $$Ā`$: 7 @   $D`  $$`$:   @ $D` @  $$Ā`@ $:`  ??#@? ?#  #4   "   d `]4 6 6 , ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @ @b   d , 6 @4 =$6 X`ԁ@$ X`ԁ@㿘` ` 2 `@ "`@s? "?` &``@ , :   @ * &@@=㿘 L@  . !* @@J /"J /2 L@ /`  . /*`  *"J /"" # 1 @.@sQ  ?"` " (0 (`0" " #`@"    `  0 "! H P """  """㿠   @" &  g @㿘 ` @=L x  ??''쀢'@r " ?c! *@ @  '@؀ ?؁㿘@5>@  $>>2   *` 㿘 ) 3 & `&   &@: , 㿘   2?2?    `*`,  @ޔ  ` `* ,  &?   2 ?`2? ?   2 ?  2? .2 ? 2 2 . `0 *`    2?  2 ? .`2   ?  *` 㿘2  @  @.. . . . . . .    ?  ("   *㿀 4" ' 2/?  )?2  *@ 6 .`. @` @`'`'` ''&@&`&` &`   ` "  @C  ? 2?2 &? 2 2 0 ` *`  $ 4L 4@ 44 4( 4 4 4 3 3 3 3 3 3 3 1LT( + 8 ( H % h "      ! ! !8 !`  !  ! ! ! !㿐  ?  @  ?? % X`ԁ@ 7` 7 7 7 7 7 7 6 6 7 6 7 70 6 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7H` ``*`?`[`#?? 5І 2&+` `  `  `  `? 5І  +`\ @ +G` EMȇ*` \+  n+ \+  r}+ \+  bw+ \+  aq+ \+  vk+ \+  te+ \+  f_+ \+  sY+ \+ Є 0+P + K+ ` 2 ``*`?`[`#@ ` \+0  00+ 0+ ` 0(+@` \+  M+  `? 5І    ^+`  ? +`@+ -+ +  +㿘@N@:`@*``2`"*㿐N@ nl) 5 *?[# А@  ` 2%.    #    А@  ` "`. \  @2`*.?  `` N@"@ @ UN@ 2.(&N@"&` N@N@"&㿘 N@`zN@8N@N@p "*$ X`ԁ@㻈 4"+`$'753 /   @/$  @b X#  "@`$%`$ )J # @w & @r & @ׯb     @ק&  "( "0&  @Y찒    #@ $$  @G찒    #@Қ耢$   b8@2`$ %`$J #" b8@& $ b8@! $  b8@쀢 i$ $ $  b8@찒    #@ž耢V$ b8 @찒     #@耢E$  @$! "@@ !"P@& * "X@ # @ b@ "$ b@@ʔ @    "H@  $   @ O "  @"` 㿘 `@:    1  $㿘@* " !@Œ  $  $ 㿘@  ! @֯   $ (! 1 @ 0""p@" Ā@<   @n# O ""p@Œb $  @n @㿘! @=$ p "  bp   ''''''@̅@ '' b '' @  㿘@@   2H( HJ  " H?" J  H  2*? " 2HJ$ X`ԁ@㿘`@m? "@  6`? -&   ,,-`@ے  6 @̐ 4ݢ2ت`k@ @,` @ @,`  # @   @-  @,`  (5 : @z@v  6  @,`   @,` ڨ@O $ X`ԁ@%4 X`ԁ@% X`ԁ@$y X`ԁ@㿐 @?.@ .  ?#@.   ?#. ` '@ P   ! 4"'L'P'T'X'''" ` ` @ ! 7'@ 'Qb''''Đ@vL"  @"$Q X`ԁ@$v X`ԁ@㿐 #\@( 4"\'D'L'@m  @" L   b@"  .``2 @DL@X,`   "@}b  4`@ LD @@lȴ 4` @!  D??@ ?? '''@, ? `! H@Q!D H" '@ #'  k@@k`0?`'@k`=" ` 9 @k /#\``! @  c@!% 4 c@ː@k"@ `#\/`!` @s  c@! c(@ٰ ` `@-` @k@- 4  #@ٙc8 @I @Q_?`@T % @k`# ! 4 4 #@ـb `# #@kwb@@t`  @  @(6?@^`@` f`@`  c@@5 '@!'@ 4`* @Ő ^ @ H @0@; @5o@4 @ @k#@ɱ 4 #@cP0<@6 *   +6`*`% `+ @k%"@   @ Ƙ : @j`  4@j@z 4 #@cx0 #@c@ @r @j@` 4 #@͒cА@l'   #\  @q  @8 @R@Nɀ '@  #\  @S    4@# 4@!  4 #@؊cE@LL @4@ @4@ @4@X  "O@jj@D 4 @#@c` @@   @4 O`   @ @ 4 @@@@ې @ ? 4"  @ (p  ? ???' `0'ܔ@0Ԁ ?0@Ѱ 0Ԁ   @,   2 @?㿀! 4"  ?  ?'//' @ "  @X 8  4"'     H@v`` `@ @\ @`2W? 2"`"P?@,ܐ J  h@֢$#8A?@ @ ``@@@`1@!   " x<    T`@\   ` @     c"!@֖?  @Ր!㿀! 4"  ?  ?'//'@  "  @!㾈! 4"'@ߒ!?쀢`# =` ;` 9` 8 5 4J? `А  J   + : `В `@ `   + :  *  R  * J   р?ȐJ  7 *  J " "  J    5 J?  J     J   퀢?*J  @ L + -L   @ 56 @Ғ -   @0& L   @ ?@    @0Ȗ @T @OL@ + -L`  @`0 # ` @0L`  @ `` @0 @М  ?@Е`?  ?  4  @s 2L?  @!(` 4" '#\ /! @ 2;    ?ؐ ???' 'Ԑ`0'̔@̀  &b@! ̀  /  !#\ @ 2  @3   2/@̰ b  @6!8` 4" aH'#\*aH /! @` 2S  #\ ! @S 2F    ??ؘ ??' 'А`0''̔@̀  0@>+H̀ ̲ /  !#\ @& 2  @̒   2/ "H aH@O @̰   @Ő!ph 4"\'  ! @    @  *`@ ٰ? @" Ұ?  @`=`(*  ??'؀`6` ! !Ȑ @,?"@ @`?@E@Y  6`@" :?8?@.   0: < @ 8 22``2`*`        ?#@2` 2`  2`   `? ? `MK``2H? 2@Q" =?@ 7?!c@Ɛ!@FS@!쀦``@@ !?@@λ "?  @   "@ ? "  @ɐ!ȁ㼐 4"' @" (?@E`@@| `@!   ? @ %@.*`   @!؁㿘 ? ?   ? ? ?@   @J " @  @  ?㿘 @*@K 2 `"   @2    @&㿘!fHՔ"H  "H㿐@ܐ    􀢠 `" ` 2`22  @Ք @,@e"h`'X !'X@(    4 #b@u? @Ғb  @C  2 @C  2@۰?0&   @ ܖ  "0@  "H@o?0@ @AC   @A=   @\"` @  @S"x  @/l  "@e@ë  4 #@bv @vb !X@p X J@ 2'X "'XX@m / "X`' b'X''@j0Z@-  X@mϒ / "X`' b'X''''@jp0AX# `@ 2@sX'X@j X ` b @" "b&b@j 2J@@'X@@m / " `'@ "&&&X&&@j/@d@! 4 X#@ҍb @ +@? x؀ N  d@'$  c ''d@b @s$$   # $:$$ }     #  #Ȅ* 㿘? @e˖ 㿘@ 㾐 4"'@!`` 0 /@d#? .+",  @.P 6!?4@c44@ @e @d`0 4@, @$?2@@ ?$  @j#㿈 ''@ $΄ X`ԁ@㿘@c֠" @ ?2 @c`2?  @e& ? ? 4 ?㿘 4"@۔$= X`ԁ@$i X`ԁ@㿘 @ga @c? "$: X`ԁ@$) X`ԁ@x" '" "  @ݔ؀ ?  '?ch?#ض  @ ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @V ?`?D '#\   @2@  x?@az? "@0 a` , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@ɣ 2 `?$  ` , `4  ` ,  "J 2L Т` 8@Ҙ `?@b0#@+BSF  @   `? ?b 4"' 4 @뜘 4    i Ӑ d?cH @ ]@%آ   #\   @?@> F ؐ @i 06*` *      @ `( ( @ߐ @*  @   @3@?#\  @a??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @ȝ " L _2;`  @ȓ 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @ꗔ" @( 4@*  4"  @?#㿘 2#?  , @€? 㿘 ' ?@I㿘@$S X`ԁ@㿐`wĔ ?㿈0  @ `@ `@0. .`0 ?@0@ ///`///G/ @* @ * @ * @ *ֈ 1 ///  @. `@ 6 ` . (06`/// @*@ *  =@*  =*  *?㿘 H   @R e "`   `9N +`3N@R"@* .@*  `I"@@: .@@**`  ` `9"@@: .@@**`   @+"@@ .@` N  5`А   ` `2N= =B N     ; 86? 5 а     ` `2N=2"?N  5 Ѐ   ` "?N ` @ ?0?㿀@z' ''''`0   `a ?"a@J㿈' `1 ` #\ `"XH@F "X㿘  0 @ @2@^1  /"x 4"   X '#\@  @^  "@Zb  @ h0 4"  '????  4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?@$'''', ?@''? ?'P ?# :/  @ 2: :[ ,2 :R ,, ,  , , @$ 8 @q@$@\x $6)   @    @ :,   ",@]; " @}"  @ $ X`ԁ@㿘 N  ."p*"p /*@J /"  J/"p*"p *`@" J /2"  #1"p@.@\  ?"㿐#\  @4o  % X`ԁ@$/ X`ԁ@㿀'@! ?''@㭒耢 @&$" X`ԁ@$j X`ԁ@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $' X`ԁ@$+ X`ԁ@$ X`ԁ@$. X`ԁ@㿈'H'L'P'T'X H  ! "x@͒('& "x("@ @t !   "x@ȴ(!"p  2   ?'  @=  $"p"p 2c "" $7 X`ԁ@$8 X`ԁ@$  X`ԁ@x  "(b0?' '> ''@( @\0? "   @ '? @ c` "8@ [麐 O  K ܐ@a  @ > ; ??܁$ X`ԁ@$ X`ԁ@$ X`ԁ@㿘 @Ē  . "@``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+ L@ 1 "@ @>  2  `@3 2  `@ &@  & ڤ   @`c 2&  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@$ X`ԁ@$„ X`ԁ@㿐 @# _#L [@ Q " J``MJ  1 `M* `k`G `K`( ## # `m`g # # #Ȥ ! #% $ #ؤ$!#@"ɒ"% @ #@" W !  @"c""! 8"x@  &&  &&@"x$Ä X`ԁ@$ X`ԁ@$u X`ԁ@㿘"`   @ 3  $b"` %@ ' $b2 $"/ b* "@*`@"*` # "b@b * "@*`@*` @$" $"@  $b*`" *  "* @&b$ X`ԁ@$b X`ԁ@$ X`ԁ@$ X`ԁ@$ X`ԁ@$ X`ԁ@X 4">' 2 2@: 2%# ! #  ` @  2` "`@ `@p 2 @ 2@& @^b  @{#㿘 2#  "  @f  2  @1 #$9 X`ԁ@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  㿘@@ @ @㿘c   @ %= %c@ϒ Ȁ @L  5cc`? "`@r @  "@ ဢ0 L?   ` 2 *:  "Π #"ˠb"b  @*$`L $`$`@$`L $`@""` "`L L〢 % 5 cȐ@F   L В `@ `  ` ` ?$` cА@.   L В `@ `  ` `  $` cؐ@   L В `@ `  ` `  p$` c@   L В `@ `  ` `  X$` c@   L В `@ `  ` `  @$` c@Δ   L В `@ `  ` `  ($` c@   L В `@ `  ` `  $` `@  LL  =2 L@n$`@%L E L　 #" L #2 " L "  " "& L "& @ 2,J A倠"62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@В =   㿘1#     @'`&#@ @[ 㿘1#  @à8&#@ 㿘#c!@  @ ! @VS"  4"'@  P @  X@V<P< @ H  D "  .@  .`  (.`  .`  .` .`  '  ?8h8 '<'@'D'8 @H 2 LH @ "@` @  @@   @x_ 8( @? '@U+@>' "@># `@ @Z@u  @@`@@v^ 2@>Ȑ   X`ԁ@"` ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( I @Jg" `8o-"H  XJ+"F J ?`F  u2B a00 `   +  *@+  *@  *@* @* @"    @ *@"  @  㿈M O?'@͐ @, @, @Ő  @殒 8  , M? `0 5`А   ` 3 @Д J`@=@T " @ `  =@/*@%@T " @ 0 M g  o a *`:  u*` : mid8` :  +  - =`=*` }  ?* : ` nh#<*` €$`" `" b II -@ & ? ?@ <@ < ="  +` -@킒 & ? ?@  X@i  -@k m& ? ?@ M<@R?2 << = ``<="  -@F H& ? ?@ @-` -@. 0& ? ?@  X@P M  ,9*` .@T`g"*`o`= -`X`+`-0>0;`u06*" -"   +* ("  %" *2 ?* "  * " +-  =  *   - +  X"`" `: J@+-X2@   `J@-+`8  X`8  `( " **   " **  "J@" ** ʐ $! X`ԁ@㿘'L'P'T'X@L㿘  ! 4 `H@.#`@S# #@$`P@uu㿘 @&@G 2 `   @9&㿘!cߒ   㿘@    X@`h&@@` &` 㿘 @&@1  & @-& & & 㿐@     X@q`h &&@@@  􀢠"@L@ # J?` '@ # $'`@ڒ` ?@3& &` , @`p "@, L "  " @ђp ,@`@ "@J 2@`#@4@& ` ` &`@   &`@R_?z@RZ9"``2& ,*`:  # "" ` *`?2$ @t*` `* &` $ &`@ & $@{p ,  "$L  $ 㿘c&a㿘c2!㿘!ca<   $\ X`ԁ@$; X`ԁ@㼐 4"?  c!P '` $d `7d @  & `` `" " 3 !/@ *`  @ *  " ` 2 @ & @.  !L @ %@  "  '@ @- X`%` M` @" E&   dD &/ % 5Р    ?  ` 2 .ဢ߀݀`2 @@Ԕ!` `ؘ   @ܒ`x 2@"` `  "`d "b   4"  @s h 4"eb'd!Ȗ @L"@c ?А@! @A OЀ   `@9  L { / - + ) L f"e4i` b2f``2c`  ؒ *2#"0  $@0$@0$@`0 #\$ @@+@ )  @ @ @` @  "& 2   22 & @} 2 ``4 L  f   @r!㻀 4"eb'd!Ȗ @ퟐ"@ ?@lF! @ڕ O 9  `@ 2 '4+ b2($@@@   @@ @} +@u b0@2  b4 L ΀ f b  @r!㿘cb @:@Y  b  b @<㿘!c"@! @   @4  @{ 2  @㿘!!X   !(@ba8$!X@cb"b㿘!!X "c@$!Xc""㿐aX     !(@@a8 $XX@ y J?` 2'#X!!`@, L@ #@ # 2,"!d@v !d*   @a@ X, L%L "  " @@ ,@`@7!dt " ""`  "'$L " *`:    $@6 , @p@ " $,  "$L  $!d㿈L@ 0  `L@ x X2 @ ` @, `< 5 Б:`?   `  H, ?Г:`! $, : ?   `D : ?.    ` ?? ` @, `ʖ*:  . `$? 5`А   ` 2$?$$:  . *  $ X`ԁ@%2 X`ԁ@㿈 2 ''   @ ?) `"@좒    @ ? @N_ @泐@NZ"@@檐 @NN " $ X`ԁ@㿘b ! @"@N8@ !  $N @N+ " 㿘@b"% 2؀ !"@G  @Wb@N"$*` @" @ @ꛒ"@Fb @Bb "㿘!@9"@)  2"#@3"x@ aHؔ  ' 4'''''"'@ʒ耢  ?2"2   *@`*@ `2E   *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@ `㿘'L'P'T'X@L㿘@Mo! 4   aP@k#` @# aX@a#@ #@Za`@o㿘  @$ 㿘 ?*` * b0N  2! #c0 @ǐ  $c0@ 2$` 1 #8h@! #8 @g  㿘 ?*` * cHN  2! #`H @  $`H@ 2$` 1  Ph@  P @6  㿘!c  @%#`d'  @ `@##`@ "     @ " @㄁㿘Ӑ 㿘@#@    @ c@@#  㿘c  @Ԑ#`d'  @̐ `͒㿘 "@Ly '@Lo @Lj"㿘@飐#@L    @ c@k@鏐#  㿘c  @郐#`d'  @{ `͒㿘 "@L( '@L @L"㿘1# " @1#`"#@^ &#   !p@a&#@ 㿘@ 㿘!@3#  "# @*#㿘!#  @#c$#`"#@, $c㿘!@#@ #X 4"'TT'  { '@T) / + # l#` #@A `%#@ # # R 1P'c c̒#\'#` #㬘@ۚР@c $c$c$)#㬒መ@ښȀ @%##`"%#@o#መ@CȠ@%#  @#̒@՗@',#@$ '@{ 2L##`? "`@ @  "@ q0 +Ā`b L :`  \@ o ! V%## #@ N#  @# @@# a@̚Ƞ 22#̒@(@4',@Q#a&@Qa&@Qa "#@ J@ #@  K&I&@7 @Pa  " @ # %#@J @Pa  &"@ #@Pےa&@Pגa "#@e @ϔJ@ 2#8# &Ā#Ā  Tc@%& J ,  *"@`    ""@*"@ `" Ā@  '"@  4"  @l!$] X`ԁ@㿘@c%3 X`ԁ@%$ X`ԁ@㾈 4"' @J   "a4?   !  " @I "  u"'p'' P `  @ 0      %@Ӟ   ?????'̐ ?'•  / @  ???''????'???'4 X4 S @@提@Ò@-+ /O? 5`А   `  O` 4#*`@ R`/ O` 4 *`@ R`/, @i5 O` ` ɀ@I@,̀` a@z @E , p @j? p@I'`p : P 6 ` 2 @ .  * 0 &   "     4 `@I4@L4`"````@H"  4"  @kN!؁㿘`   4` 4"'`''' ''''' '$'(''`  ``0 0 ```Ô@H? ""  @j!< $ b(" c4" p ?" d ? l0 " - ?" s ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$d X`ԁ@$ X`ԁ@%% X`ԁ@$K X`ԁ@㿈 ! 2  #d   #\#`#@ #㿐L? 5`А   ` 2  ' 5@ @#  J@`:`В `@ `  `2 .@J`".@ .@``֠ 㿘!!8  !8H` 4`` `#\`#`'@ #d@T@_  "0@b@  [?@ߞ@xU G J?` '< @ɐ ,  , bH@$ @Ā ' ĒbP@ @ @c@  @  @O @'@F? "  @ic"`x 4"'@  "0@b@ NX?@)@R  J?` '؀; @Vؐ ,  , bH@K$ @H䀢 & bp@܀ @,耢 @@!  @ @ݒ @@F? "b  @h"㿘 &N    5 N?   ` 2  b@FA@ @FG? " o X`ԁ@$  X`ԁ@JJ2 @(*`*㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& 㿘 ~6 (2.?  *@`@  /2*@N @F  @ሐ" @t "%  @ 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@Ւ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@   `- `*` z #@-  㿘@@㷐  #\#`@  \`  : /6@ " ^ "$  /;< 9@(@2 @ 2  2  @ /< 62@ `$ @1  @2 `2@  /2@  / 8  6 /  #\;`@㻈\ 4` d 'i @C6"@U 2` ` @Ɣ$ U?@C~`€ L?` "H GD @ /`41 ) ` .` ." @4 ` @ ? 6#\#`, 2`  2J`` @`@@,F  @e"㿘`@ `@, @L@ښ` ` P?@aL&`  `` *`@,&`?$@&`  @ `"@: @@p& @& "@@5 ?` * $@`&@@` * $@` @   #@@Bİ?" ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@ښ?`@ڕ & 㻐 4"'  @q$   b b@n$` @` @@+Ub  @d"㻐 4"'@G$ ? @$€!b  @dh"㻐 4"'@$$ ? @(€@aÒb  @dE"ȁ    (*@ ` 2  㿘N@  @,   @H $@ $@$ @ 㿘 " @ 2   2 㿘`" &@@`@͐ 2@&㿘"!``(J@ !@m  `@˥!"@c @!" `!J@ !@T  ` @ˌ!" @J  @"   !b" "  "" `!J@ !@2  ` @j!" @(  @"  `!J@ !@  ` @R!" @  @"  `!J@ !@  ` @:!" @ !" ! $"`$&㿐N@ ' ! J@` :'`J@ `'@G"&@G"& @G"ز [ @ TJ 2 M& @F"ز G @ @J 2l 9` 9& @F"& @F"ز - @&J 2R #@4M # @& @Fʒ"ز  @ې J 28 @45 @4 & $0  "& & & $@F"& @F"& "@F`& `&  &   2&   2&  2&  X@t!L!P` @ *@^  " " 2#)@% a  !!` '@ $  # Y 2a a#`'#\ !ᘘ@:ؠ@9a $aW$$aY$!!!@ : !$LB$Ԓ@̀ @$`J@ @ܾ !И@ $!d&# 2c "$@ܦ!c@zc@$ $c!d 䀢 "p@l@Ēa@ᜒa*@!T Zm!T 2`/"@ɪ  ' 'a$!T@S! S O!TJ +$ -J  @!T   "a "a@O "@ܐ  2"caa@!T2(!TJ  @@4Ȣ ` J@ f!@\ @!X!T@BLP 4" c  1'' '/РА#@4 1!P '' Ȕ  !P    b  @aH#㿈%ڠ 3 ? )@`!D0`2$@!` !@- !$@%!D! b@耢 $@%!D$ @ " @ $@%!D$ H 4\" 'H'''Ķ? '  " "@H'H  #( #@ cPH@Ô '+J+- 0#aa @ʐ aHҖJ   @I  H@ֈ'Ha@7G @x'2@/ @d @?`J@ @ a@ ( "'@I'"@C'`'@ !@Ś   "M'@*I'@/  :0 %02J  @ @ʐ  ` J@ @ @    & @H f '  2/АВ@Ɣ  ''ȐȒ@r 2  %a@տH@ռ'  @_ؐ#Xh 4"'@_` 1 /АВ@Ǒ`''Ȓ@=    @_#h㿈 3/D'D@q  ''@  㿈!L@T'!P @ . !T@!   #\ p` PP 2!` @ $P 2'@!L`?㿐aT'$ 2'㿈!L@'!P @ . !T@!   #\ ` PgP 2!` @ $P 2'@Ɛ!L`?㿐aT'$ 2'㿘#@٬aL!!"!""a@Զ !$!"!@ٚaL 㿘 㿘#@ٍaL!!P򀢠"!@ $!P!!`"!@ԑ !$!"!@uaL㿘 2?"" #x    1  &!P! #   } &!P 1!H   c#@  &!H 㿐aP  ^ X & $* .@` `&* .@` ` @$  @  @  &* .@` `&* .@` `&* .@` `& * .@` `@  &@@   '   4"'P'L'T'X'''"`` ` @w!?"77@ '' ''@L?  *@Ԡ "& @ӷ'@;]& "?  @]͐#㿘@Ԑ   $ $ @  $  㿘  @2 *@e$  2$@Ӂ? $  * "  $ 㿘`  @ .`@ @h` @*@b@`㿘  @: ,`@@b 2 `@* 㿘L@  @ 5 А `?  ` 2`L@  5`L@  @ 5   J`@ ?  ` 퀢  L   5 А `?  ` 2 L   L   `L"&  ``&@   @@* & 㿘@  "' `$ ,  ,{   )u    "@Ұ @Ҫ@Ҩ 㿀'ᰀ ( @Q @ʐ ?,@?@Ґ`''  @҈  ?( 0@耠&"@ 2  31 0  0##Ȥ#@@䀢   㿘J`"^ J #X " 5 А@  ` 2J 2  &J 2L ( 5X& 2?0  &J`  А@  ` "J "L"@6 &@?@=@  * 2 㿈  #@S0S?@008 1 *'5 3z  ? @ѽ0 "` &㿘  ` `@  `  @     @   㿈&  #@0?@sU ʖ 1 L ' 耢 " ?:( @O 01 "@A  "@:  @3@1  Ð@" 0@ 㿘@I     N  #` N@  # @  @ 㿘     `   @㿐` @Ջ" @Յ    @  㿘ז   Ж  Ɩ    $ @I7 "NN? ,2 N`@o(  @Ѐ  @g 逦@v 㿘 3 ! 3`$ %  $`@b    " @[   @T@R ` $   @$㿐 3 `' +!!    0   : $!!   `H  1 @^0@@i " 3 $  3  "@" " 㿐!!'  '  0    $!!  @" `H 7 1 @ `@`  `  3`  2  2 @ "    ( 0 㿘'H'L'P'T'X@H㿘  ! 4 `P@1# @V# #@'`X㿘 5 Т @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0  U??@6  + 5> @6֦? ""?,  @`?`В @ `  ?ܠ?`В @ `  ?`В @ `  ??à4 `2&@X  N "q @ә @ `"j N@ "f @ӎ @('_ &'@&@NĀ  4T #̔ Ė ?''?'?'' ` #\ ` ' T ؟ Ԁ     `@r``Đ?"`h@0ఒ !``@& & @*@`@͸'@ ' @ҿ@@*@`@!@|ā㿘`? "`@  "@@  ??     zg# "" " " * * ! @(*`  *02 @$_ X`ԁ@㿘@ @` $a X`ԁ@$I X`ԁ@$ X`ԁ@$ X`ԁ@㿘`0   `"`a ?"a`` `&`` 2 @@ "@@5? %"``"  @h ? `@?&`*@``&@`  @Q ?*+++)++ + +++ +++++++++++++++++ ++++++++++++++++++++++++++++X+h+*+++++++++++++++++++++++++++++*DDDDFFFFFFEF$FFFFFFFXF(    " @@p!S 4y * @` $`@ƀ  $` $`@.j @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@Ѣ$ D$ H@  `?$ @:   "@(  @8  @ u`$ $@ -@ Ғ@ @ Y4 (< DbE$ L$e& & & @ ` "`@ i`㿘   @J @:  J@ | 2@  @&J@ |!` & "@ 9  "@   " @ Y "@    " @ K "@$㿘 @?ܑ* : ` X& * € @ @C   D`" D D  ,  " @Ӕ @J@ )} )  ,  H" @ J`)g&@ c@   ( "( `, T"`,@  `( "`( 0 G"0@ C@ >  `@:5 @~ 0@ , @ @В  , &@:` @:,  @ 5 В `  @ , :`@ڐ @  @?֐ , :  ? {`  ` 5 В `  ` &@ , :  +"(  ? *"  , {J"@( "@  "@ "@"@ "@s "@ "@  @$" "@ٔ  @ $@Д S@0 @J@ ,2`& ` 5 В `   !@@@  @o @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @ݒ  @ ! @?֐ , :  ? {`  ` 5 В `  @ 㿘 @ @ &@Ր *J㿘   @ J@ ^2 `&@1  `( "`( , ", @-  @  ` :J@2J`` & @   `( "`( 0 "0 @Z 㿘J@ ``\ & @ @J J &aa)|a{`." `[`*,`:`#a(),`:`! a}a9,`a1 ~b[,`:` `@r| @ w@Bs@  o  D`" D D  ,  " @ @ `  J@ \J` ) \G )  ,  H" @} @ ` J@ \ J` )`,&@ƒ (.` H @\ `@@@R @    "`H`2:`@ ,`:`@ː  @"J *  &"@G "@( "@; "@| u s`$J \o`$J {k`$&@l @ #J@ , ` & ` 5 В `  !@P @E !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘 5 а   . J@*`А @ "   ?  `  $   @Ӓ 㿘     c@@}  2&    cH@}    (@Q  &@  @J@ ^2 `&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@=   o ` 1`?,'` % 5@ `@ ?А  ` "?@ * :  @ `@* ` ,`?<@` @1- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@˒  @@@>0@\@d 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @  @  `  J@ :J` ]3`@q 0m   &@h J - ]@^ @ @ @T  @ ` J@ = J` ]`?&@> 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘 3 & @ J? 5`А   ` 2" ` @  @{3 2` @J`2`@В 0!L  @ `@* ` .`L `  `@@ L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@c . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   3`" `@@z 2`@J`"N``@   @ 0L@  5І@  `  4*`P( 5І@  `  4*`P(*`: 㿐 &  ]&/// & &㿘 ` `8` 5 В `   * : Ւ0@V`   `4, "`4㿐 &  ^  ]&////ː& &㿘     .  `y!|*` € $" r&  "@(`Ԕ  "@  @F" "@  @= $@ 0M "@ "@  "@'"@ܔ  @ $@Ӕ ` @ 0% "@ܖ "@0@~0@t0@  "" " " 㿘  " 4  $4 @ד,  "E" @ ; " $@,    :`  @$@ @m "   -  < Ő, % $*@,`,`$`$`  @İ`" @ī`"` `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@ `  @&` 2 `` "&` @&`  0"?@&`  &8    ` "     `&8   `  "     㿘  '`8? @  Ò `4 &`4,@ @ 2  ɔ 2,@  $ @ $ @㿘  @c@ .` *  @ǻ. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@ٕ* "@    (@> "@㿘   @.` 2&  0& 㿘 &`  @*` &`  &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@֐  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@G  " @A  " <@; < @5@3 4"'@Y (  4 #@ΒcP^ @N! c 4 cP@#0Ob 3#b& & & & & $@$` $` $`@$`@(`'H 'L'P'T'X'\@ !@0H !,`€ $@$`@ $`@`@& `&@& b 4 #@|cP, `@@ǐ@Ő b  @K#p  3  4"'@t%!?% c/Z @)  3 #4 p   @ #@`W  @K#㿘` $  !㿀@( $` @x`   @^$ @o   & &   & '@b$ & &  & @\ `$`@2`8  $`''``@B  @/N @1 ''  €@/= "  @$`$`@&$ '@/-``@㿘 $@   @@ $  @@㿀 $`!@ @  @ 2  @# @$a  `@$Ƅ X`ԁ@$< X`ԁ@$  X`ԁ@㿘 @IU 㿘&@&&f  @*&"*? &&  㿘 3 3`#"Į 'D@[ = ?$@ 5 31 7 3 `"  " &N@ :#& ? ` @t 2 @܀ a-` `! 3#`" N@ : #  3 "#"#N@ ? :"` :0^ ?` c "" cD*``"%Đ `:`c"`5` 3#`" N@ : #XS  3 "#"#İ ??%N@Ā`: İ??% 3#`  3N@ : #0 3"#  ?2'@ `2   "@㿘a! 3#؀?  @#@ $##؀ *`:  + -"`*`:  + - 3 3#Ĥ`)c %"$"c`""' 3? 3 3"c"" J`Ā!%" 3 c #($! 3#cԨ#Ē"@ " $ 3#Ѐ$Đ?%#$c6?*@$J -  J 0 3@, - * 3 #(` $İ * @  %b$Ā`# 3cЀ?! 3#Ԁ #Ԕ?c$#Ē"@ " $cĐ $#Ѐ  3cԀ?2"cJ` "`$J` -J ! 3 # #($̀ $#O##Đ" "@$Đ?%#$#Ԁ)đ* @̀ "%JJ`-`"J`-   $̀`:@ 2 G? #($J  :$̀ -J  -@  -J`"?J` 3Đ $ 3#`  3N : # 3"#r ?6 W25`J` ;1`J`!Đ $ 3# c( $N : #0֒ W 3"#N`:L ?J :* @$̒ޘ  c($<`J@ : J`3Đ 0$%bJ "J`"%b :Đ $ 3# c( $N : #0 3"#N`:  ?  :* @%b #(`$$ā㿘  _ 㿘U 㿘K $ X`ԁ@$t X`ԁ@$ X`ԁ@$$ X`ԁ@$P X`ԁ@$ X`ԁ@$ X`ԁ@$3 X`ԁ@㿘 @%e? /"@㿘N0k N x XfN  a? 5`А   `D U .@N H E  # 5' ) + `В @ ` D 4`В @ `   4#*@ R` @R"`(@0 X`p@ a  .@* .@ݴ`.@ N ŀ 2\[?ǀ 5`А   ` `%  % 5' ) +  #В @ `   @"` , 0 X`@ r*  Nް  .@`/.N В @ `  Ϡ 0q?/EN @? 5`А   ` 4@3N  % % 5`А   ` `  @"`  ,`    0X@N N* @ ܰ .` 0)@'&@ `       `  &@* @ & * @ &@*  .@`@ ` @$$ @$  ("?㿘 4 `@#@㿘 4 `Д@ #@$R X`ԁ@$Z X`ԁ@㿈`  `@''''Ð㿘:? A ? !?` H!`  ! D ?" Ȓ  Ő’  $ ] 㿘q bm `9 1 *$㿘 3#܁ 3 ܂${ X`ԁ@㿘*`$ #   А :`aX@ 2  .2 N .2 *`  ` 4"eb'd"!@ '''Ā  ""  4  ? c# '̀' d c@g#@ cd@Ԁ `d  Ԑ @,%Ԑ @'"##b\"""b\ $ @i@* =2 @i9* 62 @i2* /2 t.r 2q3 0 #ؐ@gX$  cd@ Ԥ%@ߐ Ԑ @'@ِ #"  @ Ԑ@'%&#ؐ@g)$ &ê` "`@c #@  @'Đ' @p  @p@o a` %@w :`07`0@o"Ā  Ԓa( %7c@fݘ#@ &t`Ԁ  m` %#%?]`@TԲ @U'@nԀ   a(Ԑ %@w1J @2 @ ` 䀢  ?#@  Ԑ @!%Ԑ @'  " c '`"䀧@ Ȑ  'x'@ @?Ԥ'Ժ``" ̒ '̀`c@fS#@ cd@Ԁ 2   3 %'@ ad  b\@  @ c#@ 8 @Ԑ@%' @c @d#b d"b   4b  @D !㿘ebd !@ɐ"@g ?2 @G 0@ @   @ 0@ 㿈ebd!Ȗ @"@g ?`@$&` ?     d@!H""  /" "" " @} . 2N@_ 2 N?  5`А   ` I-N? ."DN#@l” D!#@[!$"b\& b\"& " $!@' @d"" J?  5`А   `  .2 NJ ?J .N?  5`А   `Dd "b   @  : 2NN :2HN $N? .@#@l] !#!@!$""\'#& "\##& d" l#`J?  5`А   `D 2 + :  : . J 逢?J .! @ O   a@  L 9 L f"( y b %2#`2 @,@@  @^%@ ۖ@@ `2L ̀ fx 4"eb'd!Ȗ @j"@f ?@`? ?@ ?@d "b ߰ (`%      ?#@"             0 @ / @ "d?"  耦/a    $ #\@" -  7d? %2@  @ "t&  a@ܔ%a @֔ O   a@Δ  M Z +b\M f"F y b D2B2?@:@@ 5  @\@   @#@#& & @%b\ %`@@B  & & d"" @   4M  f 4"  @A!㿘! 3#   "@nb$#@n 3"#㿘! 3#  3#䀢`@1 $#㿐ebd "@8!Ȩ 3#` +d  "@nb $ ?@n6  %b  J?` 2'#!#@], N #ߐ@ # 2,  @pb  , @jV   @jOc  @c@ '  ' "    `@c"b\b\# # # "LL "  " ""`&" @o "&$@,  "!$@L  `*`:    @$@`@o " $@,  "$@L  $@ @$'"@U%b "㿘 0 @jے   ,   @jǒ 2 㿘"" "      @ 㿘bc  " " " \#b  Ȣ " /Ta  @o$b Z ,%@h L   L "  " b @o   bL " , b  %b@ #@$@`ð $bL  #*`:    @$@`@nՒ  b,  bL  b b$@% p 4b ""'`  @j 2 *    (#\ @S #bT bT@$bT@V b8@x)܀ LbT d "b "  @?"H㿐@6   "` "@j ! !"X "X@k@$"X bX@w `"X d "b 㿐@?  .@?` .@`.@`@2 㿘  % !   & &   @ && @ $&@@$@ `&@ 2@㿘"" " Pebd "@!Ƞ 5 ahal ad @,`@ah @al   `@   2`  0* P@ &ђ ?  +`+`@RR@ 22""蚄?" JJ@ `2J  㿘@<  " @ْ ( `& & $`& $@$$@@ o  bh@s e?48 `.  @ Q@a O`D&`6`8&` $@ * 2``6`:6`:`&` &`%   פ@h@1 &"  2 : $ "p C &  $ & $@0@ "@2@ @  @ 㿘`(`D&`$ @@$ / @2`L`  `@@ &`( `0&`&`& 㿘  ` @Ԡ T 8 6 @ΐ $ ?   " @  @@ @ #@[@V"㿘 $@8 `> `4`>@ +4`:`'`:* 2  !@ * 2``94`:$  "p   $` @ 4`:$``< "4`<*2  Y`"  <$ @ 0 @" < "  " @t$ 4 :` *$$@e $  @Ĕ? "#@ <`4 <$ `"\$` $```2`@   $$@ D$``R@ T`8 2`>$  o $ $ 〢 2$`@I * 2``4`:$   "p   $` @ $`4`:`< 4`< 4`>` $  J /@  /*@`(`@c`DS$@ T`8?2 @@["$F `$* T`82 `<$ 25`)  $ ` @; ` @6"$ $$$` `2`` x@? $ $$$`   4`:$㿘 6`>@   "㿘` @@  G"@" $@2?  :  9 27   "@_@2  $& $ T 8   J`/ $ @&  "p ? @& ӂ 2 \  㿈 @'H  HH`X  @5 :%  2 $ `  ?`  4 ''쀥'H 2 '@@g  H2 <@y%  <' @r5 <'@  ' $ J?`/  $B  / * U 8"@ '    2 `L` .2 `L` ?` ` `@`   `@ )@ `@ " @* @|@@: 5 : $ @& $"ɰ "   $  '@ "4 8$  ` $ $   4 :$ 4 : 6$  쀢 " $ `  "  $ $  D $ #4 : $    ($ @Ւ D D$ @  4 :* 2  *`2  $ &```@9^ 2c $`@Ő耢@Q $   2-- $H29 U 8 2   $ M     x@a?  5 : $@]& $2 H   5 :@@@} 5 : $ @]& $ ?C" @x( $ `@ `@80 "* @;b` 2&`@2 T"Y " @)&`  > h>> > > > > (> 0> 8> @> H> P> X> `9 < @ ((&`0 &`, N`D`.&`4N`E  ?`Dc  2`  `2``0"&@`R`8 6`,  @  @    㿘 ( *@$  2 $   "$ @$ $   "    @A  `"`" 㿘`$ H@'   @`$ ``6 >& & ( M ?& @@ D㿘@  㿘 a   @@m&  ?"  @&  2 &   "& @&     D" "  2 D""  P86㿘   @38   ( $ .    "? ?`0@`,@@? "м@@"㿘! 4" "@6 $? && @1@@/ " @) $" @% $@!m㿘@ (7 ?"@ ̔ <   O@  -" Ğ ?$@$ 8  (& & ("` "  @<"` В? *  @&   & && & & & $@6& @Ԑ  㿘  `@ `= Ò3%``@$@#6 $"    ,*  @$@ ֘ Т06```(q{6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **ƒ-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =&%``@$@#6 $"    ,*  @$@ ֘ Т0a$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  Ė%X   ` $  @@ @(: <  (  >(` :`@?? D8 >` > >> `` "`@|`  @v㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @[@T?@J kby@9@2?@& 2 8@@ ? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   5`Ј#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘 @ N * @j   ) 5 @ N@" `   `2  `      ,  `        `0 "  @(? `" В `@ `  ``_` В @ `  2 _` `$ В `@ `  `_{ В @ `  {_  {  @є2  @ @Ě]`& ` `㿘  0@ N * @  ) 5 @ N@ `   `2  `      ,  `        `0 "  @m? `" В `@ `  ``_` В @ `  2 _` `$ В `@ `  `_{ В @ `  {_  {  @2 2 @ @^`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@; #7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(`X   ` $  @@ @: <     >(` :`@?? D8 >` > >> `` "`@` "`$@`$@° 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @{@t?@j kby@Y@R?@F 2 8@0@)? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   5`Ј#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘  ,@ 0 ( N` @)  , @ `@+ 5 @ N@`@. " `   `2  `      ,  `        `0 "  @O ?  `"`В `@ `  ``_``В @ `  2 _` `$`В `@ `   `_?{ `В @ `  ?{_  ?{  @ L @ `@`@@ߘL& L  `㿘  4@ 0 ( N` @K  , @ + 5 @ N@ `   `2  `      ,  `        `0 "  @~ ?  `"`В `@ `  ``_``В @ `  2 _` `$`В `@ `   `_?{ `В @ `  ?{_  ?{  @& L 2`@’ @ `@<`@7@L㿘>!`+@ @( "v`M) PV~ўȄ@ d ƞ@"y@@o@耠5$@  i"@&("`8@2@ ``2@| {@v `2v@o 2p@i 4j@c `(`` ` Y@T   @ @. @@O@ I/@("F#A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  M ֒$1 X`ԁ@ c#''@7 y @P!' # 1 9 ; ! جЪȴl'   * ` *J`|`:2 *@Ē`@Ē @є : X $XĔ@ ?"$(@`  $0@  ($,@ 0$4@  3@c 4Ē 0@? 4 8@?20@,$8 @@?2438$< H@r?.4H P@h? 4J X@^? 4L `@T? 4N h@J? $P p@@? $T x@6?$ @,? $ @mʐ   @mŐ  @m   @m @m   <4r ` a/////@?H&|Ģ &@|Ġ & @x?2x @t t  @ 0?, @ ,. . Ē@Ɣp? s  . Ē@Ҕ  4@2`(. *`:  p  , : ? 4@mK   0Ĕ/@? l*`$:  4   aW$@=$㿘@  @@Q "&@`@ 2@ 5 В `  ?   >    #@Xs  , ,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,, 4 㿘 1!@ "@&!@"!< @y!`@$!<` "!@!<"!D @ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ x 4"'X\'DX 'H'T' ?X #a@ @T !!<@$ g!<a@@!<' Ĭ@z$ X       A' $@pٔ #/ 4 `+   u4 #T@K찒 ` @@@@A @K @ H"D!" " c '`+M@  `(8,L \24,, %$@ $@Ր 0ڤ@*M@@#V$ 4Ϩ   ζ? , L " #"T@ 2ݦ`@( 2զ   U  @`??w  ?L: ,?#\$ ?  @f 4" ?2 :,??J %L  : $ " ''L?`: :, '"@  %$@$&@ '@. v@&01@$ @@@? a = X $S$H"@ې 2@@ "? 4@? 4D#@  4"  @$ ȁ㿈@''`?''  ? J ? ?  &@J `?J@ J JJ|:? ?J:|?  㿘@@㿘1!H "@oU&!H"!P"aD"L 㷀 4"P' ""PaH  P @Q`Ѐ %!H0.װ % -@` D !H"DP !H@QA젒 !H` @@o P%!H`%P`  @Q`Ѐ %!H?*?쀢`2L"!L?  5`А   `  *:  : #!L  J?`\2#!L#!LJ?`\2"L"L + !H@P젒 !H` @@n P%!H`%P*?`@s'L :2$@`' $@$" @쀤բ@ ,@ `@X'@- #\?;    +  @#Ɛ 㿘 = ?@Đ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ "*` € * ? *? *? *? *? * ? :*???*?  2N"@ `d 2  -?@&)? dN :  ^ \ N`:`2 *" ?"@ 2  ?@?&㿘I = <?@! d 2L5? d  `"@@ d 2 `#?@ؐ?@ dL : 2*@*@`"@?"@@ 2 `?@?&㿘 # 2N@2? 0  `N@ x X `    `@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@h|.`.`   (8 J2J " c"@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  㿐 '`v$O X`ԁ@$ X`ԁ@ B X`ԁ@"` 㿐N@ ="`@:@ "o @/*/@* ,`` a c Ц`%  2 д$>T@:*` #TЀ .@$'$T@" L'cL  =2 $@n  Г*`" (?`*`Б* : , *`: ,   =2 =,@ *`,   @* ,``  㿐c Г*`  "  "@ $` X`ԁ@$# X`ԁ@ ` (  *88 " ("  ($ X`ԁ@" ( $ X`ԁ@㿘 @? @KH㿘  @K@  $$h X`ԁ@ ? π  ) " " ""@ ?㿘 `2B?=?$ &$@"?  @$@@&@` `@$` ?$&@͒$@: &?, 㿘 `5 2 $` %$@Ԑ? @ @@͐$@@@ɒ@$ $@%@$@: %?-`㿘  )2,? ?π 8'?"  `*``*?@    @Q ?@ &@@: &@@E ? ?㿘  )26? ?π 81?,  `*``*&?@    @  2@?&@  &@@:&@@   *&@?     8 㿘` ` . . .  @ `2 ? `2`?*  㿘 #    ```4?@1?@ @$``?` @,@`   ,@?`.@` @@.@`.@\`"㿘   &?` *`  * *@ 㿘@4@㿘`,`2*?@!@`  0  H "'@ A   .'  '@&* '@?㿘`$` ?0 '  '@&@@`:'@ " '@ "  '@?㿘@Ӕ@" $ $% X`ԁ@㿈'HN@ r'D wHJ` !  "@ '  Ґ耢  4@f 0~"` 4@] ` 4C" 4"` 4@N  @Fx!X  H R` 2 HJ@ r耦 " ے y  u耢 " ϒ m   D a@ ! ` 4@ HJ@ r@}S0@wHM" "`3 4b  4@ X""Xb  4@ 㿐 4"` 4@ې !X   2  `b  4@ǐ $?"X"@b  4@ @h @” ?V`" @??`\````㿀 4"P 'P'T'X''L   +  ?#`L "@  "` + "@c "  @T!x 4"P 'P'T'X''L   +  ?#`L "@  "` + "@"  @ !㿀 4"P 'P'T'X''L   +  ?#`L "@  "` + "@@"  @! 㿘c Вm?p 4"'  N @b / L' !(@  !0@V  ?#` 'A @bf   !x@>@;$  !a  '''''' = D @] /,`@V,c Т`=@Ð *` € @  **@`2*  ?#`) a$`* @)$  `А!ޒ  ap@ Ԩ 2M  ` "  @3!?  J H 2* #2HJ㿘  㿘 4'H'L'P'T'X"@hH㿘@b `@d @b` @b{`  '`aؒ` @    㿘@@b , ?@ 28  @   % @  &@ 4 #@g3a @  @ @ @o@&@㿘 :     @ Ŕ "2 J "2 J   "2 J  J 㿘'H'L'P'T'X@H㿘! 4   a@f#  @g# a@f#@W #@fa 4(P㿘 ( p? "6?@b @2 P (    ? 2 0     0@ :f   < :@ f  "  :@ F㿘 $  X`ԁ@$ X`ԁ@  4"' L@ /2.. L` Ϡ`@`U$ @ϒ$  `@`H$ @@`>$ 0 " > ?" /5 @` / @$@#@b$-``@J?`/#,.O j@` e @`` 2 \*? /@ * T"@@V4$  `2L `G < ( 8  # &5 ,O /.    *? /@P * "@`L`/`#x,,@U$#o@_$rJ /"*"  @ 㿘   ` /  " $@$  @?@s  J " $ X`ԁ@$  X`ԁ@㿘'L'P'T'X@ L,-D,,-D,,,,,,,,,,-D-D-D-D-D-D-D-D-D-D-D,-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D,*d+*d++)********4*4+++++++*L*L*L*L*L*L+++++++++++++++++*++++++++*L*L*L*L*L*L+++++++++++++++++*&@&(L),D.4%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@#X%@%@%@%@#%@%@%@%@%@$$$$$$$$$$%@%@%@%@%@%@%@%@%@%@%p$T%@$T%@%@%@%@#%@%@$,%@%@%@%@%@%@%@%@$L%@%@$d%@%@%@%@%@%@%@$%t$T$T$T#$ #%@#%@$$0$#%@$\#$@%@%@$L%@$ 4"' 0 ``  ?"   @ `? 5 В `  " %! 5  & &  4@cY 2@  А@  ` 2 @2   @ z`Ȑ ,  €  4@c3 2 @` ?& & d`ޢ`@ h2ڢ``ע`@ l2Ӣ``Т`΢a̢`@,* ƦР V ` hQ  Mh J H @bA b>   @ h7 d2n@``f*``22`@2a2 ``= M:J"? 5 В `   `    b@b #b % 5 ? &  &@b 2 А@  ` 2  8@Ȑ ,  €" d  @@bq& @$`@$& &@ @ Ө"?d/ J #  ?& &   4 @b:  "0 L@`  ?& &  @  4 @b 0 L@`  ?&  ,&",'"?d# # 5  & &`4@a 2o `А@  ` " `?&  ,&  4@a $  5 В `  " $5,8!T@Y ?Հ`MSǐ"ԓ*` €`@ @ @@T/,@ 4 -`4R (,@  4 -`R `` 34,@@+,@@  @$@ꀤ@ ,@ , ? &  &@aO 2@ (ư @ x Xd@גd$h,@ @ `   `2``@:2a2`2``2z*v"8!t@8 ?Հ`:2ǐ!*` €,@@"',@ @ $ ,@P @@ `,@ , ? &  &@`Đ 2@@@ (8 @T/ e E@F @Ad$,@qb `2`":"$ ?  @S  @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘 2 * $% &&@@@@` &$@ @8@ "@&&㿘 5 'H   ` `2 -+L  L0 L x XL )0  ) #?)  >{r y   $ `%E    # 5I "m B  @ @  ?"1 + |><@ !b @ @  1"?# ?|<@ B   `В @ `  `В @ `  `В @ `  H  H"@㿘 5 и   ` `2 -+M  M0 M x XM 0  >?{ݒ? ?|?   ( O !@ @  :? ""? ?{~<@ B    5`А   ` `ͦ 5`А   ` ` 5`А   ` `  `  '㿘 0 @2@n$ #$ 0" 0"`  ,< & ,`@  @` 0&"@ 0 " ?㿘?:d"`2`0@!C`0   `"` a ?"a` 2`0  " ` @z H?` &` ?6` &``  6` `0@  `` & @ "@/?&@*` '&`` ` ?߀6` @@ (` 2 `` &`&@``@@&`<`0&`8"`0 "``B &`&@.`B$| X`ԁ@㿐1 #7 :5:;3 &P(&`T&"!'`H#L  .( > @?* (؆ (@ (   (. @?*? (X (x  .@/@.?$ hx  .@/@.7$ శ ./$   , ؐ'"؞غ,ؔ  , "''@#   #X@4("('@4(@'@(#ײ`` ʐ  x62؆؞ .* ؆ت  )! "@  @   P P(@'@('$"   " %@ @  `T`T(@'@('` 􀤠O  ( .$  ( ( ( . '   (@&@$ . $(  4 L L H     2*`0"H㿘 4!`2 u  3:a؀.:܀.!ؓ6  a"*a b6  $ d6 . @ *& 5@ *`( h5 f * 5j a, @ l2 !-@6 ؖ n.a @@ !@aX:@"!ܶa&a؈ @     < ` @16@%1 )22 0@ (@@ !#2@ 17@  2! 17*#3 !3`18  @!3 14!3` 8 !ؐ 4 3`15 ! @9@!ؐ  `5+`9  @ @$@ $$$   㿐'L`'P ؆' 'X'' 9 7!ض؇3$3@3.`#( ., ;1 @(31  @5@ @1 @   . @ @ @@cHجت#)>' ~!~     6 . ( 0 .`@.  @6  / 00@@ @@/6 ?1!6` (o ..؄3 . a@`? ط4`4` c `+  4`, 4 * 4  #4c %/ L" ؄  @   @P  㿈 4!`  / / / / / / //''.@.`.`.`.`.`.`.`㿈N@ $ 4N` 1@@ !`2Z * *  " (ϐ 2 N@ _k@   N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ*    N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ* @ % ]  N  *` *"  N p 2 N ! @Tr!`@1!`!`9 N` z  `?ŀ Z  @ ?ˀ 9 -  ?ґ+ :  z `?ŀ Z  @?ˀ 9 -4?*!`*`N`!``@ `  +``  耢 B  4 3  3 .@ ? 3 `.@ `? 3 `.@ ? `.@`*  3  ? 3 .@ `? `3 .@ ? `.@ ? `.@`*3 ? 3 .@ `? `.@ ? `.@.`!` 㿘.`6`I ЈN N @6 3 0(0.++N `! `<0(.7`N  `(.7` 㿘 2 a $. .  P . .@X= . @6㿀 4"'  ':,`2  `@`*`,2  2    8  `ǔ "`  @  X 4"' `h@ `N@ 2& 4N``$``a2 4` `N` $ 4@5j   *  4`@* @2`  4!h /@Ր  `  ?#@ @v @ ` ?@ `@   ?#h#f 7  @^,   $@ ?#h# @9   ??#h   * 2 " *2 " *2 " *:! $ 2. . .  .  P @W[ @& @a @ !?#H @=  #x? #h? #p??????  @  *2@ @-  @0 @(*`@ @2 @ (*`@   * @2 @ ?* @*`@ ڔ*㿘&0@2 2 c@2 . #d((33c@3. #d(( 2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( $33c@3. #d(( (2 2 c@2 . #d(( ,33c@3. #d(( 02 2 c@2 . #d(( 433c@3. #d(( 82 2 c@2 . #d(( <333. #c($@ hD@&@&㿘&0D@2 2 c@2 . #d((@33c@3. #d(( <2 2 c@2 . #d(( 833c@3. #d(( 42 2 c@2 . #d(( 033c@3. #d(( ,2 2 c@2 . #d(( (33c@3. #d(( $2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( 333. #c($@ h&@&㿘 `@ؔH*`2`  *0 : *0@`( ` 2㿈.7 6ܐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' r'k', 2`*`& `**`2 &  6 ,  2  J'C'{, 2   * *`+`&@2& ߠ / 2  ֠㿘.56㿘.6  `O *`2 `  㿘.6  ` *`2 `  㿐 3``*``*@(`@ `*`+``+ @ @  '' 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 3``*``*@(`@ `*`+``+ @ @  ''7 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 ?  @  . ( *`*@ *@ @ '** +   '..􀢀2 . ...2 . `. ƴ㿐 A*`*@ *@ @ '** +   '?..2 .  ...2 . . @  . (  Ŵ *`*@ *@ @ '** +   'x ..2 . ...2 . `. @  . (   4p `? 2`*  4"# 4!:a'@$""a@1w @@$:"#0/:5 ):" @  $" @*`@" @Ő@@@@@ߐ@@@@@ߐ@F@   @В?    ??@  @ < @ <    x@Qf‒@ @  @h@@ @S  @@J   `@M@`@}  @?@u@ܒ #@2+ *    %" + "*   %" + "*   %" + "*   %" + "*   %""  %"" `%"*` ?耢 ? @J H;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `@@9 @r &@ @l`@?@ @$㿈 4b'`2*@`*2*2222 ///////*2@ `? @" /@ 4a  4"  @А 㿘Ɛ   . . 2 .  .   >`P>@>`>`>`>` >`(>`0>`8>`@>`HX< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%$ X`ԁ@%# X`ԁ@㿘`  ,    ` 2 `@"#   ` @*` @y.  2` ?, "`` "` @ `  "`"`"` "` 㿘! 4" @} $" @} $㿐`+ `@&.`@"` @ @2@@ @@ :   @& &  @ @ `2 㿘&@  @6&   2   @|  &  &?  @ 2?  "   ?& @ `2&@2 &@ 㿐! 4" @| $Ô "`"@| $㿐! 4" @| $   " @| $-` `@{ " @|u $ "&& $ X`ԁ@%0 X`ԁ@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘@`@ @(Π` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `   l,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘 :  @ #  @h    @ :, @ 4! .",   @ ` :  , ,  , @ 뀤,#㿘@f l 㿈# 4b b  % ?'  @zܚ ?쀢  , ,b , , 8 4" '?''Ė  '''''a @z ?' @w$ @2 @' ''' x # k J ? * ``J ? * ``㿘:#P  4 4"8b<"b<"@E "ؔbؠ ?*` # cP  cP?@"(b 4E"<bؖ *` *     *` #@ cP`  cPE"ب '  _L@@E5@ ",@  &L@cP @bE"ب `' @y @E=ሀ 2,`   ?ւc0 4"'L' #S  N : /@D / 2  a@ q 2  N /@D .   2N !Ȁ "g?N :" N /`?`% !؀"X?@y@y # $@DƐ a$@;$@; @D . 2 `&  22?lܒ ?)?֤#H? ۀ ?&`&`##@# &@ &`ސ$&`ې(@&` 2,` !?` $4?``24?@`2?$ٰ?&`$%`, @*``  @ V @&°? @6(`` $$``@  @6`"ؔ@ *` \``@& ` @6` o$  H$  `C$ ` @?``@ `  @6 /@ *` `@ /@ @6` !@ ?$J$7$ @`@ ` @`" "` L "` C?``@` @6`" "`L "`.?``@`` ?@6O``,`+ @ @ B @&`O $% @ ?֐# *@`@&  L-  L ?֐#O` J 2`` !4`!?* ؒ @ 2` `2`  ` @ 24`? h  @ "@`?   @   #@ `` +  `@ &` ?    @ ``?* @@ @ `@  ,``*` @ $`@ 6&``4"`? ?bؔ @  `,`@*# ` ``@( ` @ &`,``?+ `@ *`㈒@ "@d hlp@  t"`"`"`"` +   * &`@"x| "   " " " &``&` 9&` @6`"ئ@` @9@ " `,` `   ``@& `? "ؤ@`` @   ,``*` p  <`  4"  !㿘  `5  @1/.`+ .@* *`@      @  @ @   @   @BX`? JJ Ѐ ,-+2 JJ 2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *@" * @&@N :   < 2@  &@㿘N -   + ’   @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` w  "$ N . `      &@` !ma 2N  / v` &`㿘 `  d 2  ! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ "*`@ * @*`" *" *   Ȓ    &@ dߐ d,`@*`@*`Ғ  :@``: @.`"@  &`@ ,  + - @* *`     &+  * "*"@ *` `  @u|!'N <  >L >2r?$ l$L 2ђĠ "b? "h 2&@L / < ` >L >2K?$ E$L  , ;  2L5?Đ1'L 2L` "xL , ;y  ࠒ "?L , Ƞ "?L 2?Ą# &@# &@# &@  #&`#&@#&@&@"ت@ ` &`';  ĔȀ$ $$.$..$.`b` &``  d 2  ! ,  , *@ *`" *" * @ ` $`&` 2?  `@"ؐ@ * ㌕* @ @ `㈐@ #bؚ #@ @ @ @@6  * * ``  @9 "؆@@ @@ @ ` * *  `( @ `2*   2""@#* * ` ``@ؘ # &@ #### &@ # &@&@&@ &@&`# &@ # &`#&@&@  &`&` &` ` "8? #@@??@@?8 㿘! !8  !8j 㿘Rb ?"b!: #P  #P㿘!R@t"@t"㿘 @sJ" #Rڞb R!@? :@s!@ $bR!@>!L 2#::#P" ##P"" E "ؒa8""@>Ӕ"0cP  L :cP cP<㿘!R@s"@s"㿐:#P ' d* @ ^ @'" ?* " }b!xa}_aX *@ *`@ *`*` *  *  *  * "@*`"@  *` " ' ?*  ` Y   ,`@*`* ,`@*`* F&@ # # 4 *``@ # 4  : *@ 6 & "ؒ? *` #, @  &  c  b<*"@ &(㿘!R@r"@ @r"㿘:Rb#H ,@rݖ " 㿘#R@r͐bRb !F "b"h@rĐb"h@>` 4"8Q!&(㿘 ޔ㿘:Rb#L ,@r " 㿘RƔ㿘  < |n d&|j!88㿐 D  !! * 2.  4  *     *   @2   @   ?   @ɑ*''Ta|,`@*`" *" * &$|!n ` ?'@# ?$" * *  *  $@$@'` "`   d 2  ! . .@ 6Đ,`@*`" *" * ' %T"DB'{,`@*`" *" * $&@ T! ?"   @? Q`  j d 2  d! ,` ,`   "`  R d 2  L! ,` ,`& @  2u  8 d 2  2! ,` ,`@ Ӥ`&@l8 V &ʐ?ǐ'xN  "@@ &   & &{%.&.{ <& <&`   d 2  ! ,  ,  * b &*``*`&& 6& &$& 㿘&@sh@d "  2` "  2`㿘@ &8zz8x@"&@㿘@ &8zz8xڐ@"&@`` ` ` `@ ('P&@ `'H`'L'` '`'`'`'`'` '`$'`('' ' < o?В < g?  `?ܐ' W?j'l Q?Ԁ )!n% _? 9؀   `   d 2  ! ,  , @@ `'Ԁ!n(' ؀   `  ڒ d 2  Ԓ! ,  , $@ 'Ԑ  Ԁ!nݢ' "@ 'Ԁ  ''ؐ  ?ؤ*    d 2  ! ,  , * @Ԁ@ؐ8 ̰?Ȁ`;'''l'4'ʒ?ŀ ?' ;'''Ȣ  ?,` $cK8@F:#P"h`? , c* @c@@  耢@2-`? (/ * @耢@@ " 'LH  Ȁ 2耢@츇?전?Ϩ?]?4`4 @ :`: @@''@4'LH  ? ``&' @?'@`$耢` xH  @' 2"' ?LH P "@㿘e  [ 㷐  'L & L`"  &&  $@F:#P"h 6 *" *?  "ؘ  * `2" - #@ <  6J?#-@*@ * 28 64# #,@ *` * @ @-`?"@  && Lt`2 "@  " `?&& ؕ,-?㿘!R@nX"Y e`$@nP"㿘?" 㿘& cR 㿘& cI:P P *` 㿘j'DDD&㿐a'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  p 4  b' " *"@ `   "*`"@  @(@m  " #  #h #\#` #d @=i?d  W"  Ր#H㿘 㿘RRb# H@m  H 㿘N@ `@mCN    2N@ 2N?㿈/ / * @*`"* "@*` @g '<   ?" "? 0" RcR```` `(`0`8`@8@8`8`8`8` 8`(8`08`88`@`H8`H`P8`P `0!`0" `0     !'@l'`X?ֈ!㿘d"` 4@Z 4#`   V  X 2 $  ?6 6 && & & & & & D& H 0" 0"` 0` ` @l!㿘@A  4` " ``  ` "@` 2`[ $㿘H@Y!㿘R#hT 0a@ $@$$     @lU!`X!@X#ؒ d""8 '  5     m   _ 4 d W 0^ ` j  0v   "z'k k s 0m h k y 0R  e l   l a a f 07 ^ 5 7 0"$ g  d 6b'O $0"+1'!\!r 0''t耢 ?8 '  ty耢 |?z  (  $ !n l!'^'     'U'  'O'ܐ         $?ؐؒ  @j6 ? @>?  =?.    ?'ؒ  @j ?*?@X*V:!   0?'ؒ  @j ?0h?  " ؔ @i ??,h@TX\@e֐    4 cX@&`,ހ   "5``"`IxK x"@|'p"`'t@?pp@'ht@'l@?hhl'` 'd&`&`,o \ @`\'\ s`  ̯`"@  ̦`#"s`̠ &`,L&`0(k``X``@ 2e`@. @.S .@.`,`, XD@ `€   &`,&`0  %@@-ג`,D@  @  X'X @.''&`,`, 4"  Đ#x ,"@0"`4"`㿘  " 8 8@% `("$"($"(""" "  "" """   㿘   " <r < `@ 8@dN@dLҐ҈ҀҐ҈th\뀝8  ????' $ $ $ $ $ $ $ `?"V  2z? 2v? 2r? 2n??h? "   "]?$$  $ $ $ $ $ $$ !  `  2`"    "/? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $  '  '  ' ' ' ' '  `n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   n2m?  g? V $$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @+`` `` `     2 `?&   "&@ &㿐ebd !@g"@  q @ ?  `@2u @Tn O  `@2f X@gY#؀`* J@ %J@ f" y b  2 @ @@  `J@ ဢ f@g.؀`@M `  & d" ` !*` €???`@x& '   ɷ`+ pT@ 2# @n  "  "``@ѐ $  ? @  & @I` 4"'&'ܦ@ܒ G @< @ @ 0@`,?@ $#?@  @r   ` ` ܰ &܀ "@"  륐 㿐@ 2E @  2 > @1V %   .@ $'?@aX#?,@t   2 @Ĕ?&`2@a5㿘   @}&` ? 㿘`@`Q &  $  $ $  $  $   $ `$  @e$ `  *`@$  $ *  ` `@e:0 㿘@ h`"Z    2T         H?F?D??   #@/̀ `*3?l`""-? " '?       ؔ  ??ТА'@V?@2     2  2          㿐N 2`%??@?  ?@?@ ?@@ ?@ &    ?@&? ?b 4"? 'D#T"  ? 'L'T'? Ⱥ?  ? `  ``  4 D?`?D? cPc#؄ؚ@#@  d ?TD@ +#@   d `@``@d  du 'L ?#L" L?cT@@@ F?/??P?T"D @  C  ">@@ * 2 `@ * `4 @ * 2 ` @  ```3@`'`?cT@D@@ $ ؀ " @dDؠ @ @/vے @`0`/`@*耢 x?' |'' ' ' ㌐ ?'  c ' @ @t@q#\ L8@ %~@``@ \'`' d' h' l ' ?#X??'  p '  %@X@`` 2R@`` 2L@`?@cR ` ?䀢  cL?#@6?cL@@`T@c TT` 'T''' ' ?#'?'c'   '?cD ?@*  &@      2 @_ ?L?L"   ?#T@ ??cL@@`  ?#LZT?#ST?#d  d"b   4  蕐!x8  ??????????''@]@  d@]@ 2 `@^Sd?"b T     0! 0@ '''''''' '@''' @?''Ȑ@U @^#@^!% Ā   $ `     2$ @]@]?ch 4"'?#@S 2 Mz c@M ? # a@А   ,@Ȓa ?, ް L  *`:     "@ , @  ? ?L  ?`#`#` #`#`#`#`#'''' ' #' #' '   K ? #@$@`G ?  2@?#b  犐!x  !@a    ????  $ ` ` L  @2P  ? ???)  @- `*@ !@ 2*@`^\ `J@*:    `"  @! " `*@``"`J@  @` `'` '`'`'`'` ''' 2' @&@`  2@   $` ` PX#  #?`??? @ܐ XZ X#ܢ`#@\ ` $c܀ .' @aP# a@# !' ` @'` '`'`'`'`c?E'   $ ` ` @a$#Дc@ 2c)   $ `` 㿈ebd!Ȗ @a8"@[w@ d?"b k?@ F   dT"" `;?#`)@ $`` ` ` #\#`@ #d  @@ 4@ѐ   2   2   @&`@`2``"- €d  d d d "b @[ ? d"b @[ې0@[ؐ㿘ebd !@`"`@ ѐ    d"" g "d "" N J .Jd?`2J J .`? 2 d@ "dJf2  ? @` 4[    2 D 8`7"3D -D@B 4=`=4 "   " `2 ``  2`""`  `" ?@ ?` $  ? $ ?㻈 4"eb'd !@`"@ , `d"" %? @+ $$ ?L .", @/$$d "b ?b  !㻀 4"eb'd !@_ː" &@ߐ dG"" $#d#` #\  @Ú   @$@Q d )"b @p 6d "b ` 2`#`*` €d  d d d "b ?  䦐"㿘ebd !@_f"@}    d""  "d "" N J .Jd?`2J J .`? 2d@ ^pd2  ? @f 4a    2 D ;`:"6D 0D@E 4@`=7 "   " `2 ``  2`""`  `" ?@ ?` $  ? $ ?㷀 4"'@Ӑ `d"" '? @^s?"N .2h@K , #\($@.L$b  㺐" 㻈 4"eb'd "@^v! @2x  @]"0» 2p l @ƒb@ f@  ZJ?` '#O@], L@  @? 5`А   ` "`;,@@  0 5 Т`L@?   ` 2`L@ "`1XJ ? 5`А   ` "*$@) #@- #@ @- "  )"HHeb`dd !@]"@  d"" ?`  @ @p6 @4 *` * $  >*` a ?$ 'F'$@]?2[?$@Ԑ@8 ̰.2 @.2  @  ?4  <$@` @ @  @ @  @x 4  $@` @. , @l2 . @h2  @i /`2 @a ` @Ja4 &㿘ebd"!@]O & @)?  )@@.@?# .@62  . .`@   @& @# `   &6` 㿘.`  .2 .   ,,`6 e%2 ʒ6 , 4 e“6` ,`6  42 " ` ?* @   @( 㿐#@ZaY@Z52c#2  @YY2@Z*2#?c  2!Y 4#a Y2c 7Y5 4- 49Y1 44## x*  `!@Z#퀥`  "X ,,`2   , a4*  2` , 2  K` ,2`f 6`6@V(%  @ZC( # @ ` ? @'#6#㿐  4c!/ Y#@ $YvYc!Ydd#Yca YY#@ *`6#2`4#Y@*`72` 4c t | t    4  4 㿘ebd !@\"dbd$h @\ ",` ` ,`㿘ebd"!@[   6 M I ?#̐ @ @2  @2      ' @[  ""   0?#   @ @2 `"  @2  㻈 4"' %@˜$ $@@x* `4 @s* 2  ` @  "   "  ࡐ"`?㻈 4  " '% #? @$ @@7* `4 @2* 2  ` "  e"xX 4"eb'd'D'H!Ȗ @["D'@4 ?",?  'H"$  '  <''Ā@ '  ' @  `   @? ` *@ 4#`"  ܤDH㠒`"4*` €   )4ݰ?   4# `'  % 4 4#` @ Jc @ܒ   $ $cY"cc܀  4 "cJ@HD ''''cPb H`  7ֲcְ  ֲ@"@*` 7ր '@ 6)Ā`& @'u @K* 2 'ؠ 77@"7րc ր  @^1 "b* &7֑* 2 ""c̒ ֒"@*` 7 @  #` 4 % 4㘀   @ " 㘀 @"ܒ   $  $c *@@  4"# $ 1 4  `# 1 4#  Dcc$܀ # &#D c@HH#   /'7cc |&#"D cHOH  *s@ *@.`"* *  cc#c '7 b  N`c0O L'C"!'аc bЀ <' '@c $ (o c (2 DH c    2   *@o@!` "@    " @`'S  `a 4@Q 4#`  DcܚH`1" *` €   )4'? D"ج  `@'@" Ȁ`? = "? <""? 4"  "㿘! 4#  b:? 4 4 4$#"#""㜁㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@x  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ "? >*@*,2$? $     ? " ?` 5Є `  ` 4*`P 㿘D`4 ` "' 8?, ., \" Ȑ  < ` "&`."  `?*  @ `Ц &*?J .* J." .`.`Ѐ    Ѐ -_2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*` 4(P㿘@ 㺨 4"eb'd !@Vݐ"dbd"$h@VՖ  ''    @ Ā@h 4@   4c  &Ĥ dP?  x2&|@O 4&| &2  E 4 A 4 2 & 2 & 2 "&  5 .6. &@Uѐd<*@ ' &d `&  @!v&`#  2B @U а ;`@!g!N` '&DH" \ "NN` `  .  $  ' N`` 쀢` NN    2 .$@` }' `@!' /b' _@Ui , `@  .O N `@W  ( Oƀ  #a`2>N "  " N 0 .`!@  @ a 2.!'a@*  2@ Oƀ  : @  ƨ N   L y b f*  ,  L y b f *  " Ӱ a@  T Oƀ  Oa`2N "  " N  `!@ y@ m 2.N` &DH \N   . " $   N    N   2 .$ 'a@ 2q Oʀ  2k `h N "  " N f d 0J ? 5`А   ` "*  ?0?8  ?H?@'0'8!(  5@$'$̖$ &$$` 2!$`/``@T9$ @T!$`/``@T* `" " " " `$ "@Ga0@   OȀ   NN "  " N   ;# ! 5 В `@ `  `2N N`" N@` 2NN`;瀢`N.@1 R / h"@     @t 1l.   5`А   `  * N  ; 쀢?*: .@  $@@,@{', $@@,@u',l"@  *` %@ @% @_%  @ Y / @*` "  ####Ƞ@## ̠###.   5`А   `   N  ; 쀢?*: & ./ @4 @Q  ?    4,, *,``  .a@@   Oǀ   aH@l@ `4& d **` &d@#N` @0  @ .  `@!`#`N`  &DH&H  PN  .Nd`2N @y . $ `$   & @R!P  @a` & 4"  ،!h 㿐ebd "@SL!ȢN x#% *`:   N "  " ax@  ' @J NKK? 5`А   ` @ ;+ad* < 1$ad@Z  + a@S   `a@I  `$a@?  ` (a@5  2N` $`N   2 N  0 ???㿘 @ڔ  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` @M@M 㿈  ?'  @P ?? (((D'''㿐@ ?㿈 5 Ъ, : ?   `  0   N x X    5 Б, :  ?   `   Z7,  ?Г:` ":  ?   `D , :  ?*   `  : . 􀤀E $ =? 5`А   ` < $:` `2 !D*` €?#!耢 * #?#耢 쀢`* *`  耢 쀢`*   *` * `2&@ 㿘  0 @ @HF? /"㿐N  / (  !@u " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿀 4"' @P N :   N :"Nx P N   `H ?# !Ȑ@  !@  ",ܮ ) `:`.2I N ː ȑ4, ,    6  @2d  ,bN`   8! 4, , $   ? %@ **  @P   b  !2J@ "J`  2J@          @ ` "  @ @ @`  @ # 2 @ 㿘 @? @$㿐 ^?@=`0@`  `@@"`0@KX `0"`0   `"T` "a"aT` $` $`@KE` 3\@;\ `@Jd  ?@J\`2  `C  $`4` $`$`$@2(" $`4` $@ $` "$` $`$`@<#؁㿘   2 2&   21Z x @ 2& 㿘 #tݔ 㿘 #Ք 㿐fJ h` @     h&@Ԑ h`?㿘f&J h`  h @ !  h  h& 㿈  ?'  @M ?? 㿘`40C "@"&&@Nʔ8,   `a ?"a @0@";0=@9 @2P  @ ? 2 !?  0 :@ d < :@  d  " : @ DE       "2 @7 h ȀdI"@2 T & e~ 2  <   (4 А$$L4 2T ee @B 2$0 @" P  @ ? 0 @ :d "0< :@ d0`" :@ D8<" @d  "@@d   @2)L4&L@@ @D 4%@2L@%@&0$$@` @@"0@Gw 0"  ?X4 L  :  @ @?2$$0$` @@"0@GR 0" @ ?24 @  @ "@$$$@8ܐ  ?@?20?0` @@"0@G# 0" $ ?4 $ 㿘 ;   J H ? 2H  J  㿘 5 Т @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   + #fU $ $`   - 5, "P %  A?"% S" 1#"?S  @`?В @ `  ?ʠ?В @ `  ?В @ `  ??` &@㿐@&    "  2 @E 2  @{  "x   ?''D'''  ܘ @IU      @E;ܮ  ܘ @IC ܚq  h   2c ^ `    ` ?@` ` L`x/ 2 `  @F> : `    * @"   ?     + "    ? 2@`2@@ + * @ ,`D "@E0ɐ"* @D @Ev? @J ܢ @    2  1 2 )  %` %` @I . %`  @I   ?@`` ?%` @Iv x`%@ h`xf / 2 `  @FO"Y T`` %`` %`%`   * @"   ?    . @"'   ? "%` "%`" %`  @Iu@@I@ Ց.%@ܨ *a @DÐ䀥@ D%@""@D 㿘@D㿘@Ia @Cڐ @H0 p "' "' '  ""''''7''1"    @8: @H԰  J  ,  ``" 4 @# # `" 4 `@` `/ '@@ "  㿘 5 'H   ` `2 -+L  L0 L x XL )0  ) #?)  >4 3   $ `%E    # 5I "m B  @ @  i?"1 + 5<@ !b @ @  J1"?# ?5<@ B   `В @ `  `В @ `  `В @ `  H  H"@㿘'L'P'T'X@L㿘 4c@%㿘 4@Ö㰁㿘 4@ѐ#㿘 4@Ӓc㿘'P'T'X@Ph 4"'< 4#@   bА ## #ߖ#` : ) 4#` 4#@@2̢  @((  (6'$@@̖ (@  & 6$@` 2` 2`  &`` 8@n & 6$@` "` @@Z & 6$@`   :,@` ,@`*` B$- + :  %!`%N m`%㰀@ @@'8 cH@  & 6?& N %   , , ?$, ?*` ő: ,@ & 6@` $@' $cX '''' = `  `` @@a@@ʖ ?`7@E@O@] @@ ?`7?`  #` :%  >@ $@ $cp ''''А<P;㰀@ 4`@y&` 4"  #x㿘?"& P!?&&   4"'2   s ?3& W` ?-b  )  ? j ?/??????????? /c7@ hOϔ j? O&& b  ˩#㿘 2&& "&   &㿘O?&& &  `"`㿘 < XlaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaXtXYpYXDZ ]4Z0ZPaaa[,aXDaa[[\\]4__``aaaaaaXY4YYZa]4Y4aZZZ[L[pa[a[\\\_|_```a 㿐' "@ "`2*? *H 4"'Lp`%fL`z`!ē*` €Y`` #*` |  "@yG`` #*` `  "@i7``  #*` 0  "@Y'``  #*`  "@J`'l  @O `H   '  `  b @ `  b(@ "0` b @` ېג "  b @Ͱ`  b@@ݖİ` b(@Ֆ` ȷȳ "  b(@–` b @`  b @ "H@Ô`   P  L@ {"P w"X@ b @t`@'`'` '`'`'`'`'` '`$'`('?'ؠ h @O@O F  "x@vD` `?N]" b @P7` "  b@E,&NH i `'l`` +!?! 2m!!  d 2n!!! 2mn!! !m!! d !n!ې!אԒ! !m!n ̐&?Ȓ $?&   4` -` - 5-:  V g  b @ '   @՚ "``` " M   M  b @}` b@u l`@ `D '` '@fd' '`'l  @Q`'l  @H`( @r@` D`  4b< @ @c9` 5`$`6  " "@QM< <M9 <* ,  <,  b@#  `T  . L    d"㿀# 4b' @ې@ b  K"@ `@  (*@  㿘ƿ dƻ dLג dLӒ dLϒ dƫ d  `d ?`    `  "b   &  b 㿐֒  ?&㿐 !АHȒ"@'h"@* "@*`@*`'@B  ! 4"'''" ` ` @B0!`#`? "77''''@W*"  Ǚ"ȁX  N "g @B @`"` N@ "\ @B @$'O '@@ΒĀ  4F #̔ Ė ?'''?'''' ` #\ ` ' 'P П!@     `@bĐ?"`h@谒 a@`@^  @ *@`N &*@`@8Ð  @8 d 2  4 `@2#!c $"*"$  2@ *` 26 @9o@9my  6#$`  kA &@'  G   !c $""$ ?O`GK`$`$@$` $` $` `L$` $` {C$` @;' ''''Đ`0 @= @ 2 `P` #`Gk``€`P$`H``@#xa@ 4#$@$$ `@8 @8 h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ג q $@Ӓ  $ $h 2@d   ` %c $ $Y %c'!Т&@'`'`''@m'耢 F@  $ "'0<Ȁ2' @L $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@X $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " PFD P `@ L@7@7p2   * $, ,  '7F#y Ь"@  F q yѐ"@'"`'ܐ@? ؖ"@ 'В"`'Ԑ@?В#* $, Fm,  $ `" & $` 0?  1 ""*"'` & (& $? 2 6 & $& (?  & $& (㿘 i??&?$ $$ ( @㿀!Z!@ 2  < @0 @ 2$!@+  < 'c" 4"&  c&  && &  &  & @3 (@1 @. @& <  `@㿘Z!@  ` (<   8 ,㿘@   ``@ C!㿘@  㿘 @` " `    ``€ @`  @`㿘@Ւ " @   @ޒ`  @ْ`@` 㿘@̒ @` " ` 2   5` `@   㿘 &`&` 2 @ @` @`  @` @`  P*  "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &``" 58 5" " " "    " " "   "@   "     # d? *(#d d*`  *` *`d#@ #  #"@d 0#d*@  *` *` *` "  #㿘  " $ @9  @$  㿘 @ "@$  @9  @$    "    @ " "        " "   㿘@㾀 4"'`2`!'ǔ쀢?2`^?@9     '`  ' ? .G"'` ' ) .`*  .@ '0䰒 08  )"= ! 8ޘ  "{"@ l쀢  m""  ߐ p 5 o6 `X?`X!'''#\ab7ڐ ! / 5 `' ``(''''' "#\|! ڀ  c "b b`  ڀ 2 c "b @܀?"6 B6 ځ㿘@m @h`  @c` @^`  㿘@3} D  4 #@ `005@@ $ <@ @3j$ @  $  4 #@ ޒ`0@400 $   2 $   5 $ 8`h& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @1 2  & @ "㿘   4   8 2 @f 󀦠 8@> & 4"$ 4@㿘!    " 8 @7 & @@$  @$ @  2  㿘   >J ?   "  , ?  "@ @  0"@ @  㿘 ܐ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @3 @3㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` " @? ?"   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@6 ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?p 4"Ц' N  @6'$` `P ''ܢ@ $@@6$``  X $@:$@$`,̐    `㿘 =  㿘`    `*. "  0.<ޒ ` -. 㿘  h@ޒ   \, @@b@  "`?@S@  " " @.㿐3  5 p   `#\#`" ""㿐 ` #\#` cؒ   㿘? ?  "" c: @1S 㿘?2 ="    6    ?@ .@ 2`@:`+  * @    @ ` @ 4@ 2  : + @ *` Ҁ6 ?6 ?@ ؒ@ 444444444444444444444d44444444d4444444d㻐 4"' "?N @ / @w 2   @4 2    @4 Т   J B  ?* : `(3%"*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ?  s  (m ?,M˒ >$?#\   @4ِ >?2???#@ @/U  && Đb?J       (+  2 " 2+J " ?J@   J@J`  㿘@& " @  2  @`@`㿘@  `@  㿘@ޒ㿘@  @` @(` 㿘@c @㿘@\ @㿘@/  @"` @`  㿘`@ܖ$㿘@ @` 㿘`@Ɩ$㿘@㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐N@'Ȓ  .@ 㿐@'ڒ  .@ 㿐 "    0@  @ '€@€    @ &@  㿘Ȓ㿘$ "      Z  aD2      2    5 ``?㿘@l "2  2+ "   0"   @,&@   4 #@"b    @-i&@㿘`–$㿘 "   @ "  2    €㿐 @   "7 @1' -8+ `  ` 0!  2@,C&@   4 #@b ,1@,&@  㿘?㿐 "   / 00@  `'' # `€@€  @€        >@  㿐 "   / 00@  `'' # `€@€  @€        >@    *0(             㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘(`   "L 2 $?  "aL`X  0,: ? L X @. 4GA,? `L X`  ``%<' L/2?,] e,  `c ]"8L`*#Ӕ!  &@O , A, a,I` ? "8 ! "7 9`/ K\  ,` #`? a 5L` `Z" , В `@ `  `*:  z ! 4"'P'T'X'`#`ذ ''" ` ` @/۔!?"77''''@ P*"  L#㿘T 2 0ǰ? 7"   `" "a"a  @ `" @  &? " 0@*  0`  @@" 0@*  0" D "$ @*$ D$ 4 $ 㿘 0   `a ?"a@  ? ?$  @`$㿘  @^㿘d"` U$  2 0  O? "  @J4 "  @= C? $  ?4 $   4 ` @@" 0@*  0" <`$  8 '$  2 @d ,@8   $  $  ?Ȑ*@$  4 2 @ 4 4 $ ? 㿘'L'P'T'X@$LDDDDDDDDDDDDDDDDDDDDDDDDD`DD„DDDDDDD,DDDDDDDDDDhDDˆDDDD8D(Ltֈxxֈxxxxxxִֈxֈ8xֈhhhhhhhhhxxxxxxxxxxLxxxxxxxxxxxx޼xxxxxxxxxxxxPPxxx`\xތ xxx㿘` @ &`&`&`   4"'''"`` ` @-!` ` `,`$7''7'''''@ @ɐ 2? @`  @4`   Q#8! 4"'H'@Q''`0   `"` a ?"a` ` 2 ` @ "` ? "   HW` p'ؔ ('''''@- ' ' 5(@,آ   %'ؘ?'؀ YԐ#" S$$@ ' 'C <pԔ'Ԁ`,ظ '''Ь?/K 'ؒ`Z/,!*` €O߀ ؐ / آ L?Ѐ  33  ̖`/@ *,`: @*`" @ Т L?Ѐ  L $  ('H@`-`@'д'Ц '؀`-`@`'Ѐ Ӕ '  +/J*I'ئ L ?Ѐ  33  ̖`/@ *,`: @*`" @Т L?Ѐ  L $  ('H@`-`@ '؀`-`@`&O?NؐЀ  33  ̔`/@ u,`* "@ oТKИ  '؀$!3- 33  ̔`/ @ X,`* "@ RТJؐВ` '؀$2' ('H@] J h2 @'(J l2 ' "$`ȑ-`@ `, `-`@[``''S `-`@J``''B "`1-`5$` @` -`@ `*`:`(:``* !: (` -`@ `*`:`:``* : `-`@` :``:  6J  -/ߠ`D g  G "  `2-` `"-`@` ?`''ش?@Y  #   -/ # w @^  #(o  !@ #`#\@ޚ'gG?@$ gg E e ef'@ ' @ 耢`   @   `4  $    -/߀ `J-`J@ `4-`4@ @ `-`@`2( `-`@`x*" `-`@`j"$ `-`@`]"`-`@`ԑ:`M:`-`@`B" `-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  `  `-`@`  `  #0'   x`-`@` #H  @ 1/"@*P #)/߸ `-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  ` f  #P #0'`-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  `   2 /߀'?$ S "  7 F#h  4`,  `4 0 , 806 03,   `0, Ŗ  ` `0, , 4`  ` 4  ,@)/  %/Ƞ /ߨ ''O߀ `' '4O" `.`3 5` $$` ' 'ʒ äp``$$@ ' ' pO߀  ߔ $$`  0/h/ih $$` ' ' p4" `.`/ 5ਨ $$` ' 'r kp`4$$$@ ' '\ Up"`-`/ 5ਨ $$` ' 'B ;p`4$$$@ ' ', %p! e$$@ F 㨁 BV # $$` ' ' p耢@  $$` ' ' p?``/ 5ਦ $$` ' 'Ғ ˤp`4$$$@^ `` # $$` ' ' p$$` ' ' p `-`/ 5ਨ $$` ' ' {p`4$$$@ ' 'l ep$$耢@R$$ @ ' 'O Hp"@`-`/ 5ਦ $$` ' '4 -p`4$$$@ ' ' p  # $$` $ @ ' ' p  # $$` ' ' p$" $" @ t 耢 4 R   ./h/ih $$` ' ' p  B$?$ .@ ?`4`/ 5ਦ $$` ' ' p`4$$$@$$` ' 's lp$$ @ ' '_ Xp 1" `,`3 5` $$` ' 'B ;p`4$`$$`'`'- 2'`  &'Ԑ#А"  '  2` 'p   2` '` @ ?' "?'`@o (SH ' 4  |#P 4" '''/*` *@*`**` * *`@%Ԓ Ħ  - 5@} Ā % ?   N `Zx,#ȓ*` €N ?Ѐ 33  ̘`/ œ*L@@ *`# Ж `L@?Ѐ  L@ $'7N*? N ?Ѐ 33  ̘`/ *L@@ *`# Ж `L@?Ѐ  L@ $ @4 *@`@4 *@ Ѐ NЀ  33  ̔`/ ]+  * " W?И NЀ  $vq oN h2k@ hN l2d a _]@K4ʐ  @;4  @.4  @ 4   @4  @4 @ @4w  @4i @ߒ4^  @ђ4P @ƒ4E  @47  @4* @ @4  @4  @4  @s4 @h4  @X4א  @K4ʐ  @=4   @04  @"4 @ @4 @4 @4z @4n  @ߒ4^  @Ғ4Q  @Ē4C   @46  @4( @ @4  @4  @4 *@v t䀤* &#\   @#<??&Y? L `=,#\*` €`+ @''`-`+ @''`$`+ @''`: `+ @''`: `+  " `+ @''`Ț ;@  ? " P#' 4"  W#㿐@@* @6@@z@ #\   @"?&@@#\   @"??2?@!@O@& @  @"$@ &@㿈\ f   e E  #\@  g G f' fJ 02 @? #ȁ B  '@@? #ȁ B3'@   0`*@@ '`" "@ X 4"'`, -,   +,  쀦` >  0.,X ` `0..    0. `0. &  #Ё(,㿘Z@"G!XZ,!`  " * 5Z!,``&: 2` ! *`"@o*`$ $ @"&X$ $ 㿘  !Z@"!X Za`*@ !X&@""@ 㿘   *`` " 㿘*` *  *` * `2&@ 㿘? ?* & & 㿘? #  ) @)4`4  *  $ 2  , p  * @!  , " & 㿘 +  *` Q  "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘ؐ  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c( @  (4`4 444 4  $@? #(ݐ 4 4(Ւ4 @   4 $@  $'  "' 㿘`  5 *  >``2%\` 'Z!Z@ !\]"q$!\@ ~$@'Z 2\@ t@ R$@$@ k`" >`FA>``2@㿘>`@ *   `` "? * ` " * " 2@ ` " " ?& `(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐 ?. . 6  `''`'ِ   " *@ $ 2 '$   $   $  $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??āh@'H @ 5  ?  ' ?  ` 2L - + '2LL` `0 *  L`0 `\* : (     -`*   ?4* *  ?ЦL `/`9뀤 :@E =L`0ϦL`0 π 6`e  (   ?  -`*  4* *   -`*    * *    LЀ Ӛ`e `EI 2  2"L`+ `-І LЀ .`0ϦL`0"π !ЦL *  L?Ѐ`/`9*$ "" 2     H &@  '`  B?`  c* @'&'D  BD? ? @ 2;$`"pH'`   #.` &'D?aH"@ $$ c*@&@ &.`' B@?"#F?IH  #*` &'?;H$@T  #* &'D?4:- "" 5 Ȁ ?H   + @&'D?: ?, '+ @(&' B? $ #'?'_ 'YV   #* &'?F:/   `+ &'D?: + `@"  蓠#H? J#"F? H?J  ? " "H8@?0' '*'u  $0o@# @@"?  ''0W?@  ?   2'?'0C @  ? F 0/   ! *  !&4' ?@    x ! !! !!B'!B&'??@?؀ ȉB) @@)?,?А '?Ƞ  ' @cȅD?   #'?'0E '0@ !  !BB?Z?Љ @ȅD? @@ "F"'   ?@  !  !  0!(   * @ | `     쀢 @ &  ?3 6"  @  4`$ $@ &  `mh`*  m % N   ?@6420.H 2"䀢 #㿘 t -    `!Q `1?#  #8 @#44`4    "@ @2 @:`"44 3`: ('  "' ܐ 0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' h?'P  'T '@ * ''@   T#"@̀  ?  \!0 \!@ !P B T " \!H   ;Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@'  !XB?{͔ ? '? !` ' ax!h D p PHFBL ' B# ' #, $ȇ%)'#?    '@% ' 8    "'9!x. €?'? 'P'PP 'PP' 'P``' ϐ   Ⱥ  '   c* @<"  # Ƞ    ?Ȁ   /`@ &' B<  `ȅ!?Ȳ `c* @>`$Ȁ %B?   /`@ $ȇ%B?ȡ<  `耢  a 9' 쀢  a B ?' ȀF!?0D'@'& !'и '$% ?ȅ) )P?䀢 I c* @ $ %! ȑȍB'`0.ȍ…&' W? !Ɓ) 0 @6V?ȕ$ %!ȑ DDB?ȅ'`0,Ȥ…&' 5?ȅƁ)} 0`@4?Ȑ* c@ $ % B!Ȁ@B'`0,Ȥ? !D-Y 0ȉ&' 9?ȤL 0"Ⱥ`D??Ȧ  ZX #, "P # '  a Bȁ  1. Ȁ@̍B'`0 L,Ȥ ?ȉ"#B  ?ȅ$%L` 0L 92.  , ! B ?!PD`'Ԁ  'Ѐ ؀d3 6" &$' % , @'Ю` `@4%@%&@䀢 ` 'Р  `̀2'?2 ' @ `''   *` ` '@``` "```@@`耢    `В  '쀥䀦  ߔ   1Pɦ8  1. Ħ`O'Ѐ 'R` 'Е*@ < '   Ѐ 2     ' ' 'В  'к`7Ԣ 0Wm  KA`  ̀ `9* 4`e,& ```̀` % 4`2N,`"K,``:  9E, `9` 9,,;,,@  < `ؒ 0,@  4 `L  1L 9   ,. L 0"ʐЀ  Ԁ`@ 2, 0.  ,T"\2"+dd 0ᨅ(# 5Ԁ$\ 5 ܆       $((()(*(+ (,!(-"(.#(/" 5؀  5" "` "`"؁⨜;`` (` `?# *`?;```0  ?2 `2 #0 ?(@ 㿘` ` ` 2 @@ "@x? "`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @` ``&@$`$`$@$`` "`*@@8`@"@$`$@.@` @&@@@l$@ 2` `` `,` $u` ` @ `@"@$`$@`" $&`b   `  ` @ "@  `@ ` `@ @ @Д@@@$@ +0@ `,` 0   @`@"@$`$@2`@   `" $&` ` ? @4` 㿘d"`2  2  $ "  0`  @@" 0@?  0" &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%@4    C  & 6 & &@#`& & & @ZV  2` 6 (T  &&-d  &< А`?`&$&@(&@ $ L( (I"@"$㿐@ ?`W%f 4b  @h      @  9 2$ #\   @2??(h 2$  $ $ $ $  h 5$ $ $h" *@ *`$ ` $  "`"`@k  "  @o㿘  㿈@ 5 쀢`R\"fh` 6"" .,`*  `# "' 2?' ' '@-   $ @%  @??< 2 "ؐ? %"ah" %ah@%ah㿐@J`D 4b  @f!h   #\   @y?? $  ސ 5$ $` $h"@Ŕ   $ $ $ @  @㿈\"ܰ`"ܔ   '?   @ݚ ?"?"܁`! 4"'@8"@   #㿘 `X㿘 2 H@8!  @ v? "㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘 4#` ? T` "??`X2"  `  ?2  X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@`    ?"J@ @"J@@ 㿘 㿐#\#`  L̚ 㿐#u. @  #   ``  @u " @ " 3  `I!3 IIII!b@3 # $# ,# (#  # 㿘T ؔ  P > B< P ?Đ*@4 㿘 ! V    ?Ē* 6 V ?㿘T   ?  2  ?Đ*@4   4 < P㿘SV 㿘N r   w a  0 0       & "t  "N + b @ N  +@   @ &@ (`` tw  "@!ܠ ?$! $!?$!tb "Y !*9   Ā@`@  ` @ K0 5 " 5$!  $! !!?!t0q2o O!a@2i O ?   !  €# @ " Z O (6 @ʐ 2[   D* !8  *@ :@ *`$!@   `@$!0@@$!0  ! @ ?$!$$!4@ j $  Jsް @ܐs%"LJLLMK"aT$ Ԛ` & & & & & & & &  & _!@ s" 㿘 ?@ @ 㿘 " ? !?s? "( 5 ` ! @$ $ $ $ $ $ 4$! $ 8$  D @s  Ē @o @` g :  @$ $ - " @ *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$ sE   "$ @  㿘 4W  & @Ơ  *  D# *#  * ,& $& `@" " ?!.`2 ? & ,& < & 00& (@ , @4& @㿘!4@   r!؀ !!ؐ?* &! @ ?!??&!@ 8!@X 2!r! 6!!8, @ "!@ !! , ! "!@ ! "!@ !?X@  r?"㿘` r "?"? !4  @  2 ?@  2?&!0 㿘!4 4aa!  $ $  #$ @!! @ ?! ?  rj? Org"$!,!8 đ. ` . @ @  2?  .  㿘 @F rA "&!,?㿘  "!r0  !  r( "&!,?  @㿘 r !  @  r "&!,?㿐 @ @ٖ ?P ` ` -` G`   % 2  `@ @ G`   @ "s ``݀@ǘ +2 `'@* 2 `@ "W ``  T?` ` @ܖ F?F ` `C `! ``+00 `6 `,@  @  & "@&@ 2 `@  `?@  ?0 @ ?? ` ?-`㿘 "!$q> "$!,?  $!$ $!(!$   $!($!$$!  ! !$ $!( ( @ "j?$! @ "  ($!$?$!$\  !(`$!(@@4!$!(*  `2@ *@ @א $! $!(`  @ `!$$!  $!$"! @ "! !**`     @"  ?0! `@   &@@ ? " &`(! 2   &@  "@& 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @5 !ؓ,` "  ?!! `&!&! (@    D*` + "&  ,  & ,& 0@c㿘@  @ ]&@ O @$㿘! € , (  0㿘 @   $!؀`$!  @ܑ.@   p4?2p/"   *** !ؐ"@  㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?@  ,$ ! " "@!&& $! "㿘!! @ @!`"@`"@!$@$`&!`"!!   ` ! @2`@2     @ @* $`@  @  ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` @  2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     @͘ 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   @o 2?`"  "  @ Ò @&  " @"!2  @"``"` *` @`"!"`!"@! ` ?h???????|`7 ``22`O (* * * * * * * * ؔ   (  㿘  ?nT   "@Ӳ @ 9 HJ HJ J IJ J J J I8ITIpJ IJ J J IJ IJ IJ J J J J IJ JJ J J J J J IJ J J J I,IHIdJ IJ J J IJ IJ IJ J J J J IJ J p  ! 'Р#(@  ^c''@  ''@ '@ '' c8 ''А   5` @`p 5  c@А ^#`  '@ Ԑ ^c'Ԑ @ '''@ ʐ'@ '' c8 '' Ӕ 㿘 5c  5` @ 7ޒ  #P^c""c X"@ %@"@& X @ <7 -^ *  \`(*  7 "kX$ &"$%"* @, 7 "XX"$"@%    n#` "^#^ `? c %i c @  $?$ X& X   2 X D#x X@ =#㿐#@ X4  #\   @ ??l^ch"c@q 5 ` * ^-^`  *  \ `# @ 7  % %$`$ X8` ܒ^c"* @@  ^#`$ "@$ X"% X#\   @ ??^c"c X`@ #㿘^#@^"#㿘!^#/^#^c @ $#H 4"'ls +^   #ϔ ?  ,m  2z @ސ#f!lojLđ* : `>YP *` € 5`* !U"`!R"` 5`2 M"` 5J"  5 F"`^C"#^ ?"c^<"#^8"c^5"#^ 1"c^."#^ *"c^'"#^ #"c^ "#^ "c^"#^ "c^"#^ "c %c  %c! 5  #$ $ L  ic ^ "ck!"" & & &  #\   @?&   &  ^c"c @ @O8&(&    㿐 #@*` *` #\   @??O ^#@"# @n  :+  *@ 2*`*" 2@ @*`" @  * @ *$@ `"  *   5*`  C (  #* "@%# &  &  & &  㿐  2! #\   @#??^ #@ "#   "& `T`T  & @ T$  "@" 㿘  *  6`] # 6`*`.`" 2  @  @ *  *  * *#@  @"` ?$ 㿘( 8@ Đ @?@ 6`*`.`" 2 @  @* * @ `22 *㿘 ?  X   &@ & >` .`"    "   .`2* *"2` @ * @*@@# "`㿘V?c 0 `X #  6 6   : 6 * 2 #4@6 6 & @ 6 55 2@*6 6 6 6 &  ` `.`  ?2 * #@ `" 6  2*  (   #&   p㿘 ( `   6`` >```*``} 2 a ߐ i  Z"`  Ӑ ` `  "    , ;`Ð  ?",    `:?2 @ 2`4&`*` 4`@$$@^?c": * ` , `  `@z`㿘` @ w   (?.  2  0m2*   2   0a( #   ` 4  *    `2( `"@ "   : `" @ "  * $1" * i, )"@&"  2" `2  ^#`2  @g  []㿘U^ c?#"  #? @ %\Ւ?   /hڰ  @"㬀`" @+  ǐ ^#㬒@ "#^#`㬐$@ @ ^#` $ @" ?`㬐$ @ 0\"`   @ 㿘\ 2^  "!^" 4"`@h "㿘 4"`@\" a^"# b ^@^#` U! hW  &"!^#  $# 0^#I#$#b  @  ^#` 0! h2 "㿘\"W s?@  `` *  H^,$ #@   -!P   "!`^#`^#? " @I    ^#"@ "#^#` ? " @Ȓ ߒ%'0"^#` @ : * (\@ "@  ֐!00+㿘 # 4b !^@#  ap^" $#,h#$#b @㿘 \ " ^ !0 #?c"@ @ gk  "?@  ? *   # u!`#$@ #@@ D C@@?@^#`:@#@? @ @#`@@" @  "#  # @y$   $hE% @(A% ^#`#@$@ "@ 5% @4 @^#`@^#`&`$$@@  @^#` `   8@i0㿘 4"`@'\" a^"#B b ^@^#` ! f  %"!^#  $#  0#$#b  @  ^#` ! f "㿐f!h?' @/  5`   `        ` @"gj"  P  @ g j  @2@  0 X`ԁ@2"c b?? 4"bc /b' hp!c1cĐ! *? ##*`-Đ 'h % 'l'd  d @ fƨ Ē $ -Ĥ  cĐ` `-c   @-  ` c, , Đ*  @Y?"& b  W!㿘 4b  @<c`̐? "`b#`bb #Ą#Ĕ*#Ě @ ( @ +@  +@ "  @ @㿘! 4" @ l" @㿘 4"`@b#`bUb cĬ Đ?  *c cĐ` `-c  x@-  ` c, , Ē*` @㿘 4b  @c`̐? "`b#` fc`ȀbbĞĐ (Ė   ` + *  *Ĕ  (Ą ,   ` + *  *Ĕ  (Ģ +` +  *  *Ę (Ĕ ( + *  *   @]㿘 4"`@Qb#` ec`Ȁ #%bĠ`'c̐? $ Ē ,Ě ` `  ,` , ` , ." @㿘   8 .  d= dbĘĐ (Ė    ` +  * @* ` ii(i4i@iLiTi\iidipipipipipipipipixi㿘 @W `dXN I   < ; <" a@> <:    2 "-  ?`#Y#̓*` €#?###    (",&  &d  "?Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @* 4cЀ /  Є#8*"@ J=2 "  J JJ 2 J=ې    㿐ƒY V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*(㿈'XX#d#h#\#` : Ł J " " @ ` ?  2  㿐#\#`  :e $2 X`ԁ@$ X`ԁ@ $ʄ X`ԁ@$x X`ԁ@$J X`ԁ@$Ą X`ԁ@㿘,` ``$, @2 `{,`2`6 $, 2 p`,`2`,``2 6**`@6$ 2`2`㿘`. `@I"?. "  ,(* *`@`2 `" @ 9@4(*`22@22(2$(*   @4 248?$8``.`㿈      2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'z2%* "@ , 2 $ @ @ "@44 @ '" "'`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@! 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`) c  @V   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@ } @Ӑ "q #. * @  `@ ]@ 2"?O .`* 2`@  *` `8,`,`2  *F @ے 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?v "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  ̔`@0 "`?@۔`  .` 8` & 8 (`` 4 $ ?㿘 4@@ `2  & 4 & 4``@W.`,`2 `  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  <}?*  D@ 6  *@  <?  k ?*  D@  %>  ? K?  `_? OB"6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.`.@@  `@?7 .@.`` 㿐!? @ 2h?  ဢ@,! "@ :  $'++ + +    @ 7 **  <ǐ?*  D@ 6  *@  <   ?*  D@  o> 0? _ O"?㿘 !!<   , &!  " ې?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?=@ 1 8. @@m Ā2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$  % *` ,$   ?$   * ?2% ``m , Y  2m ` g $Z % * ,$  , ?$   :** %  * @% , ;V  :**$   * @%  u*` $ ?%$  D D .  4  ?* D@$@ g . .  6 a 1(0 ] " 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @  :**$   * *# 㻈 4"'_A 2 7"  "0  ʘ$#?]? ?"'D ɞ?&!eW!  ~  5 ! ?b  "8㿘,``$4, @2 `[`$ 6, 2 R64`4`` *`$ @2`* 2 㿘!@6  .`!8$ .`     0  2{ 㿘`*  m* 2 *`*  4`$ , 2   +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 Ð4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2  +  +  42*`4$@ 2@*  2 +  4 > 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2` M`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`  8 ?$ 8㿘`,  " *`2 (  `$*, 2  & 븖 $@``" *2   **2  ?,  ɐ ??㿘 @+  ? 닐 "    +  @  `+ &@  㿘`.  `2.*  ? ` "t?`  .  `*  ? K ^` ?* @   2  "?3 -,`E?  &" !&  * !$  &!(&!$&!  ? )&!  &!(`@ 2# !$&!  &!$ ,`2 @?&  !  ! &[  "?㿘`   "@(`! Lz A&!, &!( * ?ǖ 0&!  `,!$&!  &!$* 겔 Ĕ $?,` 2 @ ! `@ 0Z "?㿘@  ?&! &?㿘```? * 2 "@ ` !  0$!  ,&?@* V ΐ ,` 2 @ !``W@ 0ZX "?㿈\'P 2d?@ P* 2`` 4 P $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ 㿠L%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmv-shshkshsedmkdirejectmtrmmount_mfsnewfsinitfsck_ffschownchgrpchmodgzcatgunzipgzipcpedmount_ffshaltrebootdhclientftproutedisknamesinstallbootmknodfsckmount_udfumountfgrepegrepgrepmount_nfsmorelessping6rtsollsifconfigcatpingcpiotarpaxdisklabellnsttysyncmountdfmount_cd9660dd!8 P!0 t!( !  ! @@! ! ! ! D ! P@@! lskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s%s: illegal numeric value%s: %s%sstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out %zu odd length swab %s blockblocks%zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryA.%sskip reached end of input!!!!!!!!!!x!p!hupdaterdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rs:session number is %s: %srealpath %scd9660%s: Filesystem not supported by kernel%s on %smainusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'hiklnPt:only one -t option may be specified.-h and -i are incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list %lld %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s @Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*lld %10lld %11lld %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fssoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rswt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountdmain,/usr/sbin/sbin/statfs %s%s on %s type %.*s: %s already mountedexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmaxmfs%s%s=%lu %ssizemsdos%s%s=%u, %s=%uuidgid%s%s=0%omaskshortlongnowin95direxeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-ousage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s!0!( ! !!!!!!!! !! !! ! !!werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard!x!p!hrprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP!!!x!p!h!`!X!P!H!@!8 !0 !(#! 3!#!3!2!3!3!#!@!@!@!@!!!!!!-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5!H!@!8!0!(! !!!!! ! !@!@!!!!!!!!!!!!!x!p!h!`!X!H!@ !0 -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk!!!!!!x!p!h!`!X!P!H!@!0! !!!!!!@!@!@!@! ! ! ! !!x!p!h!`!X!P@!H@!@!8!0 !( ! C$!C!C$!C!!!!!!-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho!P!H!@!8!0!(! ! !!!!!@!@!!!!!!-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostoposttablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s print%s: %s %s %s%d-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a | -e | -g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.17 2008/05/28 19:31:38 millert Exp $Ffhns.%s%s/%s%s: disappeared%s and %s are identical (nothing done).linkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.134 2008/08/04 15:58:13 reyk Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsBEf:NRWb:cdenp:s:tvwbckmgt%srioctl DIOCWLABELunknown disk type: %sioctl DIOCWDINFO%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:A?P>>=p %c: %16llu %16llu %c: %15.*f%c %15.*f%c %7.7s%7d %5u %5u %4.4s %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu total bytes: %.*f%c rpm: %hu interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cVISUALEDITOR/usr/bin/vi%s %s/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldcmplabel usage: disklabel [-c | -d | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d] [-nv] disk (edit) disklabel -E [-c | -d] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) %sdisklabel -B [-nv]%s disk [disktype] (boot) %sdisklabel -Bw [-nv]%s disk disktype [packid] (write) %sdisklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically.Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%swunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelFree sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) editorNo space left, you need to shrink a partition (need at least one full cylinder) No space left, you need to shrink a partition partitionThe letter of the new partition, a - p.Command aborted Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partition to nameThe letter of the partition to name, a - p.Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. %s: [%s] %s: [%llu] %lldRounding to cylinder: %llu getuint@Y Error, partitions %c and %c overlap: # %16.16s %16.16s fstype [fsize bsize cpg] sizeoffsetDisable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.Invalid entry tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.edit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd!X! !`! !h!!p!x!ۀ!8!ۈ!8!ې!!!ۘ!!۠!ۨ!۠0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current partitions. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'l' command prints the header of the disk label. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate and display details about the available free space. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: ? [command] - show help n [part] - set mount point a [part] - add partition p [unit] - print partitions b - set OpenBSD boundaries q - quit & save changes c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition u - undo last change e - edit drive parameters w - write label to disk g [d|u] - [d]isk or [u]ser geometry X - toggle expert mode l [unit] - print disk label header x - exit w/o saving changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary./dev/%s%s%s%c %s %s rw 1 %d mpsaveStarting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. This architecture requires that partition 'a' start at sector 0. The offset must be in a free area. Size of the partition. You may also say +/- amount for a relative change.The size must be > 0 The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. %llu%.*f%cOpenBSD area: -; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] \ysFO]RIRINْ=8Xv2d@4$15~JvfJ9<:o_z_Ve2kMҸQM^NNe|.Oq-tYt&k묿\YIouvgȖwd9&^g5-|u\g:~Kʟ>ko |I'HM:7L%ڬ=9X,i>>쇇Y^e ; @fË~|H+~x-6k)1o1gFβ3- h N?z3y|2lnjשZ^Mm-w@RK.u항x)':@0/l) 7ݫkw|ةVnL3ݡuW<9%ghT"RPY䮳.|Mt]tq|56qۦ3{XnfjO/i <޹1{gJ]wON VQH 1󵵝ZJ$^yDNҸ_5rp o5̛n['[W!kK D&WtjDpsYѶC:ݝ].NgYU, &9v#jjb`|mʗ^ L)`}܆16` 0HG|cqڐY?@u"3Pul{16ԞB5j ހ5"ͷubzvuvu8 :H2pEX``4`` Y%Y~=\iݛ[Zn%rEkhz?Y?^Õ{E#=7@>p>imGۼUAޑߚlB l1p0\Jk@M8yHL~=&4c:)"YxAlBیKstiJ X;f#֯5#NJ#wխ?sv,.l }~#!=vslFȃ4aQzϑiHDZ TC(̑mRiPPlփfjJJ@q/hFP эnk]=b$-D6o+` :SLbl Jwa25قCck@x8[ 'sn4Rp8.*Jdrw[s˔TVeA|A#a-yNkd]c;80,1sZ9r072LQC|fAZ/ `WH 4WǶ== jdg6UV [1dC+Uxl9t E)I@'Lk@@$E.X mG"q삂5^F7MeXU/џ geI^k {4Mmh󺝤 $qINJ29`hx+l5abW/aRK |[ ӐӐnNJO1Cvz᠄făjseA)U A l(oAL ?V1Xgt TO૛Y\{q]d寷>ҫ@?X(Z+aqI^$ d3Z۶%(&sH[[-?\"xec&ccUFwQrŮmwF5҄(Al_y/#hjP?eZxAhO)ʒ}> pɂn\pక$9?J{BZŐ P0%{duBjSr[:];/07xܧB.HTb󃃔%sX_ F!$-q=љC:WF\9xvhi.Jo!90SѴ):]Ud\:!]K;&8s`g+)t rB dMl7Rer59nJĀjJfIv*Z]΂!I;esuc).>fOC G&ԨF1\G_GO0b#}t݄VG\q{|BnE݆͜Q0^ 6?mdhMcjS3`)5@Asܮt(ASqssտ0䮖3ԃbā5fF{;YzL؍LOlT_!zM{ 7Yq)p}$dQU͂dL$~RhLf.:Lq|׌;kʀTnm$Ҭ|~L{XeX "U)K'hzh8k#Ab[JQrCS )>O- $Enn}K=kK}8rSwvhxp̧ usX/E+a~F'op]cl+:R!\p"L4ζjK,o.J6[arFJǃA :5j $~-I+PeiQ7Q0DˈQǹԄVtIloMZ=֡&g 61ou03Ԩmzq4RO;(P@Քf~ҏ3LSX\5:p7lAwHTKexnuFVF=O#CvSUf3XhJX8Dc31RÌ;⸀8SOW`}v@a1;4LH^X2`//bSq1UܹJhocXO} I(|ن6[~ ,&Zf^XfIkNZ–ĉMOxU_R1th+T_/Dtur_ C1xe3ly3\*D9.y R>U=ZӚфDu8W!jCb6(ɓ->:h)Cy18H#-qB8~4ٓ$6Y=9 hUQcqqP;'o K)} ﹧Bc"Br*L78+e{Wq^O|,* +ŮV>|haC*xbSA9X`FSP fJn 2`L0=*"(Vp8Ӣ;(d3n;xbÜ&GFlzx K& N&.O7NE qh[Si!i"sqZۇ^x0. ;;a3۞ 1 ȱ tV=FJ)SpBA  XǨd$\#T\ҴDJ4GOxHx0ܘ6 =C0X7Ygo7ŷٷSyi2O_禥|Z7}ë@#9waw} 9]i ]eF8$Ӏ8P>Ci5}ѱN&7}'_OF큖vɑ-1Zŋ/f3NN8[m @=EekpxwSO[l`CVnx?ߟnf#9pNs~>o) qvd:,8RaD VbAl=-?ԃ8FVg)Χ#Zx([8'0g 9@Q9e8!>PǧȻ@J`]06 PAse&Z,Xa O wt5jLb5AOBHt?O~,; 4N{O6`!?T:&b=ߖA G`*-/86zU " ϔ  .ݓ}vK> j<"_)œ'sl V3L C(箩J orUkf:2ⅇx*2-p8&ܮ5x,EI/N7-ڠ;@xf=ynj~ZZ&>D{`#!%{ p'}yq'J 76bR Nhh8DjX7`)5<侹ǫy0,׼z6mVsBlœ d`+у\TCi*X#t&m2N : S@ )ZERZr 1'}=P7MfeΠ~fqw SCRX{c X[L ."P*pXqOC!#c|c#ŸqYs'FT ?󼊔gZ8+ع)Hh±WfS3ЗusR)63ӌr1;:DSI+)s"\*D^0VdbH$(M/F1't/4 w#- 6FuA 0qV?>H-ea=`@ n/޽[@?f!)=Qʠ>O|@C| Oq^ Q;R,F ||I- zjͦS^7̥w5zMP? Dp_j9n7E4Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec %s$OpenBSD: ar_subs.c,v 1.32 2008/05/06 06:54:28 henning Exp $listCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%lu$OpenBSD: cpio.c,v 1.18 2008/01/01 16:22:44 tobias Exp $TRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wr$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $Unable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crc$OpenBSD: ftree.c,v 1.28 2008/05/06 06:54:28 henning Exp $Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %s$OpenBSD: gen_subs.c,v 1.19 2007/04/04 21:55:10 millert Exp $%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> ls_list%s%s %s ls_tty$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $%s: unknown option %c %s: %c argument missing $OpenBSD: options.c,v 1.70 2008/06/11 00:49:08 pvalchev Exp $ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Invalid block size %sbzip2Invalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hjmopqruts:vwxzBC:HI:LOPXZ014578Unable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-I-rUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPE/%sabcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhjLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list $OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handler$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]$OpenBSD: tables.c,v 1.25 2007/09/02 15:19:08 deraadt Exp $Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sadd_dir$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $ustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wrUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00nobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wr$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $/dev/ttywrFatal error, cannot open %s%s: : %s@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $socketsetresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %stos value is %s: %sttl value is %s: %smaxwait value is %s: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summaryA@YEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host benstuvusage: %s [-benstuv] [file ...] stdoutstdin-r%s%6d malloc"c`D"cXD"cHD"c8D"c0D"c(D"c D"cD"cD"cD"cD"bI"bJ"bC"bHX"bH"bO"bO"bP"bP"bQ\"bQ\"bS"bS"bT"bT"bV"bpW"b`X"bPT"bHY"b@Y"b8Z"b0Z"b [h"b[h"b\"aC$"aC"a~"aE"aE"aE"aE"aF"aF0"aG8"a@"axD"apD"ah D"a`D"aX@D"aPD"aHmT"a8n|"a(n"a m"aoL"aoL"a"`CH"`CH"`C"`CBD-descr-descriptiondescrdescriptionlladdrinstinstancemode-mediaoptmediaoptmedia-link2link2-link1link1-link0link0destroyeui64vltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-chanchan-wpapskwpapskwpaprotoswpagroupcipherwpacipherswpaakms-wpawpa-wmmwmm-nwkeynwkey-bssidbssid-nwidnwidmtumetricnetmask-groupgroupdelete-aliasalias-debugdebug-arparp-trailerstrailersdownup"c{8Ȁ i@iwFwFP"c 4܁ ixiwFwIlinet6inetinterface name '%s' too longcreate%s: bad value'%s' requires argument'%s' requires 2 arguments64SIOCDIFADDRSIOCAIFADDRsocketSIOCGIFFLAGSSIOCGIFMETRICSIOCGIFGMEMBprintgroupprintgroupSIOCGIFGATTR%s: carp demote count %d printgroupattribsinvalid carp demotion: %scarpdemoteSIOCSIFGATTRsetgroupattribsstrdupgetifaddrs%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCSIFDESCRNote: trailers are no longer sent, but always received SIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeySIOCS80211WMMPARMSsetifwmmSIOCG80211WPAPARMSSIOCS80211WPAPARMSsetifwpawpa1wpa2wpaprotos: unknown protocol: %ssetifwpaprotospsk802.1xwpaakms: unknown akm: %ssetifwpaakms"j"j"j"j"jwep104ccmptkipwep40usegroupwpaciphers: unknown cipher: %ssetifwpacipherswpagroupcipher: unknown cipher: %ssetifwpagroupcipherwpapsk: invalid pre-shared key wpapsk: bad pre-shared key lengthSIOCS80211WPAPSKsetifwpapskinvalid channel: %sSIOCS80211CHANNELsetifchanSIOCG80211POWERSIOCS80211POWERsetifpowersavepowersavesleep %s: %ssetifpowersavesleepnone%s%s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey %d: wpapsk wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher wmm powersave on (%dms sleep) %ddBm%s (auto)HIDENWIDNOBRIDGEieee80211_statusBA no permission to scan SIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTBASIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %s "q "q`"q"q"q"qCARPTDMIEEE802.11FDDIetherEthernet"x"x"x"l@#"x#"xx#"xp#"xh$"x`$"xP$"xH$"x@%"x8%"x(%"x %"x&"x&"x'"w'"w("w("w)"w)"w*"w*"w+"w+"w,"wx,"wp,"wh-"wX-"wP-"wH."w8."w0/"w /"w0"w0"w0"v0"v1"v1"v2"v2"v2"v3"v3"v3"v4"vp4"vh4"vX5"vH5"v@6"v06"v(6"vc"vc"vd"ud"ue"xpe"u"u"u"u"u"u"u"u"u"u"u"u"u"ux"up"uh"u`"uX"uP"uH"u8"u0"u "u"u"u"t"t"te1-g.704-crc4e3-g.832e3-g.751e3t3-m13t3e1-ami-g.704e1-amie1-g.704e1t1-amit1OFDM72OFDM54OFDM48OFDM36OFDM24OFDM18OFDM12OFDM9OFDM6DS22DS1DS11DS5DS2FH2FH1CDDIMMFMulti-modeSMFSingle-mode10GBASE-T10GT10GbaseT2500SX2500baseSX10GBASE-CX410GCX410GbaseCX410GBASE-SR10GSR10GbaseSR10GBASE-LR10GLR10GbaseLRHPNA1HomePNA11000TX1000baseTX1000T1000baseT1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTmanualautoautoselectmasterfh11g11b11a"z"z "z "z"z"z"z"zx"zh"z` "x "zX "zP`"z@`"z8"z0"z("z "z"z "z"y"y"y"y"yframerelay-ituframerelay-ciscoframerelay-ansippphdlc-crc16turbomonitoribss-masteribsshostapadhocdasdual-attachtxpauserxpauseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %s%s media mode %s %smediaopt instance %d6 physical address inet%s %s --> %s phys_status "|"|`"|"|"|p"|"|"|"|h"xbackupno networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?malloc media: status: , unknown supported media: status inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0infty vltime in6_alias%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%x%s: %sin6_getaddrusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] SIOCGIFGROUPgetifgroupsall groups:getifgroups%dd%dh%dm%ds%lumalformed link-level addressSIOCSIFLLADDRCOLUMNS1ACFLRSTacdfghiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%llddisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %3d, %3d %*s%*qd printlong%s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured as a router, not a hostmainfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routersselect: %sifconfigfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedmake_packetlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %srtsol_check_timertimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldrtsol_timer_updateillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dusage: rtsol [-DdF] [-O script] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgmultiple interfaces foundreallocstrdupprobing %ssockopenmalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssendpacketsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketrtsol_inputrecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%d) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %drtsol_inputinterface_upioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...get_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedinterface_upinterface_statusioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sinterface_statuslladdropt_fillunsupported link type(%d)get_llflagsocket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflagprobe_initmalloc failedsocket: %sshutdown: %sdefrouter_probelo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)defrouter_probesendprobeprobe a router %s on %ssendmsg on %s: %ssendprobea:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dtoo many intermediate hops%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)setresuid-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> %s pollrecvmsgnew path MTU (%d) is notified main?A.@@sendmsgping6: wrote %s %d chars, ret=%d .%c\%03odnsdecodeinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOP???%s%s, (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lupr_pack@@ HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] ? [%d]%s pr_rthdr-%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap truncated no address %s(TTL=infty)(TTL=%u)pr_nodeaddrpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1lf%% packet loss round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms summary@YIPv4 addressDNS labelIPv6 addressUnknownRefusedSuccessNo Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Host Unreachable Destination Port Unreachable Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirect Destination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %dpr_icmphVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphIP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESP TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ... patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host LESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+! [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%s/HOMEbin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbers! /dev/ttySHELL%s %s %ssh (press RETURN)Invalid mark letterCannot seek to end of fileMark not setMark not in current filelLine number is required after -l/%sless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-fileNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/tty""""""""x"p"h"`"X"P"H"@"8"(" " "@""""" "@"""""acdirmaxacdirminacregmaxacregminacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgsyncupdateforcerdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %srealpath %snfs%s: Filesystem not supported by kernel%smainhostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCfork/can't access %s: %susage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'bin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextline-bufferedmmaphelpbinary-files%s[[:<:]]%s%.*s%s[[:>:]]%s^(\()\)$r%scontext out of rangegrep version %u.%u without-matchUnknown binary-files option%s: %sfts_read(standard input)r%s%s:%u %s Binary file %s matches -- [[:<:]][[:>:]]malloccallocrealloc%d%lldafh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]"""""ĸ"Ĩ"Ġ"Ę"Đ"Ĉ"Ārdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotausage: %s [-o options] special node openo:realpath %sudfmountmain,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'$OpenBSD: fsck.c,v 1.26 2007/10/20 18:11:17 sobrado Exp $Can't get resource limit to max data sizeCan't get resource limit for data sizedvpfnyb:l:T:t:-b %smalloc failedonly one -t option may be specified./dev/%s: unknown special file or file system.rorwrq%s has unknown file system type./usr/sbin/sbinufsffsfsck_%sstart %s %swait %sno %s fork%s/fsck_%sexec %s for %sexec %swaitpid%s: %scheckfsInvalid option stringempty type list,%s,%s-ousage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s SUNEXPECTED INCONSISTENCY:%s: %s (%s)%s, disk %s: %s %s in fstab more than once!mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block xresolveswapstaticssthreshshowsendpipesarttvarrttrejectrecvpipepushproto2proto1priorityprefixlenpopoutnostaticnojumbonetmasknetmtumplsmpathmonitorlockrestlockllinfolinklabeljumboinet6inetinifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpireencapdstdeletecloningchangeblackholeadd "x"p`"h"X"H"p"x"p"@"8masterbackupno networkinsertedno ringactiveno carrierbotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullsocketmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) write to routing socketgot only %d for rlen %-20.20s done king bula sez: set_metric with invalid key-in requires -mpls-out requires -mpls-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %s0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway netmask missing%s %s %s: gateway %s (%s) not in tableentry in userouting table overflow: %s 64128inet6_makenetandmaskinternal errordefault%s: bad value%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybad label: %s is %sprefixlen is not supported with af %dactual retrieval of interface tablereadgot message of size %d on %smonitorso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelwriting to routing socketread from routing socketRTM_IFANNOUNCE: iface arrival/departureRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routeunknownrouting message version %d not understood%s: len %d, if# %d, name: %s, link: %s, flags:metric %d, flags:if# %d, name %s, what: arrivaldeparture#%dpriority %d, table %u, pid: %ld, seq %d, errno %d flags:print_rtmsgnoneconnectedospfis-isripbgp route to: %s message length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s priority: %u (%s) flags: label: %s %s use mtu expire%8llu %8u%c %8d%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: inet %s; %s: inet6 %s; sodumplabel too longinvalid table id: %sUGHRBD M@dmCXLS1@2 3cJroute-sysctl-estimatesysctl of routing tableRouting tables spd-sysctl-estimatesysctl of spd Encap: %-18s %-5s %-18s %-5s %-5s %-22s SourcePortDestinationProtoSA(Address/Proto/Type/Direction)%-16s %-10s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %s Iface%-6.6s %5u %8llu %5u %5s - %2d %.16sp_rtentry InternetInternet6EncapMPLSAppleTalk %s: Protocol Family %d: %s%-*s %-5u %-*.*s %-5u %-6unone/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-*.*s p_flagsdefault(%d) %sroutenameinvalid%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%dillegal prefixlen%s/%dnetname6af %d: %s0123456789abcdeflink#%dPOPSWAPPUSH?%u%%%s%u%-16s %-10s %-6slabel_print/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] appendSTOUSTORAPPElocal-filesusage: %s [-c] local-files %s: not foundmputr+wwusage: %s remote-file [ local-file ] RETRgetitremote-filesusage: %s [-cr] remote-files can't get cwdSkipping non-relative filename `%s' mgetonoffConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory local: %sLocal directory now %s getcwd: %slcdusage: %s remote-file DELE %susage: %s remote-files from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again latershellusernameusage: %s username [password] [account] USER %sPassword:PASS %sAccount: ACCT %sLogin failed. userPWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmore|%sCan't allocate memory for $PAGER?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenamerecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletecrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. domacroExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sCan't allocate memory for transfer bufferWriting %sReading from fileSuccessfully retrieved file. %d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]80:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Redirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}cdRetrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. hookupNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %lldr+w%s %slocal: %s: %snetout: %ssendrequest receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomeEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR abort_remote@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46AaCc:dEegik:mno:pP:r:tvVkeep alive amount is %s: %s-retry amount is %s: %sRetrying... mainftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$%sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AaEegimnptVv] [-k seconds] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] stringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initftp_loginsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swLISTNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob2%s %s? Continue with %s? ? help a answer yes to all n answer no p turn off prompt mode q answer no to all y answer yes Prompting off for duration of %s. Interactive mode: off. ?, a, n, p, q, y are the only acceptable commands! confirm%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. .Unable to determine real path of `%s'fileindir KMGTP %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d ptransferA.>?P/etc/dhclient.confking bula sez: len mismatchlink state %s -> %supdownFAILalias_routehandlerc:dl:quifi callocclient callocconfig callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link .... sleeping got link /dev/nullcannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"nobodyno such user: nobodypipecan't open and lock %s: %mwcan't open %s: %mPREINITsocket(PF_ROUTE, SOCK_RAW): %m/var/empty/chroot/chdir("/")setresgidsetgroupssetresuid%susage: %s [-dqu] [-c file] [-l file] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.DHCPOFFERBOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease.No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping.EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.lease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbininterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %d\%03odhcp option too largecannot fork%s [priv]poll error/sbin/dhclient-scriptrCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting string.option data buffer %soverflowoption data buffer overflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementgetifaddrs failedno space to remember ifp%s: not foundNo live interface to poll onpoll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %minterface_statusCan't allocate timeout structure!interface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfsocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetoption %s (%d) larger than buffer.rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cScpretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_optionDiscarding packet with invalid hlen.DHCPOFFERDHCPNACKDHCPACKBOOTREPLY%s from %s rejected.eof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal buffer#*0#*("#*#*#*#*#)#)#)%#)#)#)#) #)#) #)p&#)h#)`#)X#)P##)H#)@#)8$#)0#)(#) #)#)#)#( #( #(!#(#( token-ringtimeoutsupersedeserver-namesendselect-timeoutscriptretryrequirerequestrenewrejectrebootrebindprependoptionmediummedialink-timeoutleaseinterfaceinitial-intervalhardwarefixed-addressfilenamefddiexpireethernetdenydefaultbootpbackoff-cutoffappendalias%s exiting.exiting. %s line %d: %s%*c^ subnet_numberbroadcast_addr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets#EX#EP#E@#E8#E(#E #E#E#E#E#D#E#D#E#D#E#D#E#D#E#D#E#Dp#E#D`#DX#DH#D@#D0#DX#D #DX#D#E8#D#DX#C#DX#C#C#C#C#C#C#C#D@#Cx#Cp#CX#CP#C8#C0#C #D@#C#C#B#E8#B#C#B#C#B#C#B#E8#B#C#Bh#C#BP#CP#B8#C#B(#Cp#B#CP#A#C#A#DX#A#E#A#E#A#A#A#E#Ap#E#AX#Cp#AH#DX#A8#E#A #E#A#E8#@#CP#@#Cp#@#Cp#@#E8#@#@#@x#DX#@`#D@#@H#CP#@0#CP#@#DX#@#A#?#A#?#A#?#DX#?#E#?#DX#?#DX#?#E#?p#E#?`#E#?P#E#?@#E#?0#E#? #E#?#E#>#E#>#DX#>#A#>#A#>#A#>#A#>#A#>p#A#>`#A#>P#E#>@#A#>0#A#> #A#>#A#>#A#=#A#=#A#=#A#=#A#=#A#=#A#=#A#=#A#=p#A#=`#A#=P#A#=@#A#=0#A#= #A#=#A#=#A#<#A#<#A#<#A#<#A#<#A#<#A#<#A#<#A# n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@#ip#i`#iX#iH#i8#i(#i#i#h#iXincompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.2.3@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_readuser is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-fh] [-R [-H | -L | -P]] %s file ... [owner][:group]group$OpenBSD: dir.c,v 1.23 2008/06/10 23:10:29 otto Exp $lost+foundwrong type to dirscan %d dirscanDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEfileerrorUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTmkentryUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u linkupmakeentryNO SPACE LEFT IN %s (EXPANDED) EXPANDexpanddir$OpenBSD: inode.c,v 1.31 2008/06/10 23:10:29 otto Exp $DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS ckinodePARTIALLY TRUNCATED INODE I=%u%siblockbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %lld %s I=%u BAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.33 2008/06/10 23:10:29 otto Exp $dfpnNyYb:c:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... -%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing The following duplicate blocks remain: %lld, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** checkfilesys$OpenBSD: pass1.c,v 1.27 2008/06/10 23:10:29 otto Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlink convert symlink %d(%s) of size %llu bad direct addr: %ld bad indirect addr: %ld LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%ld should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.16 2008/06/10 23:10:29 otto Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.28 2008/06/10 23:10:29 otto Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d pass2check$OpenBSD: pass3.c,v 1.13 2008/06/10 23:10:29 otto Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.18 2008/06/10 23:10:29 otto Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d $OpenBSD: pass5.c,v 1.37 2008/06/10 23:10:29 otto Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: setup.c,v 1.40 2008/06/10 23:10:29 otto Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs  @Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED) INCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for stmap cannot alloc %zu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.35 2008/06/10 23:10:29 otto Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [Fyn?] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY CANNOT %s: BLK %lldProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfo?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/asprintf%s %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'updateasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %sspacetime%s: unknown optimization preference: use `space' or `time'.file system size is %s: %sffsnewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %lld%s: no default sector sizewarning: changing optimization to space because minfree is less than %d%% mainioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special %s: initializing cg %ld/%d siginfocallocmmappreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %dreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each super-block backups (for fsck -b #) at: cannot allocate I/O buffer %lld, %sfsinit1 failedfsinit2 failedmkfs>inode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dCOLUMNSilog2: %d is not a power of 2 dfiPRr%s: %s%sfts_read%s: is a directory%s (inode %u): not overwritten due to multiple links%s: mallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRr] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejecttf:TAPE/dev/rst0%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGET76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d) density: %d (%d) %s=%o%s=%xusage: %s [-t] device usage: %s [-f device] command [count] strdupLost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sO%s %d rmtopencloseC statusS I%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pinvalid file mode: %s%s/usage: %s [-p] [-m mode] directory ... $OpenBSD: compile.c,v 1.24 2007/03/20 03:50:39 tedu Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %scompile_re123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthcompile_trcompile_textunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.12 2007/10/16 20:19:27 sobrado Exp $ae:f:nuusage: sed [-anu] command [file ...] sed [-anu] [-e command] [-f command_file] [file ...] stdout: %sr%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $%s %s: %s%lu \%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryafree: %p not present in area %pLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx#0#(-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %d %s%s%s: arguments must be jobs or process IDs%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm# "# # # # #  # 0# ) # +# (#x #p x#` #P #@ '#8 p#0 * #( * # 3Tbind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskc_umask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)#P#H-setfv%s%*ld.%02ld%s%s%*ldm%ld.%02lds%s real real user user sys system :ptime: -%s unknown optiontime: -%s requires an argumentm:invalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p# 9# 4# QH# D|# P# D|# A|# N|# CX# 4# CX# F# 4# H# B# ;D# ;#x QH#p 4#h `4#` 5#X G$#P O$mknod*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator#x#p#h#`#X)(!-a-o1%s: %s%s#t#f#c#d#s#pl#`m#Hn#8pprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)usage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s unlimitedinvalid limit: %sexceeds allowable limitbad limit: %sunlimited %ld COLUMNSLINESx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`\ #` #H #0 X# (# # # # 8#Ȱ #Ƞ #Ș #Ȉ #Ȁ @#x #h $#` l#P #@ #0 h#  # # p# ,# @# T# #Ǹ `#Ǩ #ǐ #ǀ t#p #` #P t#H D#8 # # # # # #Ƹ #ƨ h#Ɛ #ƈ 8#x 0#h ,#` #H `#@ #0 # # # # P# #commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not setunable to allocate memory%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s#ΰ#Ψ#ΠREPLY-rreadPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]history functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrink%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX4#H#8#argument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sj_printremove_job: job not found (%s)no closing quote yylexhere document `%s' unclosed \$PS1PS2\%c%a %b %d%d%T%l:%M:%S%r%RPWDHOME/~/%s%cdoppromptmissing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-iHOMEPATHSHELL-xKSH_VERSION-rtypesetksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin-sh/shSH_VERSIONPWD.$ # PS1\$-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV# ###P#USERroot?include: %dshell: %dUse `exit' to leave ksh @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF#a##c####e###i#k#l#xX#pm#`C#Xn#Pf#H#@#8b#0u# ##p#r##s#h#v######xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacs-usemetaemacscsh-historybgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %sgetoptionso:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad numbergmatch*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argumentunlimited%s'\''%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)shf_vfprintftoo many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name ####x#p#h #` # # #X #P#H#@#8#(# #{#}######## newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!()#0#8#@#H#P]]<>ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s4# ###### # # # ##p#`#X#P#H#@LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript %ld out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzstr_val%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp--%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%seval5non-numeric argumentdivision by zero--%d %s _msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: %s [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] /var/run/utmplogoutRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelreadlabelfsr%s%s%s%c/dev/%s%s%s/etc/fbtabr /dev/%o%s: bad entry: %s(null):%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...login_protect0B%lld%c%lld.%1lld%c/var/log/wtmplogwtmp\\#TERMCAP/usr/share/misc/termcapTERMPATHHOME%s/%s.termcap /usr/share/misc/termcaptgetentOOPS?nYacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error G??C00=A@A@Alongjmp botch. inet6_rth_reverseno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error : xxswufsswap ,rwrqrofstabscan/etc/fstabrfstab: : sscanfRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s rcmd_af0iruserok/etc/hosts.equivr%s/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owneriruserok_sa__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopudptcp%ugetnameinfoip6_parsenumeric/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh rcmdsh: execvp %s failed: %s $$p$P$8$No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver errorrresvport_af__elf_fdnlistABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u%u.%u.%u.%uinet_ntop4%xinet_ntop6%s: %s$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ x$ p$ h$ `$ X$ P$ H$ @$ 8$ 0$ ($ USR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0sh-c/bin/sh$ $ $ $ p$ h$ X$ H$ 8$ ($ $ $ $ $ noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xregerror0%doffonsecurelocalrtsctssoftcarmdmbufwindow/etc/ttysr/dev//var/run/dev.dbttyname_r%s: /etc/protocolsr IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbyname/etc/networksr %s: : %s %u/etc/grouprgroup.byname%ugroup.bygid: grscan/dev/tty readpassphrasetcsetattr%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrether_ntohostethers.bynameether_hostton HOMEglob3.g_opendirg_lstatg_stat: master.passwd.bynamepasswd.byname__YP!+__has_yppwmaster.passwd.byuidpasswd.byuid%u__yppwlookup_pwhashbyname/etc/spwd.db/etc/pwd.db%s: %masprintf*netgroupnetgroup.byusernetgroup.byhostnetgroup: Cycle in group `%s'%s.%s(%s,%s,%s) ,/etc/netgroup.db+%s: yp_first: clnt_call0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]authunix_create: out of memory authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problem$$$$x$`$P$@$0$$$$$$$$$$p$`$P$@$($$$$$$$$p$X$@User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0$$$$x$`$P$@$0$$$$$$$$$$p$`$P$@$($$$$$$$$p$X$@option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cinet_net_pton_ipv4n >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" //dev/nullgethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpagethostbyaddr/etc/hostsr %u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname...RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs/etc/disktabb0b1sfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx%s.dbtcgetentr:\|:cgetnext/bin/shsh-cexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvpxdr_array: out of memory %s: : %s   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~...realpathvfscanf:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy$1$%s%.*s$md5cryptMD5Padstack overflow in function %s__stack_smash_handlerGMTabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page../etc/localtime/usr/share/zoneinfo/tzloadmnposixrules,M4.1.0,M10.5.0TZ?SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%Y%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_call$?$?$?$?$@$@$@$@$@$@tcpudpfbfexplore_numericgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswer# _gethtent/etc/hostsrhosts.bynameipnodes.byname%s.%sres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASESr__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conffLOCALDOMAINrbf;#domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenv_res_initndots:debuginet6insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$Gp$Gh$G`$GX$GPANYHESIODHSCHAOSIN$Np$Nh$N`$NP$NH$N($N $N$M$M$M$M$M$M$M$M $M$M $Mx$Mp $Mh$MH $M@$M( $M $M$M$L$L$L$L$L$L$L$L$L$Lx$Lh$L`$LP$LH$L@$L8$L($L$M($L$L$K$K$K$K$K$K$K$K$K$Kp$Kh$KH$K@$K $K$J!$J$J"$J$J$J$J$Jx$Jh$J`$J8$J0$Jd$J$Ie$I$If$I$I#$I$I$GP$I"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%d/etc/servicesr ,/invalidtoo smalltoo largesyslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%ld]Error %d /dev/console vsyslog_r/dev/logconnectlog_r$R$R$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Qx$Qp$Q`$QX$QH$Q8$Q0$Q($Q $Q$Q$Q$Q$P$P$P$P$P$P$P$P$P$P$Px$Pp$PX%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%e-%b-%Y-+%04d_fmt_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD_yp_dobind%s: %s; errno = %s; low version = %u, high version = %u; why = %s(unknown authentication error - %d); s1 = %u, s2 = %u ... $V$V$Vh$VP$V8$V($V$U$U$U$U$UX$U8$U $U$T$T$TRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s %s: %s - %s %s: %s $W$W$W$W$Wp$WP$W8$WFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKclnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory : perrorlibcUnknown error: Unknown signal: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC_catopen$c$c$c$cx$c`$cH$c0$c$c$b$b$b$b$b$bp$bX$bH$b8$b $a$a$a$a$a$a$ah$aX$aH$a0$a $a$`$`$`$`$`$``$`@$` $`$_$_$_$_$_x$_`$_@$_$^$^$^$^$^$^`$^@$^ $^$]$]$]$]$]h$]@$]($]$]$\$\$\$\$\$\h$\P$\8$\ $\$[$[$[$[$[p$[X$[8$[ $[$Z$Z$Z$Z$Z$Z`No message of desired typeIdentifier removedOperation canceledValue too large to be stored in data typeWrong medium typeNo medium foundIllegal byte sequenceAttribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$f$f$f$f$fx$fh$fX$fH$f($f $f$e$e$e$e$e$e$e$ex$eh$eX$e@$e($e$e$d$d$d$d$d$dp$dXUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0xdr_bytes: out of memory xdr_string: out of memory snprintf__sbprintfInfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.vfprintf__find_argumentsexponent?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5InfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@? ((((( AAAAAABBBBBB $j$j$j$j$j$j$j$k$k$k.isatty%$sniglet^& error: warning: unmapmunmapmalloc cache underflowmalloc free slot lostmalloc cache overflowmalloc cache/etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONSmalloc init mmap failedomalloc_initomalloc_grow munmapinternal struct corruptregions_total not 2^xpp & bitschunk info corruptedchunk overflowmodified (chunk-) pointerchunk is already freenot on queuemprotectrecursive call in malloc():out of memorybogus pointer (double free?)bogus pointerguard size in free(): in realloc():arc4_stir/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binHASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpopen_temp!!0! 4!$!9 !U<!Ul!s!y8!!!! !'`!0!$!`!,!)!)!x#0!p5`!h5`!`5`!X_|!Hi!@n!8!(!!|!!!q!q!wP!{!\!$|!$|!$|!l!l!l!vX! H,!x d\!h d\!` t!X !P !H  !@ !8 !0 !( ! ! ! ! !$OpenBSD: args.c,v 1.17 2006/11/01 05:46:20 ray Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.15 2007/11/10 13:45:17 chl Exp $$OpenBSD: misc.c,v 1.15 2006/03/22 18:08:04 dhill Exp $$OpenBSD: position.c,v 1.9 2006/11/07 18:47:46 otto Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.18 2007/03/21 13:44:04 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.49 2008/03/16 20:04:35 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.48 2007/11/17 17:18:32 krw Exp $@!8!0!!!!!!!!!!!!!!!!!!!!!! !p!!`!X@!@!!0!(! ! !!!!@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.6 2005/02/02 19:23:17 jolan Exp $$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $![!\!\t!\t!x^!p\!h\!X\!P]!H]h!@]!8_!0^ !(_! ^L!_!_!^x!^!^!_<!_\!_$OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.12 2006/06/04 01:35:05 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.12 2008/05/17 23:31:52 sobrado Exp $!!!!x!p!h!`!X!P!H!@!8!0!(! !@!8!(!!!!!!!!!!!!!!!!8! !!!!!!!!!!x!p!h!!!`!!X!!!!!!P!H/tmp/EdDk.aXXXXXXXXXXt$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.168 2008/06/25 18:31:07 otto Exp $!@!8!0!(! !!!!!!!!!!!!!!!!θ!Ψ!Π!Θ!ΐ!@!Έ!΀!x!p!h!`!X!!!P!H!0!0!0!0!0!0!0!(! !!0!0!!0!!0!0!X!0!0!! abcdfiklnoprstuvwxBDEGHLPTUXYZ0"4x[J \`O`KJ : 8\"4pLMJ N$OOPKJ : 8\"4hnSxJ TVOW KJ : 8\"4`nSSTVWW KJ : 8\"4X(,08: 8\ "4P(0,8: 8\48vDd.? ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.19 2007/07/17 07:10:22 jmc Exp $"x"x"x"x"x"x"xwFwF`wFwFpwFwI|wIwI$OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.29 2007/05/07 18:39:28 millert Exp $P.4$OpenBSD: print.c,v 1.25 2007/05/07 18:39:28 millert Exp $$OpenBSD: util.c,v 1.13 2007/04/25 08:16:10 sobrado Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.Ad"""""""" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)44"a4y""b4@yڐ""B4y"X"(c4y"""d4Ay""xe4y"X"@" f4y""F4y""g4y"p"@"h4y""HAy""i4y"h"P"(j4y|""J4!y""lHL4y""m4y"p"`"Pn4"y"8" "p4HLP4ـ"q4y"""r4"y"X"0"s4!y""S4!y""u4"y"h"H"0V4w4"y"""x4(۔""xX4Ay"P"0y4y""z4y"""4"~4!y""`?4#4y"H"(.4Ay""y (press RETURN)... (interrupt to abort)"x"" 382@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $"H"""""A"B"C"D"E"F"G"U"V"xa"hb"`c"Xe"Pf"@h"0i"L"l"n"q"q"r"s"v"w"x"xu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.20 2008/03/26 06:55:06 otto Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $"8"(@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.16 2007/12/30 13:52:40 sobrado Exp $"̈"x"h"Ұ"Ҡ"Ҙ"Ґ"҈"Ҁ"x"p"h "` "X "P "H "8"0" """"""""""""Ѹ"Ѱ"Ѩ"Ѡ"ј "ѐ!"ш""x#"p$"h%"X&"H'"@("8)"0*" +","-"."/"0"1"2"3"4"и5"h""""ڰ"ڀ"P"(""""٠"p"@" " priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL"""""""""""z h"""4 @"4 0x"x4 "p4 @"h4 T"`4 l"X4 ,"P4 D"H4 "@4 \"84 ("04 "(4 " 4 4"4  "4  x"4 "4 "4 D"4 "4 "4  "4 4"4 "4 "4 "4 "4 ,"4  "4 ."4 "4  x"4 )"x4  @"p4 "h4 "`4 "X4 "P4 "H4 -"@4 ."84 |"04 |"(4 ." 4  x"4  "4 d"4 "4 ."4 '"4 ,"4 "4 "4 "4 @"4 ("4 D"4 "4  "4  "4 ,"4 )("4 "x4 "p4 ."h4 (p"`4 @"P4 "H4 L"@4 ,"84 "04  "(4 (@" 4 )"4 |"4 "4 "4 x"4 "4 t"4 Q"<NOOP #( 0(EHC P E(  0(EHDHC ;Zx0N@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.29 2007/05/11 01:53:07 tedu Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $$OpenBSD: buf.c,v 1.18 2008/02/12 07:57:29 otto Exp ${"$OpenBSD: cbc.c,v 1.15 2008/06/08 13:58:10 tobias Exp $@ $OpenBSD: glbl.c,v 1.11 2007/09/03 14:26:54 deraadt Exp $$OpenBSD: io.c,v 1.12 2007/11/06 10:22:29 chl Exp $#Q$OpenBSD: main.c,v 1.31 2008/04/21 11:22:14 tobias Exp $#R#RH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.9 2007/09/02 15:19:07 deraadt Exp $4#V$OpenBSD: utils.c,v 1.29 2007/09/22 21:10:49 sobrado Exp $#Yx#Yh#Y`#\#\#\#\#\#k ... ...####################x#p#`#X#P#H##@#8#0#(# #############################H#P#P#P#P@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.40 2007/09/03 14:26:54 deraadt Exp $ O,$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $############@#@@@%s: can't read disk label; disk type must be specified......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.22 2008/06/10 17:14:16 otto Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.29 2006/06/14 02:14:25 krw Exp $#X#P#H#@#8#0 #( # ##########@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.21 2008/02/13 14:50:51 millert Exp ${}abcdDgGhHilnNpPqrs tw xy !:#={Nl{Np P# ### ##### ### ####`#X#H#8#(#####۸#ۨ#ۘ#ۈ#p#X#h#`#X#P#H#@#8#0#(# ##########({R _@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.34 2007/07/27 02:49:38 ray Exp $#@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $##x#p#h#`#X#P#H#@#8#0#(# ###0#(#################(####p#p#p#p#p#p#p#h#`#X#p#p#P#p#H#p#p##p#p#@#8BKMGTPE@5MS7)  l v {x$$h$X$8$($$$$$$$$x$X$H$( $$ $ $ $ $ $ $ $ x$ P$ @$ ($ $ $ $ $ $ xx:xx:xx:xx:xx:xx$$$$$P$$H$@$$8$$$$$$$$$$h$$`$$$$$$$$$$$$$x$$$8$0$($ $$$$$$$$ $ $ $ $ $ $ $ $ $x $p$h$`$X$P$H$@$8$0$($ $$$$$$$$$$$$ $!$"$#$$$p%$`&$P'$8($ )$*$+$,$-$-$.$.$/$/$0$1$2$3$4$5$6$x7$p8$h9$`:$P;$@<$0=$>$?$@$[$\$\$]$^$^$p_$`_$P`$@{$({$|$}$}$~$U0U8U`VW?$($"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$#$#$#$#x$#p$#h$#X$#P$#H$#@$"$#8$#0$#($# $#$#$#$"$"$#$"$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$%  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$<؀0123456789abcdef 4848}Kh4X&%&&@}4Ұ&%&&@} 4&%&&@}4H4XȤɠ$B wTzzPzp{$z0~8@H\h,h,<d\|4[ 0000000000000000}i}$i$j$j?,@$.shstrtab.init.text.fini.rodata.data.eh_frame.pltpad0.pltpad1.gotpad0.ctors.dtors.gotpad1.bss.note.openbsd.ident LL``||!۸%4U+45D>DGdPd Wd^dgtXl44 . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } stdsize () { local _p= _s= _sz=$1 set -- " " K M G T P E Z Y while (( ${#_sz} > 3 )); do shift _p=${_sz%[0-9][0-9][0-9]} _s=${_sz#$_p} _s=${_s##+(0)} _sz=$_p done (( _s > 500 )) && : $(( _sz = _sz + 1 )) echo "$(( _sz * 512 )) ${1}Bytes" } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp $FTPOPTS -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && chmod 600 $_hn && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && { _prompt=" or 'dhcp'" ; : ${_addr:=dhcp} ; } _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o "/mnt/$_f" -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } set_ftp_opt() { local _q=$1 _opt=$2 ask_yn "Use $_q?" $(isin $_opt $FTPOPTS && echo "yes") case $resp in y) FTPOPTS=$(addel $_opt $FTPOPTS) ;; n) FTPOPTS=$(rmel $_opt $FTPOPTS) ;; esac } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $FTPOPTS -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then set_ftp_opt "active mode ftp" "-A" fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _d ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local ask "NTP server? (hostname or 'default')" default if [[ $resp != default ]]; then set -- $resp sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf fi fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -n $CDEV ]] || return _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" [[ $resp == n ]] && return ask_which "speed" "should $_d use" "9600 19200 38400 57600 115200" \ $CSPEED [[ $resp == done ]] && return sed -e "/^$CTTY/s/std.9600/std.${resp}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /mnt/etc/ttys >/tmp/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $resp\nset tty $CPROM" >>/mnt/etc/boot.conf } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=44 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" FTPOPTS="-V" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b ELF@4,+4 (@@,*\2҈0P xHP rHP nHP jH`HzHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H  H  H H H H H H H H HP @HP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H0P  HP  rHP  nHP  jH`HzHP  ^HP  RHP  HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H H H   H  H   H H H  H  H  H  H  H  HP qHP  HP ! HP " HP # HP $ HP % HP & HP ' ޡHP ( ڡHP ) ֡HP * ҡHP + ΡHP , ʡHP - ơHP . ¡HP / HP 0 HP 1 HP 2 HP 3 HP 4 HP 5 HP 6 HP 7 HP 8 HP 9 HP : HP ; HP < HP = HP > HP ? ~HP @ zHP A vHP B rHP C nHP D jHP E fHP F bHP G ^HP H ZHP I VHP J RHP K NHP L JHP M FHP N BHP O >HP P :HP Q 6HP R 2HP S .HP T *HP U &HP V "HP W HP X HP Y HP Z HP [ HP \ HP ] HP ^ HP _ HP ` HP a HP b HP c HP d HP e HP f HP g ޡHP h ڡHP i ֡HP j ҡHP k ΡHP l ʡHP m ơHP n ¡HP o HP p HP q HP r HP s HP t HP u HP v HP w HP x HP y HP z HP { HP | HP } HP ~ HP  ~H ġHP  vHP  rHP  nHP  jHP  fHP  bHP  ^H H HP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~HP  zHP  vHP  rHP  nHP  jHP  fHP  bHP  ^HP  ZHP  VHP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 0P  HP  rHP  nHP  jH `H zHP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H  H  H  H  H  H  H  H  H  H  H  H  H  H  ޡHP  HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H > (;8;;;;; ;(;0H )@`  > (!  > (;8!5 > T0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; > ( 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> ( %)> ʨ!| %"+/> -> (+cP>  ,`" ,#t@>  ;x ;"`;" @@{Ҋ@@2 @ 0P -@ @ @"P/> P-> ( %)> ʨ!| %"+/> -> (+cP>  ,`" ,#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @gt x ``-`ׁ @[ tx ΁ )>!@!P -@ @ @"P/> P-> ( %)> ʨ!| %"+/> -> (+cP>  ,`" ,#t@;x;;>!! ;`#h#l;;;;@ ``htx ;`#h#l;;;;@ ``htxm )>) <@)>) P -@ @ @"P/> P-> ( %)> ʨ!| %"+/> -> (+cP ;`@;h#t;x;;;;;`@ ;`htx' /> -> (+cPۜP -@ @ @"P/> P-> ( %)> ʨ!| %"+/> -> (+cP ;`@;h#t;x;;;`;;@ 8;`htx -?P -@-P -@ @ @"/> /> /> 6PP-> ( %)> ʨ!| %"/> /> /> P;x>  4`" 4@;,/,;@ ;`,;h)>  #pH  p@  "`@`E <0x  +?P`-@-?P- %0P -@ @ @"/> /> /> 6PP-> ( %)> ʨ!| %"/> /> /> P;x>  4`" 4@;,/,;@ ;`,;h)>  #pH  p@  "`@  0@@|`x) `E <P -@ @ @"/> /> /> 6PP-> ( %)> ʨ!| %"/> /> /> P>  4`" 4?P * * ;`@;h09P -@ @ @"/> /> /> 6PP-> ( %)> ʨ!| %"/> /> /> P>  4`" 4?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@>`h ?P `*  P -@ @ @"/> /> /> 6PP-> ( %)> ʨ!| %"/> /> /> P>  4`" 4?p " ?P "  ;`@;h@6`h ?p " m @/>  @̀-> ( $)> ʨ!| %-> (+cP-> ʬ VP @ H ,@`#> a($` (08 @̀;)> !T0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> (%- +cP ;`@;h #t;x;`;;;;@g;`htx -> (& 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%> ( $!> !(`8 (0 @̀@ @̀  H ,@`#> a($` (08@̀܀2>?@ @̀;'> T0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> a( $`!> !(`8 (0@̀ -> ʬ  @wP-> ("/> 4ΐ  ! H,@` !X (08@HP @̀> ʖ| `?* `"" * `@"> ʖᛒ  * `@&* *  ֊@* "``'1@'0@ )>+>%@#' $(   ʒaC ʔ8  ʔ8  c  mt@ >   >  @@   >  @@ #>%>Ĥ a@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c@> "!, *> "!P!`> "!TH(  /  > <==> ʜxH > "!X> "\> Ēb@ lb"@!> $ H``> "` !>%#!>' $ $ >& 2> " > " > "!> "!<>#"">#"">#"#D>#"#l>$"" >$""H>$"">$"">)"!$>)"!,0>*"#@@ d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    "%> > > "  "> >@ >  !(>&c# !(>&c# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * > ʁ >@ *> ʁ (>' p@" > (" > ("   > (4``6 > >(:H"(o  (5<`!4"j j ` *@  ( !(> !` (08$2㿠@S> a,` Ъ@@>€"Т@: H" H*/  dXh> (>'b" `2 `2`2" " ?" ?@>'b" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"`2@"" R"`2@"" "`"@"" R"`2@2J?*> a(>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >) "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a> a """"""""""""""""@2?# * 2  ac  @ a> 4? @ 3 > ! c@  Њb@&""""  > c@ @> ` ``44: " longjmp botch `&"`㿠>*@#6 0㿘``@`€Ő  ``€  `€ <`㿘``€  *`,`€ ``€  `€ >怎㿘 ͖  Ȗ Ö   ``€g ```€ _ ``€Y @€` ```€ L ``€F    .@€` 2```€ 3 ``€- 耤 ``€$   㿘M e  ` [ V  Q L ``€  0$\htd(L44455H.t...// /<55/X/t///5122383|315555555551x15555555555555531x1l1`1T1H455555555517777766777666666777776677777776A(788@:;X;>(>\>>CC?4?\???@@0@XA@BCCCCCCBLBLC(C\x!> ! c8.!퀊F !!  €* 2 aS 2!!`€ * 2 ` 2!!`€ * 2  "!!  `@@ eq  7@$ @2 !6!6!6!!@ &!!`  ! /     6!6!6! 6!  6!6!6!6!! `@! ` : ` ">  0  > ! @ >  !#@#H> #P#X!`  !`! !`  !`( !`  7 `! <.!  ">  "$c`  d .!> #h > > #p#x  d! .!>  # 2> > ##x! `v€a id+ &> @2"+ @> > $#@> > $ # @> > $#Ȑ @9  !> ؙ3  @8 !    ! av€a  ̀id+ '> @#+ @> > $# @> > $#  @> > $#Ȑ > ؙ3  @8 x !`!€  `*`>+# €> @8 >   ( >   ( >   < >   <  (>   < 0>   < 8.!.!! `v€! >  @8r@ *@$! ` €!* 2``2   >  @8TX  $ <.! *@$!*`"  !@ +.!  !>!>!`"!@! !`  F d!!   " ! B   !`  0 d!!    ! @  !`  ` # d?< !! > €`p0!  !`€  " !0!`€  !  !`  !`  !% @ d!`  ! 5 !`( `€ * 2 `  ! !`€  * 2 ` ! @`€ * 2 ` @! .!! 0!  /( !! @! `@ ! `"!@! / { #u d? t> !`€* 2  @ bӒ 7@"b a! C@ b’ 7/b <)!777777@"A 耢B7" @/"?#@! )!@" !> #`#\@6 0!`$  ! "! ! /#( ;`$ &"$`6" 6"@ be! 77$@7@!  "> "@6  @ bJ  77@!ה 耢@> є!  &!!* > &!@6 @@ b,  77@! !! !  @ b ! 477@! @ b  7@! @!2  ` ꀥ   %6!6!6!6!6!6! !> !p> !x!> !0#\! #`#d@6P! "D@!!* *`!  ! 2 > 2 @67 !`€  > @6+ !> !  !!@6 @ a  7@!5 5> 6!*` @62@"! @ > !!  .!퀊`     ! `  &!@5ޒ 0&!㿘@#F !   2!@#; ! @0@㿀!!   2!`!2 2   ! `.@ a+  27 7 7 `  7 ` @ 7@ a  672` `7@2 7@  耥@ a  572`2` `@ 7@22   7@  耢@> 3`2 23`#\   `@5L @ `֒  37 7 `7@ ` 耤 >  `X@55 0@ `  177`7@ H 耢@ !   2!@ !? )@ ` "* S"( @7777777@  i6!@ ` "& R"$!777777$7@ `t "* "( @77777@ D6!@ `^ "& "$!77777@ 耢/6!!6!@ `G ! J? 7耢 7 7!?  7ꀤ @” @> @4 !  .!㿀.*  !* @ `  07.  7@ @>   71@4j ,* ` 2``n`! 2   `@ _ .,  8@77ꀌ 77 ` `2 * @7> 2 #\#`Ȓ @43@P #@ _  87777@> 耢(@*  72!   9@ _ 77 7 7@ @2! , *  @2  !2 ! *  `@.!!!  `@.!0` 㾨'D!> 3'| '@)'|D 0"ᤓ2` ` @ _D `D  !` / ! |?# @3DD@!!* *`!  ||@ 7@|@|!D2ᤑ2 `2?#| @3|1 * 2 '@ 1 > D' @3r$$1 | *`  1  > D'8@3b  1 |`  1 `> D'`@3S  1 | `) |D  ) 1  /2DD  ! 1   @   D @ 0 @  1 @D ក /D @ᨐ ` 1 @`  D D  1 DD!!* !*`  '  @ ^' 8 77 7D7@ D ! `/ ) D ` !'D ሐ `!D ! `!Dሐ`Ჟ D! ?h }?p zpp/`'\t*`l'Lh2 7 'X'/`Xt\2'H'dHpt*L3 h'<'8l'T+8'$<*`3 2 'D p@ $ 3 '4    37`p7 ',  3'`7 7`p p7 7`  'P'@'0'( 1 g> ) W) G) ) ) /) ) ) ) ) ) ) lt#\4w) 7 ) o) ) D@2R' D>  '@2J? *@1 D!b& @b(> b$b*1 (1 $ 1 & @1 2 D1 *1 01 ,1 .1 41 6D @2+'|  @ ) )( (a2    0?# @2 *`@0D2    0?# @2 *`@0Dᤑ2    0?# @2 *`@0D!2    0?# @2 *`@0   ) ) (  ((  0 * D!2    0?# @2 *`@0   ) ) ( ( * Da2    0 ?# @2 *`@0 Da2   " 0"?# @2 *`@0"D2   $ 0$?# @2 *`@0$Dᤑ2   & ??# @2 *`@?#0&(  D!2   3 @2 *`@3 ?#0  Da2   3 @2 *`@3 Da2   8 08?# @2 *`@08 : ;) ;) :(: ;(;D2   < 0<?# @2 *`@0<Dᤑ2   @ 0@?# @2 *`@0@ B C) C) B(B C(CD!2  " D D?# @2 *`@0D @ \ |  `7   7` 777   > D@0   @D@;> 3D7!!7!7!!  /!! `` /!;> 3` > @\K (㿈!@ \M  c% 7@@7 7@Ԕ @?@  ( @@ *  `@.@! (? (㿈!@ \  d7.`% 7@@7 777@ @?@@% 㿈@ [ .` j7耦  7`7@} @5  3 /`*`-5*0  0    5`- @   -4`, @ @ -`,` @ 6@   @ > 3 'D! 'd'`5'h-B5> @|@Dd 2  @"d@ d2`@ `D @/d 2 d@2   d@Xxx"@|'p"'t沐"'p'tp*" * " *  * " * "@*`@ t*` @ :`xD**"@ " *`"@ * " *`@ *  *`"@ * " *`* #@ #+`@ |+  +` + @ > h#\D#`@/ 8А"?@hb@@ b@'hT X P?` "PH"PH 0 DT  e6X 2@ H /d * % D!P  #!P#!HH 0 e6@ ?D D;ʀ@8T#@ \DaT aX DaP?` "PH"PH 0 F D!T >h!X :hH /d * % DP  "P&"HH 0 h h#;ʀhe6@ ?D 'h;ʀ@h#@ \5h@'hhd2   2?@ Zf  7D@ @?d*`D  /d 8 d *  @" ?#d@d # +  ?D# a 22aCa* D*`!  %        D ~ dD ! ~`'ld@ ? "@* *`  *`d "- ,`+`(  l5`   @ 5-  @-`6`. .- .`d /  (  ?`+`(  ,`5- @ 6`.  @-5`- .`-`    ?`d 0D3  @ " **  '`l/`d#d @,D"@ Ddd ?#d@k ?d ""d?c !D" !`/!d@ Y^  ]7D7@ d > D> @- d@d  "d> bpd2`  ` > #\@h*  @d#`  @-Dd@3 d ` *`  d*  (#5+  *` d*  (@``@2 @d` @2@Dd @2@ @2 @  @2@$ $ " d@D '@d `'h @+hd /`D'`?` ?`ᤕ2 "@" @@" @@ ?@ ?  ?  '@@D`'@d  'h@+xh > 3  > @X  >+ȇ* >  > !> ! > !0>  !8>  !H> !P> !X> !p㾰> 3'D! ''2      ?2`   2`  @D ?@ 0g` "@ 0(" ? ((!  ` @*<  '!D '@* @ X4 `@  !   2     ! '| '||*, ' @* *` (`(@@ ?'"@*` *  *  *  : ?'t`'  @{ 'x @u ` 2`D' `Ĕ  'l?h,`'\'T( -'d'<T'4?P ', ?`\?0<'L l?Xd?8'D'$- L  , @ ?h?H?(-`4 D 0 ?@0 h, L?`H, (2 T*`P$@?h+` 3 ? @-T5 `,@.`D @$@ *32?`.`` @h?`, @?h.`h 4L@?hD*``.`h-`?`@`   ?`@ $ `-   0@3 ?h5?`* *`   @2+ 2' @2# `2 d22` 2`2t`!2 > D'x @+x @ /'`?`;` 2`D' `Ҕ ''@ V  q7 *D7@s > #*` ** * :  @+=D ?o!@ og`Y?%* *  *  *  : ' ~) x5 U`~ @ V' o7  *`x7D77@+ /'`A?@` 2>+#*` €+ &'> &@* +  + +    D'@; @*ޒ  !  ) > 'Dx@*ϒ !'  ~`~2 ) D-'  >  D@*  /'`  >  D'H@* * *`   >   02  !-,`+`(  5   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @#9   @" * *  *  *    !: 'D' @(l*D'@* > ?! 3 D' @* @ U  q7 *7D 7@7 /'`, | *  (@ h?  0(#!> 3  > @UV!x> 3'D !'2        ~_ [ pe' ('@ U=+ '@̖ * * `( '  D'' , ?`2   *`` @ D?`2   ``@  ?`'D'  2    ?2   @ 'u`> D@)T ? +`(,`  5-   6`.   @-5`-   .`-`    ?`+`(  ,`5-  6`. @  -5`- .`-`    ?` 02  @' * *`  '`/` 8' ' (!)  **@ *` `(*"`( *  * ) *  ( " ( ' /''8+  * @`@   @' 8*` *  ` +` *  @x!  t )  ,#\> #`,'D@(z  (*` * *@ *` *"`, * * )+  *  (+ `" ( * *  * ( ` ?  :"(, *  ;> +  *  @2    2 D b'@(.* * ( ?"( ( % (  ۬  @t'6+  *  ,> )@D'@( t 8+ @ *`     @ 8@ @`@@2`@2 '> D'@'ݒ M'0*` * * )+  *+`@  * :+`* * @ *` 0 ;+`+  * (  * ( ? "(+`*` * , +` +   *# , (D`"(' @% '*  (@ "ؒ"@*` *  *  *   @ 2```@ < 'D @%@ R `@   0&'> 3  > @Rא!ȁ㿀> 3 '@j @ ";!!2`  2@ p""@@28?``>, *` €> !> !> "> " >  "@>  "P> p@t% > x@'  ?@2`  ?2`   ?` > @Rz"> 3'D !'@` p$'@°  ( p#@'@@ Rk  "7@@ `!q#4 @ !c2`4  D4 4 4 4 4 $ a2  @  @@?# @2 *`@3D2    3 ?# @2 *`@3 Dᤑ2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 D2    3 ?# @2 *`@3 Dᤑ2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 Da2    3 ?# @2 *`@3 D2    3 ?# @2 *`@3 Dᤑ2  "  ?# ? ** @2@ 2@ # Da2  "  ?# ?*  *@2@ 2@ # @ Q  n7Ȓ # 7ʐ`@@7 D777ր " @@2`  p p"m'@2   ?` (@ @'t'p#D@'t $  +@ p* @ ``@   @"    `" D> > ⠘ `@%#\w@@ `??''|'l'd''''h'`@ Q <*l`* p ''`h *`d* @ @ '@ P  7` a7 `@ !7!2  7'777@ @D@ P  n  77ʘ @ 7`D777ր   '@2`   p"'@@2    @ Da@k'x  *      >  >  #\D   +` ( ,`     5-   6`.   @- -5`  .` -`    |?@ Pk | 3@  a3` `@ !2 !3` 3`3`3`3`  #`@D@@|@ PM  n  77ʖ@ 7 D77`7ր " @@2`  . p"+'@2   &@aD@ܒx  *   ` >  >  #\D@$ @2   B`U?   +` ( ,`     5-    6`.  @  -5`- .`-`     ?`t @ ( 7'D @"`t `$ 2@> D@$+ @ 0$'@> 3  > @O"؁@> 3! '@ O <  7@  a4 @ "!2 4 4 4 4 4 ` !4 ! ` 2 4 4  @  ?# @2 *`@?#0   !2   2 @2 *`@2?!2    ??# @2 *`@?#0   !2  2 @ 2 *`@2?@ O9  n  77 @@7 777@ @> @#  > @O #8> 3`   *'& & ,`02   2   >  @#l     ,4 2   > 8 @#T n  ``t 2   `$   } U& , O2`  }J 2`    & ,2  e h   o"2`!  2 h2`  2 h2`  2`   -  2Ұ h /(`2Ͱ h-*  (` `2 2`> h@" @ & , e  ;  :  퀊 @{@ > ~ 퀊 Ԣ       @Ų`?# 2  : @ N: @   -`,`,@4` ,` @2  "` `?  **` 2 2 $ 2   `, ` , ,  ` , 2  ` 4 @2 *`@4 2  ` 4 @2 *`@4 2  `4  @2 *`@4 2  `4  @2 *`@4  ` `$   * ? # '? ?   2  "@ @ *  *@ 2 @ 2 @ 2   @@ *  *@ 2 @ 2 @#$?ؚ`` 4 *2   * * `@ ,@ > `@A@ M @ ,`   ,@   ,@,@ "    2  J`   d̑-*  h"    4`   d,` "    4`  `  4` ,` `"  @ N@#* `4`   4`     "   *@`22 ?*"@0" 4 > $``@`g" `.@** &"@@!M  & , f& , > J@ $  2   #` @@!9#\` g4 4 > @L 㿈 >, (* €> @!  ?@ L ! `7! `7 7! @  7 7 ! 2* ! *  `@.!@  @2ڰ?> 8@ ْ Ұ @?# @:`@ L[ ..`@  777@  @2?> ` @ ! *2! *  `@.! ` ` !  "*@ * , 2 `> @  ?2 @ L !  7! ` .`` 777`7` .` ` .* @ 77? @ V ! P`@ /H! B` @P<! "7?k3! ".?>*! $@ K  b7 @ A@? ! ` L @ +  ?p> 3 '  . W<.!!풂`B 2+>!! 6! !< !`€, 4   `" "!L@ R  !L &!L@C!L! .!!.> 2@  !2`@p d ! . 2` @@2"!!2   2!!2   $.`> 25 @ !! €!* 2  ! `@!`  + ! /!`€!!* 2`  7> !@i !!7!  02/!! 8+! !`€!!`€!* 2 -`2 @ #$!@! `@> (@4  `€!-`2@ 6!2H! 2E!! /(!: d!`€!!` ` €-`2@' ! /!`€ !`€ .!.``B >!,`> #\X23  @4 !6! `@!`  ! | 4  6! L?# * !"   ?2` 7`  ``"@ؔ!2  " ? *` * 2 2 !2  &` @2 *`@!2  6`  @2 *`@!2  6`   @2 *`@!2  6`  @2 *`@!2  6` @2 *`@!2  6` @2 *`@!2  6` ?  **` 2 2 &` ` ` *   *  `Fp@Qr  , r !?2  ct* @2 *`@3@ r rt*2@r  rt, @ @*r, r!ꀢ *6!@Ζ !@!2  " ? *` * 2 2 !2  &` @2 *`@!2  6`  @2 *`@!2  6`   @2 *`@!2  6`  @2 *`@!2  6` @2 *`@!2  6` @2 *`@!2  6` ?  **` 2 2 &` ` ` *   * @5> #\@O ! %> !> @C  /'> %>  ` @ @jG  @2` @+ @/@ H @ ` , >  @a! > @ ` > @ ` > А@ `> @ !`  2`@ Hu @`> @ `@)!  (" *  ?`"*` @ HY @@  > `@@Ò  ! > `h@ !`!02 ` *2 @"* "@`  $`,` !2` `$``!*  .!퀤 $`,! " ` `"`  6` ` @"@` ,`X@> @`, 2 ! `X 2! $`,! >`$`(` "` `X 2`"``, 2` $`,` `4 ǐ` "J> `   d!̑* *  @ " ` ! d  !  .!-> `@2 $`(` , "$`(`$`(` @> `X 2`$`""`$`, 2` $`,` `4 ݀`  6` > `$`@ @"`$`  (,`X $`,`, 2 `$> @  $`,`$ $`(@ے `, 2`$ $`,`$ " !! `! 2` 0`, 2` `X (` @" `X `6   W 0  . ?` ( 8 >  2 `$#\`( #` `X #d#h`,#l@! "-!?6!-" @ G @@ -`2  !`!!`€!!6!@&6! 6!6! , `!ؖB@>!ؠ ,   > @FА#㿀!   2 '! ` €* 2 '.`4 >  @@0?ߐ#@`?>, h*` €! 2*  ! *  `@.! @h @b @ ݐ @\ ?> ) > &@!`€!> `@ 0v> @ 0o> @ > => > @ڒ ! `€@h!> d0.`D> @@.`> (@ ! *#!* "! 1"@@ !  "!* #!* "> `@ ! *@"! "!* "> 2@~ ! 2* ! *  `@.!'!#'!N '!'!'!'I >  @Z!`B  >!! `€!2` ! "! pa"! .! @ !@2    !  "*@ "!" ,!&"> @ ! !.! "! pal"1 ! !.! "! p["  ! !.! "! pJ" ! ``!.! <" @' ! pb/" @ |!@  ?  "@!  !.!  ?"! @#> @ Y! `€.`2 `,>, T*` €> > @ # > 8> `@|  @˔ @F @Ŕ Z?> x@k  > @d   @! `!`.! ?"!@ 0!"@> 4 @L 䀊!-   :  !`€.`4 ``` `$!%> @e @&آ !ꀢ&6!!В`B >!а㿘`>,!h*` €> @  !ؒ`B >!ؐ @P "!  2  "> @  > 3`  `+'>,!* €` b2  > ``2 `8 @Β , ` *` 2` 2  > #\X  > ``2 ` @>  @e` a>  @e` "> А @e` $>  @e` (>  @e` @>  @e` @>  @e` @>   @e|>  0@ev``> @ @em` > P @ed` > ` @e[` > p @eR` >  @eI` >  @e@` @>  @e7` >  @e.>  @ > ``2 `#\ږ  >   2   @  !2  d  !*  .!,``  >    2   @  !2  d  !*  .!,` >  @ 2   @Œ ! ` @", `*! * @`(  !"`(, `א `>  &(``2 ``k  > ``2 `a  > ``2 `W  > ``2 `M  > ``2 `C  > ``2 `@9  > ``2 `h/  > ``2 `%  > ``2 `  > ``2 `  > ``2 `  > ``2 `8 @- V, > ``2 ``  > ``2 ` ! ``2 " $@(,   #\> "> "#`> $˔,&( > ``2 `h  > ``3` ` > ``2 ` > @Ӓ , > ``2 `X #\@Ē  (.X&, > ``2 `@  > ``2 `{  >  @ 3`   `@ ! "(, `$! `?ȑ*` *  *@ 2  `* *  @ "  ! d  !  .!, "&,` >  h 3`   `@g ! ", `$! `?đ*` *  *@ 2  `* *  @ "  ! d  !  .!g, > ``3` ` `@1 Z,` (  >  @%  !>  @ !@2    0@ A  b70@ה ! !.! pbf" @Q ,`+`'  >  @ , `  >   @ , `  > ` 8@ؒ , ` &,` > @AM X㿘.`6``=!@ ".` ?` **> p2@ 0'2  + 2 "* "@`$&`(  .`X! 2! "!!?6!!B@>!㿈"   A !@"!6"9? `@!`  @ @ " "  0 0" 76"7 "2"`6"7" &"" 7?6"@ 㿘! > ">  @!,  2  ? ,  `  `? ` ! ->  * @!  2`45`` 2!6" .!! .!! `@#h> 3! `'`> " >   ^@  > 6@&!-   ``2  ?  `  ? ! > 6@@     +-!`44`` 6" .!! !.!`@"   <!T ,`!X 2 "@*`" * *  @̒Οʀ  ΐX!2   r!!!2  2!!2  (> " (@A 0!&!L!L'> %> Ґ @5QP!L `"̀`# !> .!" `&!L@  !2   ! .!  %>  ," `*`43  @`` } | ! > #> ѐ"-  `2 @> @` @`@1 4`@ "R ``DE> @G`@=> @". ``@`@/> @` @!'> )> '#8$> "#P> #`> #p> #> #  >  #> #Дؐ@`  > @   > @> 㿈! !@ >  i7 @@ *  @$@㿘!    < @,`x! !* `!*@  .!퀢 .`*  !* ??c#    2`  @ > $   @q`@ >  2`   (7 $ 9'2` ^ 87 ?!a @4  @7@7@"    2 * @7 ? * (@4 > 2 #\#` H@ޘ   $ '.`,` 7 䀢  !2 ! *  `@.!`2,  *@ * .`$ @4 ' @``  *  2` 2`  `!!  `@.!0` p! a.`* * "!*  N $!    k$, 4 4 , , , !`! < !`4< ! !4?* 4! @  @  ! @&!`!#&!!" > !` !d@G !!`! :!!> !` !d@5 !`!: ! : .`*  !* @@` @* @ *@ $@!\ * * @$@! <*@$*@ $@!   4`,`,` 4`,` ,`   *` `  "` ` ! @24@@! ! @2+@@ =o  %7 @@  $@`* @2  *@ * $@ 2  * * @$@@!> 3` #\ ` 3`#` ` > #d ` 8#h@ `2 #l "@ @> 3` #\@3`2` `#``3`#d`#h " @ `???ì#c !)>  4  $ , 4 4 !  )  $ ``2! 2    ` 2!` !? : @2       * 0 *   , $ , #\ 2  #` #d "@8 㿘!2   > @% !!2 "!D!2   !  0.!!2   > @ !6!5 ,`2   (" *  ? 2`"  $!@"* "@ $ " $ (! 2 $$ ( $ ,@ `*`!2  Ϣ 㾐!> 3 '!       @  `!S@2! P=`!2  2p?> @ > @ a?  @b `    @ ` > (@s @?> @@i 6?!  @$! 2) @ # `  @Ē    ` @@   @ @H  > @;!`㿘!   > !`  6 ! `  `@`!2  2 ` f 8`?`f a `&&6* 2 <   !    !`   !   <<6 *`6!   !`€   6ݐ !`  Ր <!`  ʐ ?# @ `*`2 @6㿀` !2 ` @ ` * * $@!(2 ``2 * * @$@`?,` `c,` `,` ` @ * @ @$@!  2`  4 ` @ $   @  $@` @2  * * @$@` 2  *@ * $@` 2  * * @$@` 2 *@ * $@` ,`` * ` *` 4``!> `*@ 4``> * @3`$@ `#\ ` 3`#` ` 8#d ` `#h@ 2 #l"@ @"3` #\@3`2` `#``3`#d`#h>   ` @ %> ` 2  * * @$ `, ` `*` 0 $ `, !  `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d @  <2*  *  @$ , 4 ``` 㿀.`*  !* 2` `**` $!( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3`#d #h> 2 #l8 ` @ "> 3` #\3`2` `#`3`#d"#h  `@ ܒ  +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d b@ P <2*  *  @$ , 4  `i 㿀.`*  !* 2` `**` $!( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3`#d #h> 2 #l8 ` @ "> 3` #\3`2` `#`3`#d"#h  `@   +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d b@  <2*  *  @$ , 4  `i 㿈` `/``+``(` `  `-   5`@ 5- @@@-`4,- @ ,` @ @  @ጒ >  'p@ 7   @ > ក  /E<?` `/`` +``"(`! `#  `$-   5` 5- @@ @ -`4,-@,`% @ @   @  >  '@ h7    @ #?@ >@  $@2 > @2  $@" >@"/`  $@)    2`2  <?#?  >   2`   2`2` @  > ` > ` *` `+ `@ ` #\'@ ` ` * @6ᨀ$2`` ` * @6`.`.ᨀ(2`.@2``.`6!0@ 2?0(2 ` * `*  +     +     +    +  !0` 2?0(2!0` 2?0(2 ` * `!*!!0`" 2"?0(2"!0`$ 2$?0(2$!0`& 2&?0(2&!0`( 2(?0(2(!0`* 2*?0(2*!0`, 2,?0(2,!0`. 2.?0(2.!0`0 20?0(20!0`2 22?0(22 `4*4 `5*5!0`6 26?0(26!0`8 28?0(28!0`: 2:?0(2:!0`< 2<?0(2<!0`> 2>?0(2>!0`@ 2@?0(2@!0`B 2B?0(2B!0`D 2D?0(2D!0`F 2F?0(2F!0`H 2H?0(2H!0`J 2J?0(2J!0`L 2L?0(2L!0`N 2N?0(2N!0`P 2P?0(2P!0`R 2R?0(2R!0`T?0(2Tp<hx㿐! !€6!!7!7*  7" &  `6` 6@ !0 @* `* `* ` ** `* `* `*!0 @* `* `* ` ** `* `* `* @* `* `* `* `* `* `* `*!0` (?0((02!0"` ` ?0((02 ` * ` * `* `*!0  ?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0 2?0(2!0  2 ?0(2 !0  2 ?0(2 !0 2?0(2!0 2?0(2!0 2?0(2!0"? @? @*`(2 2` "!0"? @? @*`(2 2` "㿈!> Ґ  0>`.!`  &!4 0&!l&!h!0$ ,$ $$ 0!! 4 4 !>` < ``&!0!)4 ! 4   4 ! *@6!`  2! !0"$","0  22$ `22 ̒  *@6!b! "A!'H /d * % !P  &!P&!HH 0  C!   2 !P`' 4!P?` &!P!H&!PH 0 Bb!g] !H /d * % !P  &!P&!HH 0 !&%"`*'  2$@!@2`  2@2`    2@  2 @!2  ה @2`  2!P2`  4 `!P?` &!P!H&!PH 0 4 @ 2h > ' @5 !    @ 2U  'c @5ٖ 㿘 <?#@@& <@ѐ㿘 0 !  > !Ā`I>`!X !#!0C#!X2 (@*`@!*` @ 5(!`: .> !Ā`<!X ?#!X a `;# `?Ȗ*`2 (* @ @ " 2  !  !*  `@+!* 3@㿐 >b 0`l@-۔ a   $,4 H /d * % aP  $aP$aHH 0  a2   4KaXa`  L a2   & a  a`   aPa   aP?` $aPaH$aPH 0  $, e a a  0,a퀊` a`   aXa   aX ; aP?` $aPaH$aPH 0  2aX@aX ah "$ahal"$al$aP?` $aPaH$aPH 0 > @   !2` /aX$aX@aP `aX *` ? $aXw$aPaH$aPH 0 0m f"0aX g e"U TaP h"9 NaP  l@ 2 #>  @, $aaD 67aPa> $aDa@R -aP> `  @$aX@F ah "$ahal"$al$ >    @5l>d`d@,> !̰ @, $aP?` $aPaH$aPH 0 㿐᎐ f  g e 0  h 0    "`5 "  `!@  ` 2 #蠄?2!`2!` 2  㲔 "`,`,   &`,㿘 @  *&    0@-3 l *@&  @>  `0@  * & @ !X `  $!X>  @ @͐@> 3  '0H o*@ e aP  $aP$aHH 0   a 6 b*@ * * 2  "ia  >  @@UaP?`o$aPaH$aPH 0 f @ >  h@<aP?`V$aPaH$aPH 0 M  & a@    >  @ @*@-& '->   $` > a >  @ "  a8 b* "@ *  & ,& aPؖ@ْ  @* &   l@ 0q#> f @+W  &  " aP?`$aPaH$aPH 0  @& @ /6 @ , /  4  ` , a2  "?# ? ** @2@ 2@ $ a2   , , ,  , a2    4 ?# @2 *`@4 a2    4 ?# @2 *`@4 a2   4 ?# @2 *`@4 a2   4 ?# @2 *`@4   $   * ?# ?1?`   a2  "  *  *` 2  2 #a2     *  *` 2  2  $`?؆a`a4a aP/> @ aP?` $aPaH$aPH 0   > @.] 㿘H /d * % !P  &!P&!HH 0 !`  !P?` &!P!H&!PH 0 㿘  0H /d * % aP  $aP$aHH 0  f)>  g e"P ,UaP h"2 OaP >  0  @t  B l>b`@) @ /#>  'P@^ aX ` ?ah $aXal"$ah$al &>  >   h@E l>d`d@)ǔ> !@)Ȑ  &   & ,laP?` $aPaH$aPH 0 㿘H /d * % !P  &!P&!HH 0 !X!h `'&!X $ !P?&!P` &!h!H&!PH 0  C"@!h "` > @ݒ 0!P?` &!P!H&!PH 0 㿘!X !h  &!h "@!h "` > @ 㿀`>]".` €! r!/m?>@ .`*   !.* @*` @( `&  "# 2  ` ` 4*`` " P` ` ` *`0  (  ! *`@ .#  @  " >  ( >  ! >  ! >  >  `.*  > `#\#`f> @_ > `@) 0%!X> ` ? &!XQ!X!p ? @` &!X>db@(!X &!X@( > :! 2!/-> .!*  (b @ > #\2` > "(> "0#`#d#h #l #p@Ԓ 0Ѐ> @@͒ 0 '! ">   > )!> %!">  > !> !> "`"p> ">  ">  ""> " D$ > @ !2  @2     !  &* *  (  ( @2`@2 `@2`  @"    M  (* *  (``@2 2> @7 03<.@ @ *@ &@ >`>`&@"&`! `€!     ! ` €* * , > 23 @  㿘'P'T`'X! /@ >  @LԐ#H@LP> @Lΐ#P|||HH||x LTȐȰȰȰP,DDD߼    2     2 㿐>} 0a@'% 2%  @ &% % 2%   @ &%% > % 2%4> @LT#0P > > #@LL 0H"H* %,> @LD %, @ +  `. ڐ . %,*"@ *`"  ڑ*  , @ +* %4 . . ڀ`   &  ` & @.%%2  6 `6 N6 b& t& l& x@ *  H'>  @.B> a̐ 0*"@ @&*`㿘  @!> ",!>   @K!, Ȑ .%`  ",! >  @K!- .%   !%4` W> >f#\*` € Ȓ  ِ  Ȑ` ؟ %8` &%8  %8` &%8   %8  Ȑ  &%8. .     .     Ȑ` ԟ  Ȑ` ڟ  Ȑ`   Ȑ` ۟ %4 @K 0 Ȑ` ԟ  Ȑ` ڟ  Ȑ`   Ȑ` ۟ %4  ` ؟ 㿘 @>  `@KS > b,!>   @KJ!t  .%`  㿐> ",`> % x@K5!> "0 2%> > "``#\ P  @B  $"0% 2  & & &  @ )Œ$ ̖ D! "@ ̖`@0< .%6% "`, @ ̖ -*! #   $ ,  "`, @    @ $@" ,@`,   2  ̖ב*А ̐! &$ &$  В:  %<   ; `!`*%?*** ̀@`! .%,!>   @J! Ȓ .%   %4  a0 I̐#0ɐ"0 .%@/㿐` `,  ` > ",` > `/ `M`N@Jo .%`` 2%4`А"@ > ʐ @ *#> ! @ *# @$`%4 2 ",!>   @JE"w Ȑ .%`        ֔     * %, @ ) ,`"* %,@ )ّ* &`%8  %4  2`   `2 %8"?%8  %8     Ȕ   Ȕ   ` "r`M%8 Y`/`D &%(&%$`'%$%( @ `  Ȑ`  Հ @2 %4  Ȑ` %4  `  %4 ",!>   @I"  .%`  ",!>   @I" Ȑ .%`    @0`D@=`/",!>   A@I" A .%`  A0۠  %8 "    `  ` `D`M.`,`,*`N *`D  `..`.%8 p 2o  &%(&%$' %$%( @ `  Ȑ`  Հ @2 %4  Ȑ` %4  `  ",!>   @I" Ȓ .%   `!% @6%.%",a>   @H"ϐ  .%`   ",!>   @H"ѐ  .%`   @0E @ ", > @HՐ!",!>   C@H͔" C .%`  C0)`!% @6%.%",a>   F@H" F .%`  F0",!>   B@H" B .%`  B㿘H /d * % > "`@A&` H 0㿘> 0 ` `@? `H / * % > @@"`H 0` P@ '>|`c@"`  &`  㿘  `0!> ", `> @HC!", >   !( @H9``*    @,`   4$  @N  2@ &Ò$ > 4!<$ H /d * % ` $ ` "` $`` $ ,` " H 0m 2$ N  $  $ D $  $ H  /w  $ D $ @ $$ H, LH /d * % $`$ `"@%`  $ e`@`H 02  @ " @ @   @ 㿘> ",`> @G!8"3 %>  @ "`H /d * % @ H 0` "%  b, @GdP@ #贆2 Ȱ 㿘> ",`> @GQ!p%`" > @E!``` `*     ` @  ` "`  @  !H /d* % ,       &> 4$  @@   H 0@@ %$  <$  "` $$ , " > 4!̀$   "$  `      `  H 0z@=,`M  2 H 0k@ *`  *`2    *`22 > @E !,  , *# ,`NH 0      , @``&   , @``"`& `?@"$@$`` ?$` & 0 "@> `!@FW`@`2`㿘``/  *  > b,  > @FA!@ $  .`/  *`,`,``  4   #&`D&`@&`H&` &` $,        2, @Ӓ , $  쀦@2 0 &@ " & &  &`` `&` % 㿘`` *  ,      T> b,  > `,@EӐ"@!k``L (2 `, > *`4" 2@EĒ `, 2``L,`X` @  $`, $`,`L > 2`H`H$`(Z0e$`(`b, `$``(`"`,> @E"P`,`2> > `4@E"`@E"p@K 쀦@2 `,% &  .%'`, 2 `  2`  2`4 , "  `"  "`  ? "$ $ @c `’ %H /d * % @ҐH 0㿘`  `*  ` 2,``  ,`  2  > > > "@C2`M*"`M `N*`  ""> "@Ct ?*`  ?&` @``"`& `?@"&@&`㿘!> ", > @D"",!>   @Dؔ$ Ȓ .%   $   㿘``> 0%&% %% @@C+# Ȑ@€ %4` * ,`  '>  Ȑ@€ , &  ߀ % `   Ȑ@€ , Ȑ@ € %   '>  Ȑ@€ , & % @&% ,  > `#(> #@> #H% @De , "% %  @ > !> %#P@DW % `@ *%> @DO#X% 㿘!> ", > #`@DC",   > #> @@D8cP &@> @D1#X  Ȑ`@ %4 2   Ȑ`   & ȁ㿘e4   ee0  e* * > #p@D`!> > ? `*   `@*``       `PX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`` `    ,eݰ `.@  > #@Cɒ`!> ,e$` ````+`e,r`@ #w . "* e,@ #o* & e8e4  ` 2`` "?e8  `  `Ȕ  `Ȕ    !> ", >   @Cs%u",!>   @Ck%u`Ȑ ,e`   ee @ ` @", >   @CT%w",!>   @CL%w`Ȑ ,e`   ee @` ,e4e@ $dH>$d", >   @C0%",! >  @C(%`Ȑ ,e`   ee`@ ", >   @C%",!>   @C %`Ȑ ,e`   ee`@ 4e,e 㿘> ",`> % @B % 2$>  H@B 0",% >  @Bݐ p%&% `.%", > % @Bѐ % ",!>   @BƔ% Ȑ .%`  %% > @B 0% ` >   @B%",!>   @B% Ȑ .%`  %% 6%`A3.%% % %  ` ` `  ( ` ` ` `    `  @`?`",",!>   @B]%  .%`  0">  @BM % &%   > #x>  ` % *  @ "N>f#* €","> @B( $ 6  @` $> !@B &$ ! $ $H" ( .%","> %@B!% @"{ ",%L!2%> ` !0@A ",b> @A!X",! >  @A& Ȑ .%`     ,`    *  2  <  M   N*` ",N" ?*,N,M *U"> ` !p@A % `.%  ,  %8`  Ȓ   Ȑ`   Ȑ`  0%> ` !@A  , `$,"," > @Ay!%","> !@Ao %","> @Ag!  $$`.% !$ ","> @AU!$$@$$H","> @AJ"@&$H&$","> % @A="% `  " `G","> ` `@A,"(% ` O", `,%   `,,%< "  " `|("%,@` > @A "H%`2  , `,", >   @@&{",!Y>   S&{c @  , "* %,@ * & , "* %,@ * ,@`  @ @ !, @*`@*`" > @@Ɛ"X%`21  %<@6 %?,   ,  `,", >   @@&",!>   &@@ Ȑ .%`  %% @`.%6% ,% .%  `+ %,; @ @ ,`"* %,@ 8* &`%8%4    2  "? %8      Ȕ   Ȕ   %>  @@B"x% ` 2L,  @, +@ %, @  ,`"* %,@ * &`%8%4    2 `` "? %8      Ȕ   Ȕ      ,@` > @?"",",""> @?"@` > @?ې"", >   @?Ӕ&",!>   @?˔& Ȑ .%`  %% @a`% 2> %`2 > " S%%  > #8@? ",6%  @%#x@? ", >   @?&",!>   @?& Ȑ .%`  %% @` >   @?s&",!>   @?k& Ȑ .%`  %% @` .%6%% ",!>   @?R&  .%`  ",!>   @?B& Ȑ .%`  % .%&% 㿐> ",`> %#@?)$% @$ "=%",!>   @?' Ȓ .%   6% )&% "> ", > %  @?'",!>   @>' Ȑ .%`  %% @% .%@ 6%# @>'% 2%4% %    * 6% 6%6%&%@"% %є ǀ"% %"s  %” "%%    %  *% *`* % `* % *  % * %`&%  , ր  , %,G @ L ,`"* %,@ D* &`%8    2 %4  %4  `"?`%8  `    Ȕ   Ȕ   ]%     `% * *% *`% *  % * I&%% >   @>6'A ` %  9*@ >   @>''J   M% * N% * (&% %  .%*@ ` *    ` , , *@   %   *@ *@  % .%*@% &%%4 2% %%",!>   @='  .%`  0U%@@8 Ȕ% '% @ `  Ȑ`  Հ @2 %4  Ȑ` %4  `  ",!>   @=' Ȑ .%`  ",! >  @=' Ȑ .%`    @x> ",`> %@=z 0 @ 2 y  € . @€ %4 ` .  Ȑ@€ .  Ȑ@€  . `$`" ܟ@ ܀ 2! ݐ &$, >  ܐ   @=>  ܀, @€  ,! >  @=,' Ȓ .%   _ % >  @= P^  쀢  >  h@;  0@Y  ݀ @( @€  ,! >  @<' Ȓ .%   , %  2  "`, @"-%%  .%߰ %> % $ @<$ Ȑ@€   ,! >  @<(  Ȓ .%    % ` .% € "A  @?2 >  @<  @ 2  ݀2* % "& $ 2$$ > % ܐ  ޖ #\ @<~  ݀ 2  ܖ  ޒ ?H#\> $@  @   @   @   @<>(`,!>   @<6(` Ȑ .%`  %% @`.%6% ܀` "%6%, >  ݐ! @< ` Ȑ@€  ,!>   @< (h  .%`  ,!>   D@;(o Ȑ D.%`  D%?`s>g H*` € ",`  *  `? 2!  2 4 `8*`` " `"  "`  "@" " @濒 `2% "> @{d` > @;!` %*  `.% ` ,`% 2>  @;! `> @;"ѐ> @;"@!5  T"`,W& %?`h>g $*` €>  @;n"0t $  > @;e"`> @;`"X%$   € >  @;P" ?#>  Ȓ € @;DbȒ ?  쀊 %6% 6%6%.%, > @;-"@Ő 䀢 $ " & &  $ `$ & $ `.%>  @;"`SG   $%%4 "% >  ݔ ސ"$#\@: : .%, > #8@: ` "%8%`.%,!>   @:ܔ)2  .%`   % " %%4 2%% .%% >  ܒ @:#H | 0  2;> 2> @9$#x`   ޑ*  `$>g *` €,!>   @:)\  .%`   ! ` 2 $ M 2$> U# > P# ` , >   @@:t)k,!>   @:l)k Ȑ .%`  %% @`@.%6% ` D %?,`,`% .% M`, >  !@:I)s,!>   @:A)s Ȑ .%`  %% @:a >   @:-)u,!>   @:%)u Ȑ .%`  %% @`, >  !@:)x,!>   @:)x Ȑ .%`  %% @a.%6% t&$%8 " %( @€  f @€  ޘ  >  #  #`#\@9ْ ,a>   @9є) Ȑ .%`  , >   @9),!>   @9) Ȑ .%`  %%`@ 6%.%,!>   @9)  .%`  !%8 !%( >   ސ   ` #\#`@9 !&$@ &$H.%u&$ ݐ P ޔ @9v ,a >  @9n) Ȓ .%    % W  ܒ `.%>  ݐ  @9S  % >  @9I %%  ?,L% %@, @ > !@98 >  ! $ $H" ( .%!@9$ &% ,!>   @9)  .%`  0> !8 @9   % 2> 2$> @7t!P ,  "0 @z @ > "h,! > "h> "h, @> @8ݐ!h&$, @" > @8Ґ! ܀/%4 , ߀ 2%,!>   @8*   .%`  %` .%,! >  @8*  .%`  $ > % 2 $>  ݐ! ޔ @8 $$%@ ߀ .%ƒ`?   ݐ! ޔ @8  ]&$> /"@8wD Ȑ@€  ,!>   @8h*2  .%`  %8 W/D &%(&%$`'%$%( @ `  Ȑ`  Հ @2 %4  Ȑ` %4  `  ,!>   @8%*@ Ȑ .%`  ,! >  @8*C Ȑ .%`    @ D/,!>   @7*G  .%`   &$, @> $@7"0,!>   @7*M Ȓ .%   $%@@8 Ȕ$' $ @)&$> @7Ő"H%4 2$,!>   @7*V .%   $%@@8 Ȕ$' $ @ &$ ~$     Ȑ`  Հ @2 %4  Ȑ` %4  `  ,!>   @7t*c Ȑ .%`  ,! > `   @7`*m䀢   .% Ȁ   `   @S  @> @7F"X%`.%,!>   @7;*s Ȓ .%   &$@7/ r90  .%̐* @@%,@ ܐ 2В@@@ '"@  ? @ 2 @@А@ @$  $ Ȱ 㿘` 'А @&`&`  쀦@ ;% !'!> ", >   @6*",!>   @6ڔ* Ȑ .%`  %%`@ 6%.%А"@@ #@ '> z > !t'@ y#`@b0 Xp  ``0*``@v]  Ȓ € Ȥ  @ > "> " %> #\ "#`#d$ #h$#l$#p%#t% L#x #|@6{ HH /d4 * % @  > @6j#0) 0!> @6c#8 $,h 쀦  $ @v > @6M#@`  В`*  $ БH 0㿘> 4!̦}H /d * %  ̒ @9 0*`  -`?6% 2!  2 4 `8*` " `"  "`  "@" " @  2 ̒@̑*`H 0> !̓*"@ @*`㿘 Ȑ@€  . @€ %4 ` .  Ȑ@€ .  Ȑ@€  . `$`" ܟ@ ܀ 2! ݐ &$> ",`>  ߐ   @5 ށ4$$x   < X X  X㿘"6# P "( 4"h"h +> .`4 @ `, 2 .* 2. 0 +> @6Q@5q`p"@"> > @5i @5e  ?%#4" @( "Ĕ%2  ?# @2 *`@"(`"Ę!.`2 2g".#g >   #@>   .# .#2@5%'0> 4`$@Ɣ  #&@:@??@ # @2 *`@&@:@?@ 4 0 >>>?!`H"$0$4$@4\$` $`@&@5"(`"Ě ">>㼒 3 @X>>>##a&"&"&"&"# > @4ϐ #?`6*`>}# €"@(@i"(`"Ė 2"@???@b "   " @X] @X| " "@Xx  "@"@8"! (@"Ĕ!2 " &""Ā ( 2 @  " X"2`@ { 㿘"@ P"?@cM?"@X?@5@'2 㿘" " "Ĥ ( 4  ?# @2 *`@> Ҫ "t3> />  @  @W " @42a @4/   &"@ ( +  ?4 @      ?# @2 *`@ 2`, > `* > @4!> D, @Wא㿘" ""Ā (#2  ?# @ `*`2 @"( `"Ę  p5> 2 4`5  `3> />  " @3Đa @3    @Wt  ` &"ȑ,``* `@> ! ,`> !P> !`> @3!@> D@Ww㿘 ?" P"Īc# %     * 2` 0   `@$@#  "(@ "Ĕ 2 4   !4 # 2 "  ?#4 "(`"Ĕ"2  "h , ``$ #?   `* `$ "# "Ā ( 2`@ 8 " X"2`@ - "(@"Ė!2#      #&@:@??@ # @2 *`@&@:@?@ 4 # 7 ( 4   ? 2`*    ? 6 ?# @2 *`@44 4 "@"@{" ( "Ę!2 6 *  x 4  6 *  p 4  ?h 4 @"@   4   H4 @\`@ {@U5\"  P"Ā (!2" "R`\ `\!?0(R`\ `\!2㿘"@I 㿘" ( "Ē#4` "   @4`# 60  @4`"%  X" 2`@ 4"" (  2@ 'Z#   @4`㿘" ( "Ē$4`  ` ?# @ `*`2 @`   ?7?# 2 , @4` ' . 4` #"@k("@"Ĕ#2 #   `?# @ `*`2 @`  ??? # @2 *`@4`  @?# @ `*`2 @@  `?# @ `*`2 @`  `?# 2 *@ 4@ 6 ?# 2 *@4`"(`"Ė!"2@` 0"(@"Ĕ$2 `;>}#.` € #   *`   4` &#  4`0   ?# @2 *`@4` }##  ?# @2 *`@4` n##  2D"" (@ "Ĕ#2   @?# @ `*`2 @@  `?# @ `*`2 @`.`  ?# 2 *@ 4@ 6 ?# 2 *@4`-" (@ "Ĕ 2   `?# @ `*`2 @`?` *.`? # @2 *`@.`4`#"(`"Ĕ!2  㿘""  "@`""&`"g&`" &`# S O P> "1 (@"Ė##2 `?# @ `*`2 @`" (@ "Ě! p2>  D* 2&`"(@ "Ė$2 &`@  ` ?# @ `*`2 @` (""`  &`&`> #!h@0H 0"(`"Ĕ!2 㿘 \b $@ @fb! !D!` 2 !p!D Z  2 > @.!!D€ @ a @ ] '!D€ " " `e$ `B > !!D!` 2!p!D    &!D&!H$ !L?&!L@ِ`  ?# @ `*`2 @@ 0  c`:@??@ # @2 *` c : ? 5  \$6 \ % ?@  !D€ #5 ! !D!` 2!p!D    &!D&!H$ !L?&!L  b:`@??@ # @2 *` @b:`@?@ 5  D @ H/` /c`   6?# 2 ,@5 ?<#5 c %>  2  %  ? @ @-`@א 2   2  5 ` ?-@ 2 -2H 0 `B >   c    c    @  ?# @2 *`@ `@ΐ!@  "!@!㿘" ( "Ė$2`  `?# @2 *`@`"(`"Ę!2 2   " @ 㿘"9"Ā   ,`   薂B@> +#`` "`B c> " %8%&"&"@#"" `B > @ H4  ;6   &"#    `2#㿘?" P"Ĭ# ) &+  @2 *`@4`  @/ \ {4\  @N "!h 4`` @2 *`@`  2㿘" P "#   ?# @ `*`2  @#    @@2 ` g@~ 2```B 3<``D`B <` @ @,  a #   ?# @ `*`2 @    @@ϐ0B  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0   $㿐""̑* @ P" " "@ @}  2$  ""쀢@2" 4@ "  " @}&"$ $ `  Ȑ@}   2(  $ 'H/` /#`i g  $""̑* @ "@ @}  H 0@} 0"`  ?"@&" 쀢` `@}u   2(@8#  ` 4` # "$   *$ `$  4`  2$ *@$ %&@`4  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0   $H 0㿘H /f * '  P@)   H 00ra2@a1@Sa @a@"4\] 0!5@a@"Q 0 !6@ 0J\ 4\ ` -@ꐒ0<"@P(6Ҁ%82 l 2.$l0,@  2\@Q\ ?!4\ `@`k0@-ؒ@.T 4 \ @ @  H 0㿘H o*@ gB H 0㿘>   @*a B< 㿘"" "@[>"# 2 "(`"Ĕ!2 4 4   4   @4  ?c?#     * 2` )  $  ?#c %     * 2`   "  `@$#  P4 . 4 " (" 2`@R " X" 2`@F!h 4   x4   p4    4 @㿘#.@W ? c  . 2 @ 2  @ . 6 㿘?"#"Ģ c)    * 2`    `$ d2`2#>   !Ȁ   >  !@*а 0 㿘#  "Ő 2' "` "?# @2 *`@2  "" ` "? c *2`   㿘H /f * ' ""̡,`  @z $  ` ` ?""@ ,`"쀤@&" 4@ H 0㿘H /f * ' "̦ 4   "@{;$ &"@&"H 0 ? 0*  ?0(2 ? 0* * ?0(2"*` 2`"? (0 " 㿘ʒ  ƒ  ?㿘  * ͒ @    >㿘" "Ā`($2"Đ2` ˔  ǔ Ô  x u T o  * 2 I  c  , { *  2 8 Q 0 "(`"Ė!2 㿘"! "Ā@($2h t  p l h  d `   "(@"Ė!2" ( "Ć#2  ?(0"" ߒ` 6 ? @0*`2"("Ĕ!2`㿘 ?#c #  `  * 2` 0 `  $LLLLLLLLLLLLLLLNhNpNxOpNNNOpOpOpNp,((hh> 3`  h'!&-8  0@&<` 77€Р ""> @(d!Ԕ @a@)7> @(V   ` ?& 0 4`\`$&%$a4`  $a0`(<`x$a@a` $a`! -> b0@"  N> bH@  o> bP @ )+) d<6-D6-T6-B6-R` & 77Ȧ 6->6-F6-V6-@6-H6-J6-N6-Z€ 2 6-L?# @ `*`2 @6-LT "$-0   e hI a hX-0: @"_ &-0`&-0 "e@$ -0 &-0  <G!X  `@#&-0#'&-8!Xc  @-0$2 !&-0-0 &-0!X aj $ -0(&-0  <&-0X "&-0&-0 !@$ -0 &-0  <$&  h<!O 77€  !̀ "`,-0 &-0!`,!<@! @ " T  h<aƐ 77€ " ?# @ `*`2 @`8  6-X ,>>%> '> 3>  -X  6-X t6-X,>>%> '> 3>t4@J   @J ! @J -0 $ @J -0 ( @Jۖ -0!" @JӖ -X #  @J˖ ! @JƖ -0 $ @J -0 ( @J -0!" @J -X #  @J ! @J -0 $ @J -0 ( @J -0!" @J -X #  @J ! @J| -0 $ @Jt -0 ( @Jl -0!" @Jd -X (  @J\ ! @JW -0 $ @JO -0 ( @JG -0!" @J?   @J:  @JY@wb`bd$b@'k4b@&sX-0`&-0b @up `h ``& €@   > @"`-0\-2d-6 ? @0*`2-0\-4h-6 ? @0*`2㿘-0  0`\ !\- 2d2@ - `4`h-  ?<#2 !\- 2d2@-` - 0`@?# @2 *`@- 0`@!\-` 4 h-`67 ߐ#p2  @Ӑ!\-`4h-@  !2 @c!\-`4h-@  "2 7 -`!\-` " D@?# @ `*`2  @!\-`"D!\-` 4 h-@  (2-( @  @^!\-`4h-` ?2 @!\-`4h-@  $2 \-` 4 h-@   2\-` 2 d-`6 *  2aL  @4 -\-*` ?(0 \-*` P!  h 0`€ -<   H*` e @u  _@uV   W$ `  @ D L? Fc *`2 @ '2%>  2  " <  >    >  ,,  <  @$"p0, D * 2`   @$"0 (   h ` @ $ $    @ D 2`4 #?c 2   @t  @tے   ܔ(   $"$ <$ -> 9ܒ  * 2` >  >  2`*  @$="0 D֐ < <@  <@u > @$$#0`$ @$ 08 *  @@>?@:?c * 2   > 2`*  @##P0m$ $   . .. catchmodchgrp cp4 ddD dfP ed\exprhostname+x ksh sh ln lsmkdirD mteject( mv pax tarcpio rmsttysync ... . ..chowndmesgfsckfsck_ffs+xifconfig+xinitmknodmount mount_cd9660!P mount_udfx mount_ffsx mount_nfsxnewfs  mount_mfsxpingping6reboothaltroutertsolumount disklabelxdhclient+xPdhclient-script . ..misc0keymaps . ..termcap ... PH_ < @ H_FqEP  H_P@@<@T UHoxPPHoAHa!pHdHdAHaHaHaRX W aAHaRXHoT HoT  AHa(Ha(Ha( oAHa(Hn*Hn* 7CbAHa(Ha(Ha( ~Hn*Hn*Hn*4 KHoT HoԈHo [dP;rC0MkHӶX{s[RpDCP|+`R;F9$rauRNynWw_=p41tomNf]Ry6)~a'OV9n;PӢ eգ pg2ձ.AGb0 89I>:]#tbwԫgJ2U6 rpL^? p9>'U6v_mP6D N1@>Z'lUg <v4'TVéc14=}=SH[Cde^L%-LMlr(yyv7IdqU48f_TI+BS mU']+F\l Td,B[OIhZPVF1J41rչ]\u4:ID9 p{sfZGz^q=]{OG`N1{d_z~@۶ ^u Q&֓'{GPCb3ٴ?Gaj]\>b+oV)Ei>T+E]Hs4zй|ܮb=@wek\`˄'@@MJpg| l1Waf}yI"tswecʠfh(o ē~/KO/%NO e+|2RkyJޑHxW7Z1S7!QWK?8Ƽvn]{}Q˶\_&^(sW[m/ 7É]E$|^hzk=a 9Pb%(I`C8kv~C HYDY*Zq5+-J-%/PrDEY?h&Zèa~ޡ4*$ 5S \mdn?=I~#{)2sSR;/#|գ&K }\֋Ӹ=bNTb!L^&a(]pcVUm+ԆrPQcEt5p)<*=(G^d5/␾M,iCw"QĮF u)M20#U ͂Z6k)E ˨!E۠6aBˡ`Be)(P=U\UNbMJf/ֲհV)3 b`43Fbطx`}C_@b8*]Ct)^ 4߸:!7nO|%K-Ư1/y"s4A2EahP4v&{0\#Aap ]&910)dzx>Rc Y62)JD7[/9Ww)&ZP4cGsQ$ 1?R4D l^s DE6ѳ ^5LVWDR8     h   @ D *`B@t<`0x?c 2*     2`* >  ɔ  $  h$   @ . )``B <` - @* & 2%->  @u-\ -j@<  > #@# @tm``B )<` @u-t@v3?-> 2 `D@J `D @r -<   H`@tE0@"   0 \`2 \2 Z @:  @: 㿘> !*!<"@ @*` 0 \d%H /f * '   h<@  @ H 0> #@# 㿈  h 0`€ * `2  @ ?a# 2 + `,. Ԙ  + @ 0_`] * 2` ?  䀢B ?, hc\   -0$`5@  @ `*`2 @-` - 8p@ @2 *`@ 8p@7<@8 7@? $@ˢ`      >`㿘-8???## -` - @ `*`2@ @ 0 @ #??2-   > #@"V  <!\-`  -`6?#2 .@2!\-`-`6?#2 .@2!\-` -`6?#2 / @2-` -?#@2 .`@a"a\?#c2?# -@  -  `0`  2 -  `0` '  @  * 2` @ 4h 2@   ??2- 6   >   @! <㿐!T` -0 5   h#אc?? @   @  6-0>  8@! 0`&-0+ ?c@   h< (777€㿘!T`#-$-  *  -$-#*@ 㿐!T`?` @@  h< `(  < `# 77  h @` !@ 2ذ ` @ 8 2а -@  !\-` 8p@?# @ `*`2  @!\-` 8p@$  !\`8p?# @ `*`2  @!\`8p`@  6@6``!\` 8 p*?2` - 2`?@->    <`@ $]6`!T`X? @"`  @<*@F 0I@BD@D `?# @ `*`2 @`>#(*` €         ?#  *`2 @a?# @ `*`2 @ 4` !*  2 !4 4  4`4  h`?` * 2`    <  777aT ?` ఐ .<`"f`ీ"U``77` @ `*`2 @` I>#d*` €          0* `( 77` !*  $2 -T        ? #-> "`?`?# @ `*`2 @7$ 7 < `# 77`-7 `*  *2`  h ` Ȧ̐@V &   7Ȑ|$7ʒ=`€ 8```[ ` @X 8 Q !\-` 8 p-`@?# @2 *`@2!\-`8p-` `?# @2 *`@(2@`!\` 8 p*?2`-  2   h @`!!@   㿘68>       @& P^ !\`-* -`6?#@2 .`@2!\`-, -` a?#2 .@a"?2a\#, 70-`- @  * 2`  `0 @ `  2-` < 㿘 8  !\` 8 p7 ? - ?6 㿘n 6 2 !\` 6 l7 - 3 !\-` 6 l-`  "42!\-`6l-`6 V"x31 6 "-M @  !\-` 6l?c * 2` 4 !\-` 6l@"4@ !\`6l?c * 2` x !\`6l"x@r 㿘  h@  @ >   p@t a"?a\#-` - 0`@  ( 0`@  ` 2-`6-K <`!\-` " D@?# @ `*`2  @!\-`"D&!\- `4`h-@  (2 o 6 4 :  $ - 6l2@2- 0 d@1 0<` 177  \@   h`€02 \"5 \"P  ,*  @ @4   `   @ d `h,  7㿘`?  0@ 0@"` @"W4@ ^ 06@"`@"`. @"`  @o@"\`  @@ 0@"X`ఐ-@"` C%@*@"` @@R 0@" ౐@%@"` @〢@"` ` `@ n "j 0` @  `*`2-H0@ `  *2->&  * 2` 6-B * 2` 6-D` * 2` 6-F` 2`*  6-J->-H@  * 2` 6-L` 2`* - 2`*  N 2`* o @S`z * 2` r6-N` * 2` i6-P` * 2` `6-R * 2` X6-T * 2` P6-V * 2` H6-Z` * 2 `=& ` * 2 `2& ` * 2 `'& `  D0   * 2` `?  &  & *`2@ >  @  h> 0   H /f4@* '@0   H 0i 0@  0H 00X!@t A a2@a1@ @"*>  !@4ꀦ@ .a @qa@ %aҀ@"> a@ua@C a@"`>aـ@Ұ   !耦@հ 0a׀@aҀ@0@ 0!@>뀦@ܰ a5@a@ 値a@" a怦@"]>a؀@"o>԰ a瀦@ π0!逦@0 !6@ €0!ր@ `\ 5`\ `   h@@وҀ%8 `l 2%`l`\ ;P`\ P4!P> 2<  ! 777 h   4! > <  77 h7`€U`\ h@U`\ @"U`\@ U`\ W$4@@" 4L`\ @G 4C @>< @$$ 2", !8@ "D 4 ?a!7@0 c h〢@@@ W h@B R h  T +N4@Ѽ @  DE   D= 4<?# @ `*`2 @04!T4` @ * &4   @ `*`2@  44!!T`   , aԒ *l 4 h`€2$`0`@k   @S$$  ?`-_+ ` !7"+4 ` ~ hK`% G+  ``C@`= k h`〢. c h@Pcc * 2` 4<Z !T`   h<@  @ H  h`€>!T`80U+ 2 ?@-0 ,-@0 @%@%0 %@C0 C@0(@ +`    h`€ 7 `\   @$ʔ$ 쀤`\ @!T` @ K ܀U$>`0`@Ѝ Ѐ  @u$$ Ā@ `\   N `0  @Y$<!A" 44 h`€  ?c  * 2   @; !  2 *@  !d`0`@7 z  @ !L ! n h) N   O@ ^@  Ƞ  ?@v &4 < `77  O*`7 Z  h`\`:@4>`0`@ ,@ &@ ">`0`@ؒ @ Ē@ ϒ`0`@ǒ  @ ɒ@ >`0`@϶    @$<4?# @ `2 *`@4 ߀`\   h@Ԁ @z$<" 44 h`€ 2 ?# @ `*`2 @6  @\$<!B" 44 h`€ 2  . . . . . .`0`@L > `\  2!T`2   h<@  @  @$< c   4444 h`€ [  >`@o$!> !@ 0d* !@| * @e!> * "*@!6>`0` @ .> "  @А$"<4!4!T`  , !Ԑ*(  4 2 h`€ 2    >?# u&@ |  4`  4` `4` 4` 4` 4`  2* 4`>4`@  2,`R,`S   2* ,`  2`*  4`\  @ `2 *`@4`^ <   7 n      ,`t,`B 2 2 ```C `B + `B` `,`B 2 `B ,`x@  2 `x ,`x@q | ` &@* "@`|@ `` | @ `2x`m@ j g60(a  @$<C" 44 h`€ 2N ?c * 2`  A$  =6>`0`@ 6> 21 V0(,*   $ $ < C77 ?# @ `2 *`@ 7h `€ @ @z @u H 0㻐!  `c(&!T`"$ -0$2    h<"77€ 2  2  > a̠ @ * @0   > @/ ! @욐&X-0 0 Q'H /f4\* '\ @ @Ȑg -B!?# @ `2 *`@  h<777€7-> 7ڐ 2`*  77-J<  2`*   777-D<  2`*  `777-H<`  2`*  777-F<  2`*  777-N<  2`*   777-R<  2`*  ` 77-0h  < C @ `2 *`@777€-0 @ -V<`-  2`*  777€-0 <-Z  2`*  777€#`Nh  ?@ &<* 4 `O7j7l  n7h € "'#->`"  -J `# @ ?@˒ &<`4 * 7B F7@7D €!-L#`o  &@ ?< 4 * 7`p7 7  h-L?#   2 `h*< 777`€#`-  ?@{ &< 4 *7 `. 7_7 € ሚ<`77 " M H  €->` \!< !777`€  h< 777`€ت-0 e% !?# @  h `2*`<@   777€7Ȑ < @ `*`4 `@77 ȟ€<`6  #6   €T + 'Xc!4 -T!777 €-T?# @ h ` 2 *`@<  *777€  h -@ `@ ` &: >  @ &-( &: > !@ -0@ &-,@7 픒`@dH 0> !\*@ !<"@ 5\@*`x> 3 !  8'   4@d 4`& &  &   4 " ?>?c #@& @R   4 2`ओ2`* / //?c 2` ,   &〤   ؒ@ǒ.@`.`.` * .`@8@ǟ4`4`4`, , ,  ,@ǒ   > @!8p> 3 'T? @```2 @* // /?c 2` ,   ɒ〤 `  ؒ@4@P@@8@F @@4``4``4``"   > #\!P@ ?  > @!P0 Y  \$U! @!D!` 27!p!D I  &!D&!H% !L?&!L =@u D(7>( & !`@ ] 2`  \!2`  @> @!@c!!D€ ը@ Ѩ` h h   5@!"݀@2 * >  ( 77Ȑ `  `2# "```( 77Ȑ   ` ސ   *?b#777 ?7` 77# @7c!? #ϒ  c @d: cܐU%    * 4 7ܤh  D @ ` @ <\ D#c  @d?# @ `2 *`@! 7ܠ h  D @ `?@ D5 D?c 2`*  7>`# ` c> !@ʒ Dc  @cі!  h  D @ ` @ . D @ @b \ d 6 Z6 \ h@!  @ > "@P-0 < `@0 D-, ?# @ `!  h2 *`@(777 @ D`@ <@!  @ >   @Q"(戀 㿘@K-0 !<@ܐ 0   h -@` @  \4 Z {4 \㿘>  @'"H０  h`€ `B > 㿘 @"-0Ȑ-0`   ` &-0> ې!p@- 㿘@@裸   h<!  77€?# @> `2 "$*`@ < ! "$@"   " @2 `!T&쀊 !T > &`!T &+aT '@]   h<! 77€?#  @  `*3 *2 *`3` @ 777 @6!  h 77`€? @ ` 2 +`@  2`+  ( * ("@* *`@ *`*  2*  aX777`Q&#v"2I@ &<a$ 77€ 8O @3K .0K -,K (K K*`KА Б* +`K" " (* *?А  *** +  *@  *`K ?А &&!T  > "x @0' > "> "H!X# c#\#`@蘿#dc@@ d#h d@#l> "@Қ㿘-?`#`  @>#*` €        ? ` ``" ` `"   -J " `@ 4`@ * @,,@4  @3i6-H6->  㿘- ->b-H -J!T`2` -6-J ?c "  O "-0 F " -0A  6-> 6-> 6->  6-J 6->1 -  ``>#*` €      6-H "-->  -H -J@  h@-`@3ΰ < x㻐 2-H &`f&` 2:-<!D &`" 77 h`€ , ?# @ `*`2 @`"```  &` `  &`` &`  &`` &`` &` &` &`->   < <!C" 77 h`€ ?# @ `*`2 @` &`㻐-0  ?  ` Ĕ D?#  `   f-   * 2` 5   < #5` 5@  h`€ 2U 2O?# @ `2 *` @<  77 7  h`€ 23 2-?# @ `2 *`@ < 7 7  h`€ 2ݐ "   "    h@ 㿘-0`4 &` > `0&`` @7 ?`c    ,  ` @ `*`2@  "B `  㿘`6-N` 6-R  h@ -N"`-R "`㿘`2 `-0@ O  2-0-0*@&-0   &-0`  @6 !  hN2` @ 20`2-  @V`    ?"@ *`:`!  h*`2` 1 >@ "    @V> "@ `  㿘-0$ < - h >@ 0 @ "-.`!\-`  @?# @2 *` @!\-`  @` *`:`?" 6`-0@ &`&` 㿘  .E    2` >*` 2H B 2B D 2< F 26 H 2J?c 0(2LN 0(2  (2` I2 `P2?#(020`R 2 T?(0*2 `V2?#(02`X `Z2?#(02`\ (2 2  㿘`  ` > 0*` € T B  Bz6`?# @2 *`r@ E D B F ? H`?`#   2 3 **  `N`J 6 `L6 N6 `?# @ `2  *`@R*P  D6  F6  H6  J6  L6  N6 P6 R6 X T6 V6.6  T )6`?# @ `2  *`@XV 6 6  `?`#   2 * `\ *3 `Z 6 6   2  h`*``8*`2`@ 㿘@ @    ?f@"@&@@$@㿘**`Q` &㿈!> 3 ' ` / ` * ` * ` *   Җ   > @(#㿘 !``> #@ x@!"->  4!&$ " p!"? x$" >c@㿘  %@ 4> @ S#8%@  6` "`  `ܔ ?#2 *`@6 㿘  '@ > @ $#X'㘤@ʒ 06!?# "   * 4 6u 㿘 !``> #x@ ̀ D4̑H /f * ' @| "$'> @u  @ Ւ @ @Ԓ @ђ `$$-0 >  x a   2?H 0㿘!`H /f * '    @z?;c#c? 0 R Q$  1   @ Y> @ x#   4 ` "`$ "@$   4 $$ "@$ > a@/"-  @ (> @ G#    4 ` "`$ "@$   4 $$ "@$@\  @2 0  @@俒 H 0㿘 !`@H /f * ' ` "`$  ?"&&  6  &" $ $& "Ѐ  > a̠"@闒 @䁐H 0㿘 !` 4?Ϣc @\ < *`a  **2 ` "`$` ?"@& & `"  "`   "@& &  @ "@ @ aА?$aЁ㿘```a`   @, q D @  ,`I !ԓ;` ,`  g `;`*  `2@ `g;`* ` ?* `@ 0 6 4& & "$ `&  "` "& & !В$!А} >b`@> "̒@㿘` q`` @ѐ *   " ` `  `` @  `?    !`'L  'P 7@ ڐ`> @ 0/?#  @ `*`2  @*2  ?'L'P`P` L@ >  H@Ԗx  P`  x   " -> ̀ ` Ѐ'  > @ xH /f * ' H 0> ʶ`{ ?̒@0-`2   "-Tb -T e``c ` 4 "` ` W`  'P @  `  @  $@`" `  @Y`@"@x$   > x @?|2  `@`' ` @ `   " `x   @`` @@"4$@ >  @2`` " `   >  @%@櫒 ,6!?# |  |  |  @2`. 6* 4 'L2L,`'L2`L 'Lx   $&=X> 3 )!`''L'P) ?# @ ``*`2 @ 'LP'PL` 'L'P  ! /  `   N@d`> @! N2   O@: `  O>  !8@k` 4    . ` ` , :, </"     " : " : " :  < `, : , < : < `, :, <, < , :& Y : < @, ;`, :?  > @!hB  4 6  :> !  "      &>  !Ȁ 2   > "@   4 " > @ܐ"8 > ʐ 4 ⸠ } @| > "`@ɒ!#@o #6'L#?c{W  {S  {OL2`. 2L- `'L2`L * 4`'L2L-X'L &` > @-"㿘!``N    @T> @s"0㿘!``3 2 ` @9> @X"0 ?# 0# 2`㿘 ?`,# @ `*`2> @ @;"` l 2k @> @3#` @2` ` P"=>  "+>  0   > I`$ @'> C`"4>  & )> 8`- 0> 2`> @#A`@#(=`@#89`> @#H4`@#X0`@#h,`> @#x'`@##`@#`> @ݐ#`@ِ#`?# @> 2`#@ϒ ` ` `2 *`@>  #@Ē ` ` , `< BđH /` * ! `?# @2` ``P( `` "!`0`"0`` `"0ɔ 0  0 | 0 H 0@Vd㿘B "    > " |  @0 㿘 @ .1 H / * !  ` > "`{̒@`;> Ґ# .H 0  H 0 㿘`?c * 2` ` !@ 0`\ T@`> #@ 0K` "@    `" `? `\ 3@ΐ > @ (0+H /` * ! ` "`\ > `\  @> @̐ Pl H 0@U^ a̠{r"@c`?# @ `*`2 @48H 0`  +` =  沐 @Uǖ  4 "6aLaP@aT`@Ur$aT#` ; B<`""&``B <`&aH 2" $aDaL$aH $aL`\da0@`? > 3 >' 0  a` @  0!Հ@ ` !Ӏ@ "| !Ҁ@F> 0!׀@ 0!ր@> 0 @s `Pw  zH /f * '  2        ؔ 8H 0Q`PwZ  HH /f * '  2  7X 4 7V 67\ 87Z :w=/^H 0 `@  `Pw$  H /f * ' } " а H 0`'  H 0`X4 > ⸠ zE̒@6H 0`@Ò `<vݔ  `> ` ?@4̐<'<J  vɔ `Ф '`H /f4* ' & h  "@ w  47F  7H 67L 87J :d/Nv@   h@H 0 z` vr &H /f4* ' W  | Sp@᱒ |  ' "7"7"7-L777 47 82 // 6/7 :   // :   / , :   / , :   / ,@v1 |  & ||@H 0`@  ` > @G 㿘@  `w: >>>?&% bPX" b&!`&!d&!p6 > & 0! &!  0&!@@w" 8&"" @!  @ @" #> @ @@@" > @ " >     &"&" &" &" &"&""@ @$"H> @C"> " @=!> >!pL @@ &"> @!0" *&"" *`&"ܑ*  * &"&"&"ԁ㿘H o*@ g@ H 0h ! 77"K"M+`"I*"J+ "L@ "H  77ސ 0@e7"&""&"К@"3`7&"x"&"Ȑ?* "@"" 3`7x7?* "`7"Ԑ " 6"  ", ""ؚ@"`3`: /7Ԑ7/7֒П " f"  0", ""ܚ@"`3` /ː7/77Βȟ " f㿘"x  㿘"x  x d"|`""@""x l"Ԑ"  "x, 2"x4  x d"x  a" "t€ !"?"t€ !"x !B 6  @ ;6 @Ő 0"> !`@; "`@㿘  2bh@QȐ @Q@2 ; <bp" <㿐 @Q-  2 ; @Q 06 0 $ $ $  '􀦠,  @P   쀦@Qa     ( ' $ 8 $ "l $&@ؤ㿘% 2  `B >  t`B >  @뼔  0@^ 㿐"= 2  > !@  > !@  `B >   , > !@  B > "@*`  "` :/77 " " "ؓ,  "d  " @&"ā㿐Y"Ȁ`@ ;=6  @> !@L  @> !@C 0@h 0Q "`"@@ В`B >  > "@"  ЖB>  Ȓ`B > Ȁ`` `"  В`B >  `B > " " "А?&""Ѐ  , "ܔ "d `"  0@s&""Ѐ "6 㿘"t€  ?Q "x  "x  @  Ȓ`B > ( `B > ( >  @"0)   >  @"H B>  $>  @"` ȐB>   """ 7 㿘>   @Fb Bd> 㿐 \ $@ @ib̨+> bܑ,@bd  b \d6 \b@bb! !D@ڡ !` !D!p€ !D ">$b  &!D&!H$ !L?&!L "2$b D ",@F ,@b*`    6 Z0 /77b` bx  Hb " bА  $b \$6 \$b́㿘H /f * '  0@"   H 00`a2@a1@5a @a@"\K 0!5@;0 !6@7 0@\ 4\ ` G@002@  2\3\ ?'4\ 2 @20 @@  4\ @   " "@" H 0㿘㿘 \!'<6`6`6`6@"  @P  @ 2 *2 @  *@ 6@ 2   \ = 6 \ \<"6 \6@6`6`6`㿐"'r@㿐"'r㿐"'@x> 3#p""#h#l '2#p@&#p#p    > m"  #p ?." &#t 4 @ ."& 4." H I.">>!`>> 0&#H&#L&#@"P ""?&# `-&##p? 8#\ ", , #\#`@$ #` @  *` ,@ `` ra  ,#X`>"&#X@3 > "@  # * @#*`  &#  > @C# h> 3" #l #0#!" #h'� t#,t !,t# `' !2]� `X ",  `/>  t d  c   , ,  H,, @, #\#`@@B#\#`@@@  " I,, , #\#`@@$#\#`@@@ 2�   ,� > @ۿ#㿐` "b @cl> ,, , , , >,  ,cp` d`"g`4` " @? ` +@@`2` U`4 /`D/` "=@`0  /  3@   /   2  3@  / ׀> @'# "@> @"#@`2` " `4/ @3@``4   @ c sϐ   @>  c`@E`@2㿐.2`#@ ""@#h#l#t#$@,`4 #\#`@+# &*6 #\#`@@㿐#t "#l#\"#`@#h?# @ `*`2 @6 \ "*@ 2 *` 2 *` *`; *` ` *@ 2  3@`0 ?  +@`㿘\ "`.@ @.`.` 2.` .`?`.`  .@ 2 6 0 . ` @  cs- ` @㿘@6㿘#p    " *`s" *`s?<""* 㿘>> ̒a>"h 8!H&"&">>&"&"  @gԐ???@) "   " @_ @~ "0@{ 㿘"h?@*~?㿘@*ܐ"h 㿘@+"h"&`"&`㿘@*̐"h㿘@+"h" " `@(㿘#p > #> #s㿘#p > #> #st#p"0"(㿘>>"b>"h 8#&"&">>&"&" @ ???@)l "   " @ݖ @ "0@ 㿘"h?@)?㿘@*Z"h 㿘@*~"h"&`"&`㿘@*L"h㿘@*"h#l#l(㿘> cȔr㿘> cȔs㿘`M   : ,@ڏ 4: ;?> 3`+  +`@ b * 2`*` B *2 *  `C + 3` ; 2`*  *`q^ :@Ȓ`B :  2@  B * 2`@ , ?㿘 >  . a @ 6 > "L>aԀ  "L `@ 0 2` @h   @b  8 @5l@ <@ T@ l 㿘 H /e`* &` ` @"(  ` (Ȁ @&(ȑH 0㿘> Ґ`  ` B `* @`<H /e4`8* &`8  @4$`8H 0 p>>#`$ $ Ѐ $ l$ p@-> #t # c$ $ $ $ $ `  $ ` @  $ `   $ %$ H /e * &  ,` @H@3%`l@l  ``cd`$`$`$`$` @ ` . .... `. `. ` # ` $ ? ` `` .` d.p d.p  d ` ".0   ``,` ,` ` .,`. `  ,` 2  p`2 p @" p p $ p ?$ p  @ h H /e * & ` ` p   H 0M <,`. ` 7H 0> > ې"$ px !@3 " ` p $ p `` @fH 00 ` 2 p  @ p > ۑH 0 h> ې#*` €㿘> #` . @  4 8 h> ےc* `@€H /e4 p* & p"   > ʐ . ,`̐ <@d*` p@ p l @I$ p. H 0@# 㿘   8.  , , `   d 2 d. ,  d, o oǐ d ,      0  ,  , , , 0,   * (㿘> #` . @> 8 h*` 㿘> #` . @> 8 h *` > Ґ `* 8 @ 㿘> #` . >  8c h`* @ @ 6@&5  ]@ "h `y@"/ `x@- 0`z@`{@ 0 k@ -  j@0\@V 0sl@m@ 0k  @ , ,`c   ,  @, ,`R  *@, ,`J *   `` 2`@ 2` 2a D 2` ` 2`/&` ` `2 `2 `2  &@   2  @ 2 2 2 2 ,  㿘l> c` * `(  & `$`"``(@ `  # `@!   "# ```` `2` , , ,  `$@@ %, p +>  `$ H!c@1  ??$ p 2 `,,= ,,  , , , "` 2 `$`,`$d ! ,0$  ,`,`@@   2    , , @-0), `$$`($`$   @  > hc* `@€  *@, ,@  l> 3>  c`'*  H /e * & pN 2S  4O  @@"V "F V  H 4 p & p@ H H "7 @ i  p & p 2  , ,`    H p @A  ,@ & @0 H @A5 H,@H 0  , ,`H 0 > @ڐ#H4 p( p" pH 㿐H /e4 * & &  & & H 0  >  8>  @`2> >  8 @#\> `@ 㿘 r l  @m l 8H /e4 * &    H 0 U l "$&  $#& & & p 2 H 0 < l@@    . *`H 0 '> > ۪#xc   "    `& ` & > !̓*"@  T@7*`   h @ * €@*  l@' 㿘 8   / 2  *,   `& `& > !̓*"@  T@*`0 ,   @ࠀ@ . -  &  @ 1@ ` ` ` `@0 .  2  h> ےc* `@€    *@. -    @ࠀ@ > h# *` € p  ?$p `$> @jH> h# *` €   H ` @ `H 㿘H /e * & `  'l ` ?.@`  'k ` ?H 0㿘H/ / .`.@: .` .`.`.` .``H 0(8HXhܝ㿘 . ,   , , ,  , k d   2  "     .  . . . .  2 `,  `   ,  `2  .   `,  !,  2  ".  , ,  2  ,   Z,   `, `2  Z .  `A*`> p €> @ H0:> @ X06> @ p02> @  0. 2  &  >  > @ 0  2  &  >  @ `. > !> !(@  @`. & > @Q!H@(     . &  ,   T, . >b, @l>` <@g> lb@b(  &(ȁ㿘 L ,` ,` ,@,`,` ,` `  ',` ,@ ``  'Р'jҐ  `  ? jĐ d `  'Р'j  `  ? "  @@`  > !h @f& 㿘  @ ! &  > !  #> ғ* @*`c@` @x  ̀ & > !@>0! c*` *   €      *"@@ p> 3 'P   G?>> Ҷ 0cБ- В @H@ǐ  2*H @& @$*@$@$*@&*@0 $*  ?,`*  €?"` "@ Ñ- ?` > @`"㿘?@2 `@6`2` @&` > @ך`a > " @0)`@B \>`0'?'''''`'''''@K @@nWh > "HВ@t0 㿘``   > "@c0$  @  * @ 2 *@@ \ \@)*@ 2* `  @ @D 㿀> 3 '@U @  *8$ < (* $ X@q  8f  (`2*@ ,(*@ (*@ 2*8@  (8  (2*@ ,(*@ (*@ 2 (`< 0*@ 2< 0> ` d "@ ` > @І#㿘! `v c,` r a m M A R C ,`,`,`,@,`,`,`,` ,`,` ,` ,`,`,`,`,`,`,`,`  2`2`2`,`,` ,` ,``  fK 8 ` `!* `"*`@ *  `# ;  `0, `1* `2*  `3*`@ 222 ****`H@ H)\@,  2,`(,`),`*,`+,\ d), , f, @t)& `0㿘H /d * % @  > # @O` &H 0H``> #@`> ґ* * c   @`  2 `(> #h@'ް `' `)*  `***` `+@  6`6` 6` > @##@ j %`X `,` `* `+  `( ` `+` `* `* ` B 2`2`2`2 2 2 ,`,`,`,`,`,`,`,`,`,`,`e| ` `!* `"*`@ *  `#    , @ \ee `   `!*  `"**` `#@   \ `(,  `)* `**`@ * "* `+ *   `\e@)@ ) `(  `)*  `***` `+@    ` `!* `"*`@ *  `# -  ,  `X4 4 4 - $- %- & ` `@ x- 'j  W> `   `!*  `"**` `#@  * H@"$ ''€@O  㿘  @t ! > ґ* * c     @a {   2n@  *  * +` @ +  *` @ *  PT "C2U@ܘ!m2P@ @X `Q?d d \ ( )* **`@ *  + > @S#'\ !* "* *  # * , $ ,  df)  `*  `**` `@  2 \d dU) \`@2@ @ `> 3 '   > ґ* * c     > $  * *`@ *    >  @`@s C@ t ``@;  >  x@a`1$%*`&* * ' @*` * " *  @ > $%*&* *`'@  * *" *  `@2  > @ː > 3 '@z  ,`*`?`"#>  @*T ` ` >,  0  +    @  `` e X`e@   `  > 3`   z> 3  @  !>  @ڒ m> 3"@ @   > !@͒ ]- $,`$ - ~X `2H  ?*  * @  25 @і > !0@ ( 8ޖ  2`  2`  @ c!$$& `   - @v @s > 3  > @!hp> F# `$'+> )> '> @ 2``a@  !@   @  ``2@$ @h Ԁ`   @ 2z@@Ӓ$Ԁ D )    2: `0 `1+  0+` 1*  `2* 2@ **` `3 3@   "` @Ք  2 $ %*` &* *  ' @*` > !@ > $ $` 2 !*  "**` #@  > 0 1* 2*`@ * 3  !@ǒ @@n 6  7*  -`7'7'ܐ@y @`2@Ԁ`   @@  2@'Ԑ@ #> 3j ` '@Z>0 Xe`e@  2?, `2?   @ B C? 4>j8?``>j8 ` > @"㿀> 3 `'  @   ?> d А@   `H PTܘ"Camj @e M>  *  * +   **` @ *    @ 2`  a  !* "*`@ *  #   @۔  > "X`j@`2j `>  " 2   > ""0@  @ ` > @z"㿐#\  * 㿐#\    㿘> b@V`4!>ʐ@ے! "!> #@쭒`> &`0> @짐#(D  㿘 <@ 4& <@Ґ㿘 $8a) 㿘 % / *` * "@c-*` @ &&"` 6 6  ` 6   @ *`*`*`@*` c * 㿘 b!"V ୓*` க* *  ௐ @" ౑*  ಕ* ೓*`@  2 2 2 + + +  + ౓*` ಕ* ೑*  @ ` ఆ ౙ+  ଛ+` ୑*  ಗ* ச@  ೕ* ௓*` @   #       ++++++++2 ! @ H4( `T``(`* (```(`* `(000*** * `(`* `("`` `(`*`(`*``*``* @           (`(`(`(`(`(`(`(`(` (`(`(`H *  (( H(    + + + + + + + + + + + + + + + + + ᨆ+ + +  2 2 2 + + + +  H 㿘 !! !% !ԑ,`& *  @W &!&"`!Ē&"`!̒&` "` @ @`"`?`H 㿘 T!"?<`@"`@"@<"@"<"@ 2<!"?<`@"`@"@<"@"<"@ 2<!"?<`@"`@"@<"@"<"@ 2<! @ 㿘 H /d * %  4  > && & & $& (& ,> & 0&  4V < ୓*` க* *  ௐ @" ౑*  ಕ* ೓*`@  2 2 2 + + +  + ౓*` ಕ* ೑*  @& 8 ఆ ౙ+  ଛ+` ୑*  ಗ* ச@  ೕ* ௓*` @   #       ++++++++ௐ 42 & 8& 4& <ἔ & @"@" ?$ H 0H4(``<"`@`@ @ `@?`<""`<"`@ "`"H  㿘  0 D*` `!H/` /@H 0` !> #0@٤ b @`  @> #X@̔pU 2& ,{ $  %"A 5 "1  5 6"8:"2"0  !2")",-"%"$ ( *#""  """ @@  8 "("4@@ " @` @ & , 4^  @ 0   & ,& H o$*@e@&ސH 0  㿘 0@㿘@{ 40"'@> 0b#@ =b$@;0"%@' 050"&@&0" @  0)0""@ 0"!@  0@"@A@@Ɛ @Ô @ @P 4㿘 Ț D   + @  ` !*  "**` #@   +  `@ &`&` 㿘 Ȱ  ?*`D 2`C!&` ` <=*`>+8 9,`:@?, (;*`@ 3`+  +` >` 45+`6+ 7 *`@  &` !+`"+ # *`@  &`@͒`p`0`@@Ȕ  *㿘  ?*D `2`` @&@ !* "*`@ * # ` @+@ ` `X&``(3`+ +` >``6`6`@琔  ғ* 㿀` 'D $  @d `[`#`\`#  @Rb@D'@``2 '@ ''@   @C*`'@ `Ԁ?'@D> #@`0`  ` D> @#@0` ! @> D> @#В`@  @  > @ڐ#0i D>   D` @ C 0j0ge`> `0 @`0@2  (+@ S`> `8@ `0`I` "` &`B ?@ :`> `@ @Ґ`(@#`@2* "* #* * !@4*=44444*8*9*:*>*;*<*?a'@ ` * @2 2 *`6*`7*`4*`5@@ * ]* _* \* ^@>  `H@析 @@> P @~ H@>   XX@w ` `В `'@ f'쀢 C?! @ D>  `p@0 @`@| D> `@ #@ @K > @ 0`  ```Zth  &` @ "'D>  @0@G D> @#`@  @ > @ 0D> !@ܒ0` Z C #0}0z`@/` \@ ]* ^* _*`@ @(   !*` "* #* @ ]j*`a'@a>Ҩ '@b`a>'@a>ϔ'@b0>ϖx'@b4!8>'@b(cx>'@b8>'@b,>А X'@b$!>Ӟ'@b %>Ҡ!X'@'>Ӥ a0'@ao'@ !'@ >զ a'@ cd!>'@!>'@x"0>'@"4!8>'@"(x>'@"8`>'@",>ДX'@"$!>֞'@" #>ՠ#'@%>֢cܐ!'@d'@ 9/`a'@ a>ܦ '@ a!>'@H!>'@x"0>'@"4!8>'@"(x>'@"8`>'@",>ДX'@"$!>ݞ'@" #>ՠ!'@%>֢cܐ!'@d'@  /`!!@@ !@ > > D`$  '`4'`<7`7`*'`8'`@7`(@Ĥ `'"@@Ğ  H/` /D" @H 0 >D @ H/` /D"@H 0 > F#`t `$2``m`D* `D"`` ? *`2  *쀠`@ 4 4 4 * 0* 3* 1* 2@  @ p!  @ p@  D> @p@僐!8@4 4 4 *`1*`3*`0*`2@ p@  1@  D> !x@h!! '@! '@> >ѐ!p @b '@@㿘 Ȧ   , D ` p@䦔 2    $ ** * @* 㿘`@`> 0j ? j@@ߐ  @ 2j &@㿘 3!!` @  " @   " @   `D@ `D @   $`D* " @ْ 㿘 I`FH /d * % ! `> @!p@$ ܠ %> #>  a  *`" * @ߔ #2@U!  " @  m H 0P'> 3 :' @'  !///// @`@@㷔 @`H@㲔 @В`X@㭔 ̔ : > @! `> 3'   '` %; Ȑ@   `8 `9+  `:* *  `;   ? 2 2 ////  < =* >*` ?@ *  3 3 3 ////ː /Ĕ //=/?> 3'@´   `< `=+ `8( `9+  `>+` `:@ `;( `?*  2***222/ѯ22@ Ĕ ///////////> > 3  > @i! 㿘  !@ "(@" p(@ "(@"  " (@(@  "(@" p(@"  (@"" (@(@ 㿘 "`4X0 @;     @" "@  @2  "@ 㿘   `?H /d * %  ؒ $#> 1>  !̐*`"  @aЀ #2 $H 0 @㿘> "D` > a@)ǐ    a& < ` <& @`""` 4  D E* F*`@  G*  @ݐ €  *` * *   @2 D㿘 #> @a  $8#> 3`'@[D@[P@[~` > @!㿘@4=    ` ?`@ . . h >  "#     #\ #` #d #h #l #p #t #x #|@#`> @⯐#(㿘 D`Ƞ ,    `@q      ,  !  ? 2  ?㿘< 㿐'D @ `' $ 2 @@> L"H     *  *  * J 4     - /`+`(     5` 5- @@ @ -`4,-@, @ @   @ > @@> "h`@pM   *  *   >D`;  $8  8 BDB:  @ < =*` >* 8+` 9@ :+ * ? *` ;@    2'D`('b (@b (@b b (@ !b (@ (@ 㿘> "D` > b@(R Đ `9ؘ̚  @4,@2  @8%@ @4 @2&  @8@& 0  <00 20"0& < & @ "@#  `B  : @2  㿘!!H`@ດ   !0 !4&  &  `p@୔ !@  @`<   >Ғa@U $`<@W 㿘`@@Ð㿘 D           .`"` " D D " D D D88 D888888``.`㿘   ̐ 2w 2  \ ]* ^*`@ *  _ ^?&  㿘 " ِ 㿘H /d * % ! .`  X@)`"" XH 0`.` ` >  "p`@!!@ >&  @ H 0x !  !* "*  *` #@   "? 6"   > + @X` *`p`@ޖ@    #@ ؐ @ ` " ! > "`@Ŕp&P > '('˒ 2t   ` `!* +  `\ `]* `^( `"+` `_@ `#- 5`*      ?ȣ-` ?Д@!Ȩ@| ?BȠ  @ ?ؐ@0@蒂@$B?(  @К @:b  ?2 @  >` \ ' ;& ,  +`X'' `>`0(.`0Ğ\`10 .`1`2 .`23: `33366 62`2` @2`2 2 2 0`.`3.`x.`z.`t.`u.`s.`A.`B.`y.`v.`p.`q.`r.`@.`C.`H0`.`{.`w.`=.`>.`<.`?.`8.`9.`:.`;.`I0`>.`J.`K.`4.`5.`6.`7`0`6 `02 `12 2 6 6 .`-.`,.`..`/.`.`.`.``2+**`3 (@ `02.`0`12 .`1`22 .`2 `3 22 3 .`.`3.`.`.`j 222.`D.`E.`F.`G.`|.`}.`~.`&`.`.`.`.` 8`2`2`2`.`.`.`.` 8"@g3& 8`B ?B @ 2 ,䀣 (  ,  ,@ ? ? ؖb?Ѐ4  2@  H /d * % % H 0 @@> #8`@Ӕp S 㿘  * *`@ *    H /d * %  0 1 2 3 "P  t u*  v*`@ p,  q +  w( r  4@ 5,` ( *  6@  7,++`@ s+  @ `>  @#X $ `% $ .  * *`@ *   . .  . !  > #@Ӕ. . . .  ( % (  ,  W%  $ 2Z`` %`%`,%`( `1 ̘ ? 2'`< <` @"`@" @ <"@% @% < 0  "  0 <` @"`@#  0 @ <"@ 0" @ 0"`< 0 `؀ > #`@ [@``@kH 00 `%`,@%`@uH 0XTXpXXXXX[[[[L[([p_`<a_`<a_^_0_t_0_0_t^㿘     26 " 㿘 " b 㿘H /d * %  .`  X F (>Ր" €`(`!& ` !! `! `!H 0`.` ` > #ؔp`@ژ! !@ "X @  >&  @R H 0x !  !* "*  *` #@   "? 6" (  Ȕ > , @X` *` p`@ې   " ؀ ) %  " 䀢  ܀  >  0@ '>  ,  X@H &> @] X0>Ր#@ * &( 0! ! ) '!   !    !     >  p`@"p!&㿐 > ( 2g `PB ?`   !* "*`@ *  #  %& , @`  0,x,0 1,y,1 2,z,2 3,{,3 0>,0 1a,1 2 @,2 32`2`2`,3,x,y,z,{>2`2`2`2 2 2 ,u,v,p,q,s,w,t,r`$0222,=,>,?,<`$6 2 2 2 ,9,:,;,8`$6 2`2`2`,A,B,C,@` 6 2 2 2 ,I,K,H,J,4,5,6,72`,,2`2`,-,.,/,,,,`(X #` !* "*  # *`@ @ ` $+ @`X`4>Ր#H*` € 0 1*` 2* 3*  @ 0@ 2`,0 12` ,1 22` ,2 3 `,3L3   !*  "**` #@    >  @`C  - `X`}>Ր#,*` € 0 1* 2*`@ 3*  02,0 12 ,1 22 ,2 3 ,3 3  ,& ,+3 3 ,,,,` + j 222,D,E,F,G,|,},~,$,,,, 82`2`2`,,,, 8"& 8H /d4 * %      H 0   >  `@9p 㿘  * *`@ *    H /d * %  0 1 2 3 "  $ $ $ .  * *`@ *   . .  . !  >  `@k . . . .  ( $ (  ,  $  $ F() t u*  v+  p( q  r+` w*`@  s*  > `@ʐ!L$ 4 4$ 8 " $ @ 2|0r u*  v+  p( q  r+`*` w@ *  s > `@ڣ!@ `$, $$,$( `8 ̢ ? 2.`< <` @"`@" @ <"@$ @$ < 0`!  $ " 0@J  0"  0 <` @"`@$` 0 @ <"@ 0" @ 0"`<+ 0 `р > !p`@Y塚@ݐ``@H 00 `$,$@H 0㿘  4U 4 ୓*` க* *  ௐ @ ౑*  ಕ* ೓*`@  2 2 2 + + +  + ౑*  ಕ* ೓*`@  & 8 ఆ ౓*` ଛ+` ୑*  ಙ+  ச@  ೗* ௕*  @  "@       ++++++++ௐ` 42 & 8& 4 & b @ € " 0> @>! 2 4㿀'D   'H'?H /d * % !*(@'䀢 'j@ 耢 "H 0 "$"@  $@ "@$N"  "@    *  *  * A 4    - /`+`(     5` 5- @@ @ -`4,-@, @ @   @ ?2$  *  *   ?$ H`:  @~ K +`2  A Ȕ *  <2$?2$ $$$ 耤 %$"-  $$ $ $ $ `  0!$ $  $ M `B ? 4  4D@~=D @  @H /d * % 耢` @`@耣 @  H 0 㿘 `  @H /d * % @(@H 0@}㿘      "5    / @  K  2  @2     ( (Lh  "  c@  L  &   @@D > 3 '@@co@c~8@c P@В @L  6* ``?$ @cQ@c` @@c\@c@ @L  \* ``?$ @c4@cC @@c? @cf > @!%> 3' @x@cc  @c!@cH@w `+ (@n  > @\!ȁ㽐> 3 ) ' 1 + + c @Oϔ! # ب)@@Oڐ ( @@N   @4(@1 @,  #@& @#!` > @!㽰 +& (@(Ɛ c&  @O{!  @(@!   )@@O ( @@! &)_@( &  `> 3 ' > b*(#\   @΃ > *   b#\@z #Ȕ?? ,@;ِ 2t ꄐ m N f @ $  `'Ȁ`"Y !'  `< `=*  `>( `8,  `9 `:+ `?( `;* @*2@  7 3#ȓ,k ,'Ԑ@x ! @?`?" ,@@y0??@,;@ ?2@   ӓ, ` > @5"(㿘 - #Ȓ @*(?*`?#Ȣ,@@x@??,:@ ?@  `@i@g 㿘 @ ! >ݐ!$ ($ H /f * ' @{'   H 00@% 㿘   @ "`,H /d * % @ H 0@㿐 > H ` `PB ?& ,   @@> "X`@p߀` 0>+0 1L+1 22+2 322 @+3+z+{+x+y2`2`2`2 2 2 +u+s+w+t+v+p+q+r $222+=+>+?+< $2 2 2 +8+;+9+: $2+@2+A2+B+C (% 0 1*` 2* 3*  @ 0@ 2`+0 12` +1 22` +2 3 `+3 2 2 2 +H+I+J++K 06` 1* 2*`@ 3*  0 `2+0 12 +1 22 +2 3 +36`@6`2 2 2 +H+I+J+K++++>+4+5+6+7 0 6 2`2`2`6 6 +-+,+.+/++++++++ࣔ@ j 222+D+E+F+G+|+}+~+#++++ 8଑2`2`2`++++ 8"& 8H /d * % ^ H 0  &` 㿘  * *`@ *    H /d * %  0 1 2 3 ;  t u*  v+  p( q  r+`*` w@ *  s > @ؐ"x $ `$ $ .  * *`@ *   . .  . !  > "@, . . . .  ( $ (  ,  q$  $ 2$, $,! `1 !̘ ? 2'`< <` @"`@" @ <"@$ @$ < 0  "  0 <` @"`@#  0 @ <"@ 0" @ 0"`<9 0``؀ `2> " @f((, $ 3 3 3 >. . . . "# (# H /f * ' @y' H 00@ H 0㿘 > "D`> b@ `$`( $` 4  *` * *   @" p *` * *   @2 T@``@d㿘    "`,H /d4 * %  H 0 㿘> !> Đb> @ʐ"0L#> >    @`  ` `(@ 2 > "$c, (."c$c @g   >   >   " 0> #" ( @|Ŕ > `"# > @Ӌ#(0 ?"> #`"",a > #@#`##$? 0   ` > $   㿘#`c( `  > @  #$> # c(@ " #$c(,"  " @8 @ ` > > ( ,  ` ј ` c( @@|ҔҴ,Dd߬,,D`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @?  &` &`&` &@`6$ $$@  㿘  @> &  㿘 @>   "  20   " " "     2 0   " "  ``0"42 0(<,",4"< 4, 2"4`(",`( 00 "`00(2 , (""`("0  "4"4(,"(, 00 00(2","("> ," (42( 4"4"43 2"4`,"(`, 00 "`00(2 , (""`,"0  "4"4,(",( 00 00(2","(" ("0`0"4"0 4ݘ  2l4`,42( 4"`4`,("`,( 0`0 0`0(@2","(" ("`0`,(4 ,,n4"k 442`42"4 4(, (, 00 "00(2","("", 0`,`4 4"`4,2 4`,("`,( 0`0 0`0(@2","("m ( 4"`4`(,"`(, 0`0 0`0(@2","(" ,"`0`((4," 44 4 A0",42`4,2"4 4,( ,( 00 "00(2","(""( 0`(`4 4"`4(2 4`(,"`(, 0`0 0`0(@2","(" ,"`0 "42`(2"4㿘`(2`,@`, =( ", ( 2,04"0 "& ( 2# ,# (0" `("(`,",`0"0`4"4`0`"&`(2"`,"`(`(" 0`, 2" 0   0 2 0``0`4"0 "& (2# ,# (` 㿘@   @<ߐ  ( ,&`4&`0&`, &`(`6$ ,$ ($@  㿘  @<  ( , 㿘 @<  ( , ,"  0 ( ( (2 (0 (  0" 0," 0 ("  0 , , ,2 ,0 ,  0" 0(" 0 `(,` "$2  <"$"< $ 2"$`"`   "`  2  ""`"   "$"$"    2"""> " $2 $"$"$3 2"$`"`   "`  2  ""`"   "$"$"    2""" " ` "$"  $ݘ  2l$`$2 $"`$`"` `  ` @2""" "` `$ n$"k $$2`$2"$ $   " 2"""" ``$ $"`$2 $`"` `  ` @2"""m  $"`$`"` `  ` @2""" "` `$" $$ $ A "$2`$2"$ $   " 2"""" ``$ $"`$2 $`"` `  ` @2""" "`  "$2`2"$㿘`2`@` = "  2 $" "&  2# #  " `"`"` " `$"$` `"&`2"`"``" ` 2"   2 `` `$" "& 2# # ` 㿘@   @:ʐ   &`$&` &` &``6$ $ $@  㿘  @:    㿘 @:    "     2 0   " "  "     2 0   " "  ` "@0 @ ""`" `" ` " *` ( > 4̅(" "" " 㿘> 4!  $@ @* & B4@ $&  & #&  @ x> 3  '  \ "\*`>Ԑ ``X"Ԁ"` \ >  `B :X"؀` ѐ ` >  `B : 2  Xb`> !  !xB` : > @!#X t @ $ؐ@’ t $/t $     /` '/''''> 4 X`@qM`X #;g`> B:` 0?R`t t $ `$G    @2 @2  @2 @" ( $ @@@@ X ;` `X +`+`T+`<` `2!x`> #@ʆ!x`> @# *  *<*T > @#> 3 ' 2/ c @2'b- "''> a`> B:`Ȑ#?p& 2ebb̀`> bȀ >  @„!&> `B : 2b[? `b* xc `@2b- " 0" 0  r> # > #@` > @ # @ > @#> @\ *?> 4!"`pc$* y`0`> bȐ "b> ! !pB`"!p: Ѐ`  X > ?`B : ` > @o#؁㿘.`t@  > > > > #`@@!"# "=$@ 8 3#> > ! `|| ' ` @2#ax >  X>  >  @ɗ   @> @Ɋ#@c=? 2 c@ے.`t" > #@ 2# @?'?>  |`|@  .#`t  <#   <"@ " <`t   8 `#@ 8"`@" <@"`8@ 8#  㿘 t x@"& t x @   t @ 㿘.` t@8".`2.` t`""`"`<?"""> #@n `8 2&> #`@ 2" @ D 2" > @X#&㿘> @;# `8"`< "`8 㿘d h@  > > > #`@<"ߐ! &' F\*  B& G* ` B` F * 2 G` * 2@ C*% B!*`$! '@(  B@  B`@ 2` @ "2`" C@*%@ B*`$'@ E &@&&@& 㿘 &| "tu?&x > #@Ȓh?  . ]?@3>   > a!`>!|B:!`&>   a!x`>  @=`> @7 > @4#/?> c&`&`""`a !l`B ; #!l@ X# `2t %`2  . 2 @  . 㿘> a`> B:`Ր 㿘> `B : ( ">  @ > F# & ( " @("@"&(8`>  |` | 2 @2 x t@`2` 㿘> a`> B:`# # 8 `` t   x 2  "  &怦`   㿘> > !Ȥb +>)> '> ̐` @ H /* ` ! l`@@ @ @8Т @S H 0̝㿘 ?  @  > > > #`@Ţ#(  X> > > #` @Ř#* bl b> ""l `> bb"> "c4" @ $ =ː @z$ > 4!0  㿘> #_? ;> !)> 4 X`0 t!̀@+2  0> @u) d  0`"bȐ?"b 0b 2 b̀ 2@Q Fc> pB$p<ؐ @$` > @u d" >"X\ \X XX`> 4> > 4 " t""X XX`> 4> > 4 " t""p < 2>  t  ,  $ "   0#` #\ X#d#t#x#h#l#p#|@#>  > cD      @^  . 㿘>  `"  bab] "  X> > > #`@@ė$6b?  "b XbȀ 2 `@QL  ``" \b?  "b `bȀ 2 \@Q<  \` b? "b \@Q0 @E$ |@~ܒ  `"  "`> "# ? "& &  "> @R'> !@I> l`B "l:㿘??3 > `` '  ` `  `> @t  d  `?x > 4à 8 ?? `> @s d m `?? $ `` `> #Ѐ`$ `> @t d㿘`$ 2 @vk&` `?㿘 $   @v&  $  2" Ȁ2" ?" 㿘.`0]> ` 2` @a!`.`2``Q> @Z!p0M     * ` 2 ` " "@ $      *  %> )>    2 @#x  .@!8 @x  倢6``> @ !㿘 @ 㿘` 2 t ` 2 x``% %      "> >  :"> > > @֐! `> @ѐ! `@͐! `@ɐ! ``%@Đ! `  `0 > @ĺ!`> @ĵ!`> @İ!` =`$> @ĩ!`"`6`$ > @ğ!؀">  )$> @ĕ!$"" @č!耦 4 .> >  , 0! 8@Ā 4 =` >  U "> > "@t `> @p"( Da H P@j L =`  U`> "@_ `@]"(>  T"0@X <㿘  > @O!Ѐ  > @I"8  > @C"@  > @="H  > @7"P  > @1"X  @> @+"` @ > @%"h > @ "pxؒ"? 6" "X"X@#) #)@ ؀" #%" `a'#% #%@ ܀" #-" da'#- #-@ " #." ha'#. #.@ 䀢"  ," la' , ,@@g  耢"  (" pa' ( (@ - -@ 쀢"  \" ta' \ \@ 0@> 0  "  X" xa' X X@ ] ]   " |a'! 2k"X *`   `  `"  a"  `*`㿘 $`$@2H `B> >!*` € ` @2:  `@25  `@20 @@2+  `@2&  `@2!  `@2  `@   ` H H  ` @ @ @"x  * ( (*`00*0?# 3   +  + 2 㿀c> 3` '@_=9 6@ 0R  `*   2 66@ * / `*  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2w6 > @""㿐 ?'L*  * @' * * * LL `2 `2.  `. . .L@?L @ * 2 B6@㿀!> 3 '  -@* '2 * !2 * 2 * 2 *  2 *   2 * 2 6@  > @"p\> 3`  d'o kRL``@@*`` 6@/ @24 Ж 7@@4 @ʖ ` 4@* @2  4@ ' `"0S *   2 4 @ *  2 4@* 2 1  @*  2 *  2 *  }2 *  w2 *  q2 *  k2 *  2 d4@Iɔ``0@Ж R* 2 L 35Р D@ґ* >2 ԑ* 82 ֑* 22 ؑ* ,2 ڑ*  &2 ܑ*   2 * 2 4@ > @Ő"X > 32 , `?Ȭ '  B`#\  @$) 2 @[ I `  0C`E?4 $;7 `@/` /`/`/`/`/`/`/ X#@ Đ " Q .@.`.`.`.`.`.`.`ϲ` $ @$ 4 @ @` > @C"ȁp> 3/]x'L| l'P*g'Xj' 7^  `  0  ( @  t  `6 .`66`4"h 6&`,  > J"  h`&`0&`$> J h`&`   &`&`@&`"` ` ,` L4``$` P@$` L ,,,4nP4j ( c-   $ , ^\4`4 $ $  4   , , ^ 4 O> 3b @4 @ @@ /*@@ $@ ,`> " ]` 4``4`> ",`],`4`     X @ѐ1> 3`X  '//'4w 4s  4 ؒ  @L > 3  (@)4   @ `,,#\    @^ > 3  > @P"㿘沒 @Ֆ  ! `6 *`6"h 6"`," `"`0"`$  0  ` @] 0`@4I    `0&@@```` ` `  " ``@ `?  4  / @+ )   8         @            ?/>( ( %@     `? `? @  @ @  `?@ @ `? 㿘.`.. 2`2ė2㿘     㿘     2 c* 4" c* c"  c2 `42 4`42 46" , 㿘`"\"e'@ ? > @t"a1&2 "'> *  &@`L"  &  c: " & b\$? @E&  & && b\$h&@@."* @&㿘> . <$  I* `"& ""% 2 ` @  "\"e'@@E  & h&@x, @&0 ? & 2'&@\%`2 (`"@ " (!& "  " 0$@*#@@*#@`*#``*#` `  *#`  ```" 0 "  " "  "" " "  '"/@0@ " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "@` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"@`` @" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"```@" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"`@ @` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "` > 3a  @`''XP'\b- L Jp /ؒc @b- "''>  a`> B:`Ȓ`# -'@ ` "( 2@`$ 2 @`( 2@`, "@` ɔ!!x`N> @h# > @a#8= `$ 6 ,   "` . 5`  X`4 5  (  `  \`4 5    `( 8'\ 'X ` 5  " 5 ?X 5 `>" *` €\n @\X" @ H    @  =  9 5 ! #\X \@ X$(`?\@ X$$`?\@ X$ @?\@ $\Xݘ@\X   \Xu@ $``    `H,\X@lƚ < \ X  0 (`$$ $  ?$, , \?$, ,H\X@l 2 (D 'X '\ﳔﯔ   "       z@   > #@` 5  > @%#@  > @# ` > @#`P\> 3`'l'L''f'Pj'T@ LP>   > 3 2 2@` < #ȸT//40 7ꀥ7  , .`4 7   XL 42`   7 JL q2@(..2 ,4 ?@ $@* 2`@7 ۔   , 2 @  *`2  *` 47   ?, 2 @ |?*`2  L b- `'>"4*` €LP 2   @jT@eT@`T@[T > 3  > @А#p㿀h> -a@"* dx@? ^'L`7f''?'`' c$     b `0  00`C X@s :0 ) 2 %`'耢 "d' -`"  B@"h' .`" $ C@" $l'耢    B@@ 2_  $    B@3 2R  $ 2 $ B@ "G  $ 2 $ @i B "<  $ 2 $ @s B "1  $ 2 $ B J "%  $ 2" , B  `" ,`              2 ,  ,耤   - *` (2 *  `耤   `  '耤`e `$    B@ 2R  `$   B@" "G  `$ 2 `$` @iD B "<  `$ 2 `$` @s  B "1  `$ 2 `$ B`Δ "%  `$ 2" `, B` `" `,` `   `  `   `u 2 `,  `, x'耤\` $   B@R  $ 2 $ B@ u $ 2 $ @h B j $ 2 $ @r B _ $ 2 $ Bi S $  ` B ```      ` ` 0` `-  .`*`(2  |7'c ϔ "d`" C L @j@kd !'c 2'bh 6b\   ƚ 耢    耢` `"% c$ 2 `"  c$    㿀txh lp* 2 *` 2`#h#\#`#d ښ *#\#d#`#h * 2 *` 2`#h#\#`#d  #h#\#d#` -`- 2 2`#d#h\#\`#`d #$?`"`>"H* €#\#`"(#d"* C4` B#h#l > #@`> "*#@"(| $w" `$ 2 B B  " ` 0j` `X e` `\ ^`8#`0V $ 2 B B  " 0K `X F``y 0@`\ <`8`(o 06i 00 B 2' "-  2 "*" BR"*4`"( X" #@@ג`"(?c @ 8#@ 4"( 240 㿐`^`C?#&`&` &`" `\?`M> #ЀF>   `$`( `(`$`B  *<?@*'*2`'2@ 2"@' @E 2 *2@ݘ 2@ @Ř 2@ ? `&`@`&`@`&` H> 3. 6' #\  @š  Ā$ @   " ` `` 8  ` (  @&  > @#@>  b> 3`. 6' 7#\ @  Ā$       *   (  &  > @ؐ#X>  > 3`` ``'` `0+ؐ@˒ * /"@H  @I -,`@ *   / "  " " " @G  (,`< ` n$@?* 2  * 8 Ր?"8,`.2 2`@8 @ *  > @t#Ё㿘 X& #5  t $  0    d  "`@& > 3 )>  L' %> !>  @#p@-#p@.  % L? P?x`    H  ( 0 8 @?x??????????ؐ@- ``@-۔ `B  `$@-Ԕ `(@-Д  @-˔ `(@-ǔ @-> #> `H5> 3"p  #`H> @#`?$('D B'H''''''''''''''7//@#l  > ! 8 B: 87 C "  " BG' :, `A' 7'=7 ' 757 3>  ' @/`7 ` / 7  >  ' >  '  * /   `/7`7 '77> !*@+ 2 2 '#\;`#h#x#l#p#tಒ =䀢 耢 28> !Ȁ " C7 C "   ` } :S ` 7 `   $< F*`   F (   @ @2 2  2 ( @ `+   + 8 #\#`i$,7䀤` G+ @ 2 *   @2  @2      *  6  /ē+   8+  #`#\17$0 `  7 ` $< F*`   F (   @ @2 2  2 ( @ `+   +  8 #\#``7$,䀤` G+ @ 2 *   @2  @2      *  6  ē+   +  8`#\` #`  7$0"0 F*  @2 F   @2 F@2 F " G F*` 8 G*  @   @  @  + @ 8 "` `A4`2` "2` $,@ c+"0 F*    @2 F@2 F 2 F  " G F* `і G* @     @2   2   +  ` Đ '`"C F|c+ F*     @ @ " G+`@ 8[ G* @    @ +  @+   "Ec++  8<=c+*    @    " G+`  G* @     @ +   +   "c++  ֐c+ 2'$/> Ѐ`"Db0BbX:b0@k| ) 2 %`'Ѐ d' #-`  `@" #. h' #.`"  C@ l' `$    `@ 2a  $` Ѐ  `@ 2S  $ А@ ` G `$ 2 ` `@b. < `$ 2 ` `@k 1 `$ 2 А   ` % `$ 2#А `` "Ѐ2` 2 ` 2`  И `^ Р  `," `-`p1'Ѐ `*`(+ 2  t"' `T    `@- 2U  T  Д0@ ` H `T 2 `P `@a = `T  `P `@k 2 T  В@0C ` & `T 2$А ``@ "Ѐ2`D 2 `H 2`L  И`@ `0 Р  `\" `]`x'Ѐ  `Z`X+ |2  |' #/`@2"! #0`@2! #7`"# D@2!# 2! C   #2 #1 !' #` 2А$ C C #` 2А$ A ."` @p?А @H'c <܀ "d` C В@b@dHd !'' 2'h 6'\ D#d"h #D' ( D'ВԔ И"Ѐ ,АؒԔ ИZȀ "Dd@h'''7Ȓ`B = & Ā`"c& Ā @Ж c& `   #d#\#`@o[ c$ c `1 F `*` 䫐 G*` 䤔, F *` 20 G *` 2< 28 2@l CЀ P# M ` I ` `4 ` `     *` (" @   H B: HF7 2  2   #\#`#d#h#l #6 #p#t(#|$#;#x'А `  `  `"*  " `2  " А ` : `  "*  2  "  #$`Pܐ   ( B: (C76 #,` `@ )ė* 2#tH+ 2`*#p##\#`#d܅0###x#|##;h@  Ā @ 耢`"> @#䀢` > @# `"`'X'Th'l7xrv" > x`B :x ``B :`<7# 2$"-  `$B䴒 > `> b- TFd*@ B䣒  > ! h B: h7> !@G! 2 ' \> ! ( B: (7' X' `" &" Xb "b \`"  `b "b \b "b ``" #4b "b `b "b#4 "#   / # @"#&  / #&` / c& @/ C "   V W O :P Q ' ,4  ' 0 ``2' 4#, 2' 4 ," ' 4 ' 4 ,  4    %   0`' 0 B͕2/ = `*  = 7 8 * @?: 7 8   0 ' 0 7 P/ <' H/ T /    / / 4!!' ' `T' `X "`XT  ` B➒`T' `X "`XC 2OE@ + (@, @ "> ! ( B: (7l ``" \b?"b \`" Xb?"b Xb?"b@m @ "E (  ( @#\#`#d@-'  > #@`> @#@- 0E/ d`2# $- (-`2 2`#\#`#d#hX\d` d# @@|>  |XH\ C > @,ݐ> ! X B: X"$`/`@9̑2 7 C 2  2 #, 2  `1/ <E  t xF$*`B@ G(*`B@ ,` F* 20` G* 2< 228 2@@' 0 B2* 2 B/$* 2 B*(7 : 0   #\ `#`#d#h :B#l$#t(#p#x#|# > p`B :p7J d`"`> @#``> @#`"T`X 2T`t 2T> ے#> ! > !pB#!p; @n T@` `X `t > t#> ! > !pTB#!p; @P  h> !@?`B%> \'`'''''耢`"b0BbX:b0@e ) 2 %`g'耢 d_' #-`  @" .hS' .`" `C@lH' `$   `$ @ 2`  $` 耦 `$@  2R  $ `$@w F `$ 2 ` @\`$ ; `$ 2 ` @fb`$ 0 `$ 2  `$ # $ `$ 2" ` "耢2` 2 ` 2`   `$ʔ`   `,@" `T`p'耢   `( @ 2T  T  `(0@ G `T 2 `P @\6`( < `T  `P @e`( 1 T  @0`( % `T # `@ 耢2`D 2 `H 2`L   `@`(f`0   \@ xs' 7`"d`D@2Bd 2>`C   - 26 ] 22 `   - 6 ] 2 2 . `  :  / 2 0 2"`@?`?*`@` )'c   !'\ &$% ' ( 2' 耢    }'''7Ȓ`B < c& #` `#\#d `@j; #$` 쭔?   ( B: (7  p\  `'P'T 'X``  `   `  `   @ 2@ "`  2` TX@)w ` ` 2@> (`B :(} ` "` 2`@"& ` `` " `Z `U d "@ 4 ` `!`  ` T2 B X .  -`` 2 *@  `?2  `` *@6`.` ` 2   &  .  ` `* &  -`* & & -` 2  8!6  ` ``  "@` ` ` d "@ 4 ` ` `2  `  2`  "`` ```   #@` 2   TX' d "@  ` *" ?"%A`!ۑ*  `      "@ @ 2`@ d d#d#\T#`X@)6` 2  -`2 @ *6  $ 4& *`  & &` `     .  ` " `    .  ` "& ` `   .` `2 `  `" ` _ `` 2@> h`B :h2 `  .` `  .`. > 4!"`  (  `  2*`   `  '*` ``(` ` *` ( *` *``? ?  u?"% pA!  j> #@`+> @f [ ` #\#` E#d#h>  x>  #l E @ 2> >   #p>  4 8@?@ d d#d#\T#`X@(Y` 2  -`2 @ *6  $ 4& *`  & &` `     .  `  .`. T )> < %>  `  ` ` @#\#d#`#h#lX #6P #p #t#|# B#xX $A ( 6 & & \+> !axW> @А x ` #\#` E#d#h>  x>  #l E @ 2> >   #p 4>  8@ @  1 ` *#  2 ?"% 3 A!ۓ*  4 $ @  5   6 #\>  @~`` 2@aP`B :P 㿘     .  "    .  "A ` `  .` `26  ``2  +.` ` . .`` " ɐ   7> h`B :hA  `2  2 ` ".`  .`. > 4!"`  (  `    `   (``   `(  *` 8\> 3 B  `/''Ā`/$ `)(%77$ `(77– t& p` X c5 c% 2 c% 2   `@2Ӱ  @@(@( Gt* <` M @`  ,@`0  #\ #`#d#h:#t#l B#p#x#|#X$(܀`u`0 @o`, @i` "  ` 4@> h`B :h|  *`< <`  @?  E`0 @?`, @9``* 08 H`2 G@'"`H G` F**  *H*#\#d#`#h:@ #l#p#t@ #x B#|#YXq`  `H @ ` 4@> p`B :p * 0P " D#\ #`#d8#l#h#p#t#|#x#X$(# B G` * F  *0*`#\,* #`#dP@ #h#t B@ #l#p#x#|#X ,H" "4`D`0" "`LP, "0`8`D "`H*=*U* <* T` 4@> p`B :p  2  (  > #@` > @g \ > @`#* <* T&   #d#`#\ " tx@pt G*  B@ F$+   (   @ @2  2  @2 ( " B + +  B $#`8#\ B G (+ @ 2 (   @2 @2    @(  + +  B 8#`(#\ 'Ā @   > @] `\> 3 `B ` `/'`/`$ `(77`$ `(77ݙ & ` ` 2`X c5 c% 2 c% 2  2  ` @`(`@`(`@  2  *  > 4 + > 4!"`      *` t x@u t `G*  `B@`$ `F+   (   @ @2  2  @2 ( " `B +   `B+ `$ #\`8#` `B `G `(+ @ 2 (   @2 @2    @( +   `B+ `8 `(#\#`@   > @e!x\> 3 C$ '('`'T': 0 @` `        *`    2 B B`7 C// 7$ ِ( $Д (z % ` `  X c5 c% > 4 c%  > 4 24 > 4!̔ & *  t x@' t G* @ B  \ > 3 F$*  @*   @ * @* @* 8 G(*  @*   @ * @* @* }8 @ F* ,`2`ٖ 2` F* 2`T@" Ű F$*    @2 @2   2 @" G*` n G(*    @2 @2   2 @" * `N T} ``?@  // / 5TT#\ @  @  F> #@`> @t! Z ?@ 24> `B :L @L I* PJ@/'|'e'#\ Ȗ ( @p  > > #@`. > @C!H) !ΔT/'|'' 0 3 < +" , 2``/` *` 4 `B < #\8  @0  !x  > @!p  39 *  * @8/````bk`:4  #\  @   > #@` > @А! * | //*  *`2 "* 2ھ I% ` E`2`X c5 c% 2 c% 2  y  ` @`@`(`@`(   `    $ "@$   `5>   > ` *"@@ *> > !!x`>  `!@Y B $> @R! B (> @K!@> !@E 4 P`B < P#@`>  `!@3 B $> @,! B ܹ(> @%!> !@ t x@y t G* @|*  (   @  @2   2  @2 (  **8 #d#\#l#`|#h Ԛ  *@ 2 (   @2  @2     @("  **8 #d#\#l#`#h" ߛ     T@֔  @і@ T@˔  (@ƖȐ c 8#\  @  > #@`T > @i"O * | /ո/* ղ8*`2 :* 2X % ` ߀`  X c5 c% 2 t c% 2  t `@2  t x@  t G* @|*  (   @  @2   2  @2 (8  * 8*#d#\#l#h| #`ߚ> *@ 2 (   @2  @2     @(: * 8*#d#\#h#l #`: ޥ>  T@  @ޖ@ T@ؔ  (@ӖȐp #\  @  > #@`b > @w"0] * | //* 77l % ` `  X c5 c% 2 t c% 2  t `@2&  t x@  t G* @|*  (   @  @2   2  @2 (  * 8*#l#\#d| #`#h  *@ 2 (   @2  @2   2  @2 ( T * 8*#d#\#l #`#h ݺ T@  @@ #\  @˘  > #@` > @"` * | //* 77ד % ` `  X c5 c% 2 t c% 2  t `@2M  t x@G t G* @|*  (   @  @2   2  @2 (  * 8*#l#\#d| #`#h  *@ 2 (   @2  @2   2  @2 ( T * 8*#d#\#l #`#h  T@'  (@"Ȑ /* | +/* %77Җ ]% ` Y`  X c5 c% 2 t c% 2  t `@2  t x@ t G* @|*@ 28*   @28 @2 8  28 @8*#d#\#l| #`#h  c  *@ 28*   @28 @2 8  28 @8*#d#\#l| #`#h   2    > 3T@p  @k@ T@d  (@^ > 3  > @|"h> 3  B` C'// $ Y (U77 $ȐL  (H77 & ` ` 2`X c5 c% 2 c% 2  2ް  ` @`(`@`(`@  2  *  > 4 + > 4!"`      *` t x@ t G* @  > > > #`T@2  $> > > #`U@Ⰰ 2  (> > > #`V@ږ⸀ 2  B> > > #`W@Ζ  "A Fx  F*     @ +` @+` @"  G+`  $ 8 G (*  @+    @ + @+ @A+   8ک (; *     @ +` @+` @" G+` $ b G (*  @+    @ + @+ @+  B E ( ` > @{"ȁ㿘_``)E * 2    277;  7`27@> `B (: @   !  @     *`  (   7` 7@> `B : @p> 3 '@{1 ` ` ` + >  /# `*` > $ /`"` "` "` "`2 =  h`* @.LЀ`#$`   < h`T " @*W ` "<@/=   Ѐ``8 ?"`8 > @z"p> 3 '@z `` `  * /"*   / "  " " " @. @- Ѐ t " 8 ?"8 > @zu"`> 3 ' ' ` >  2 7> @.#  `*7':&c5` `沔 @ޖ  3'c% @ `? ) ' > #@dئ@z4 ܐ ,` /$`c5 @-؀2P> ^a`T "`T`B :P`4 ,<*`0a  > #@`> @\#X02 d  Ș ޙȀ 2$`b @     2$`   ǀ @ "c5  > #@`> @&#(0 @ "  䀊 2@Ȑ`0`   䀊  H "@ `  ?" 䀊  H " @ ` ?"`  l 83 䀊 " H 2 > ^ ̒`" x "x6 `@*`6  > axa,  "a, > c`0 "`0!, 9c5@> ^! L`" Lc5=  l @m &c5@ -'  " !, @}'2c5> ^a`D "`Dc5 2& ؀`" `8 ?"`8@_c5@-   > @y #P> 3 ' ' ` >  2 7> @Ő#  `*7&'c5` `沔 @v  'c% @ `? ' '}@xђ Ԑ ,` /$`$`  $`c5$ $` 6  *6#\  @9 a  > #@`> @#02$ d  8 Ā  `Ȁ `̀ "b`8 b @   ` h  ` l ` p ` d  ` ` N @ E "=c5 '8 `> #@`9> @#05`? ?  ? ? ?@ X4`  l @U c5 " c5!`B:`c5    l@= c5 2&@Yc5 > @x 㿘      :  {   @ !  o*@f*``ca@  @]  "$ ]   @ N"@ & &  @   "@& &  ;@ܱ  '3@0* ,6   &    0% : 0 > ax` "`> c` "`> ]b` "`> (`B :(  4` &  㿘 @]   㿘 @Q    @    @wc @ > > !!h b'`7n 'h'X'd5 `h  ?????????`T "`P P`P2 a!x`>  @`0ʰ !2ǰ   2 > @ @   6   @jn    @`.`` `  7^ a`B :7n `` ''''''  ` `?@  ///// ` /`??'` hd#\#``87^ `    fX6~X #\ 'Ȑ ^-n ađ2 "@* "@'䀢`" #\ @* 2``7^n#`#\XQ*  #\ 'Ȑ ^n .   "@ `  7^ a`B :Y7n#\X%* p #\ 'Ȑ ^Κn n^@ > #`#\Xܚ* * `7^X ` 2 ` @c X ` *`XX'`\'h X ^> ^"dhd#d#h#l#`#\`X7^^ $X @  X "` X` #4`X 7^ a@`B 7n:@x  > @D hX ༀ `"h`  `"hأ^  `` 2 "$ 0$ 0$ $ " ^     X   `   #$    `  6 , 6 ^  `#L` %  6 , 6`cL2`c<"X  ` ``"` c& h`hd#d#\#`o @U ^ `    `  `@  B@ :^ `   `     `B 8^` #$`^ ``?(8 `B ;`H@ B  ;h8 `B ;hH@ B  ;XWX`8 `B ;X`H@ B  ;X H `B ;X8@ B  ;X H `B ;X8@ B  ;X @ ( `B ;X@ B  ;X` `̀" `$ 2`T2  Ԓ @?t ` #$ `?#\`,#``?` @FB`T 2 ^X2  ؒ @?t `` #$ `?#\`\#``?@F!`P^ `@& 7^ c5 X^> !'L!h> b'7  '|'p'x ? `h  ?????????`T "`P P`P2 a!x`>  @`0f !2c   2 > @ '4 6 7v a`B :7$  I L @   7vL  ` `* @  7v a `B : 7h@`?`` @ '/'//''''// `>  `*  ( '?  `$@ /`(@ 3f < +"( , ]zwTr|x#\#` * 2``7v `B >7 aax > @  &7v#\   aax > @ϐ!7v ``B >` aax > @!7v `@`B >`@7ݦ #\  Ϛ  x > @!0 7vȦ  3 *  * @/󀥠x`" : : |p\xp #\ 'Ȑ v Z#\ē2`*`"" ' @* 2``7v#`#\prP*  #\ 'Ȑ vk .   "@ `  7v a`B :Y7#\ps%*  #\ 'Ȑ v? v@ = #`#\pM* * `7vp ` 2 ` @` p ` *`pX'\'| p @> "0|x#d#h#l#`#\pޏ7v@v@俐v !p " p #4`p 7v a@`B 7:@x  > @!Hp  "h`  "hv  ` "$ 0$ 0$ $ . v *   $ p   `   #$   @  `  `  `   6 , 6v #L`  6 , 6cL2<"@"D"H" p   ``" c& ||x#d#\#` @R  v `    `   @ B :v `   `    `B ;@v #$`v `?(8 `B ;@H@ B  ;@|8 `B ;@|H@ B  ;@pWp`8 `B ;@p`H@ B  ;@p H `B ;@p8@ B  ;@p H `B ;@p8@ B  ;@p @ ( `B ;@p@ B  ;@p `̀> b" `$ 2`T2 Ԑ @?t ` #$ `?#\`,#``?` @B`T 2vp2  ؒ` @?t ` #$ `?#\`\#``?@B`Pv  L@L" 7v c5 Lpv @ 0`05  3? x `x.  0'` # ! ?`  ?`  ?`   ?`   ?  % `%\ $ `$W" G @K  I?`D 06` ?  =?`8  6?`1  /?`*  (?`#  !?`  ?@  ?`  ? ` "`"" @8 2@ `8 @8?2  ` (  ?`   ? `" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @ &  㿘 @~   "  20   " " "     2 0   " "  `㿐'> > #\ax`   @/ #> > #\a` 0  @% %> > #\a, 0  @ !> > #\a"   @ > > a#\ #  @ `@#c` @  c, @ 0"cP @ > c"c" > c"c" 㿘> 4> a"%> 3> #@` > > b(@{" >  ""H@v@ ` >  ! "  (> > > !a@Ɣ > > > #a'> +> 5> /> -> )> (@N  ""H@J@c  @2 @> ᰒax@  @  ! 2 (ᰒa`@ (!x㿘!> "  *@mݐ > a!x  > > b@" " > "@ "@" @'> > #` "| @9" @ | @ | *@m !!x` > > b@" |> #@"@|@> #`  @|@  @ 㿘 ! 2 , , E?%> '> ` "` "$ $@ޙ @ `  ,? $ 0+)?#> %> '> )> `""`"@"" , " >   @8> #0@! @ސ"`| ,?$`|@_ ` * `2 "` " `" hȒ G> 4! !"& ( `>  "`>  "   ? "& & 㬀 & 㬐 "` "`"! `>  "`>  "   ? "& & 㴀 & 㴐 "` "`"㴐& 㿘 ! > > "$? `"  "`> "# ? "& & >  @]0"(( `"  "`> "# ? "& & > ",@F㿘?  3  * @ <"*`3  'P <  ! "  > > > !a@*!M   "@ & & @ 2G ,!>  @  &@ @ &@@> 4*`!@2 $@` " @`" @ ` * @`2 "!@"`(@" ,> @"$@> ##`"@㬐 "`@ # @"@"` /` ` ` ,2`*  ` @  ` ` *  $`` `> > > !a@!x2 2 2@ @3`# @+  ,* @ "@ 2@ #+ @" ",-_4 @> #@` > > c@" > #@ 4@% @5 * 5  Q/` #-,2`2  @*@ C> !Ȥ  -> )> '>  * !x` &#@ ,`2`@ ,` 2 * #@#@ `"  "` ?"$$ > @)!`> b ?` "b ` * 4@7 $ *2$P `@ `! *`!2@@ ,`&@ ,"`@"`,@ , & &@" %@&@ `! Ԗ , `8)> #> > ` @` * " *$2 @ # ` !`` * !!x`c@m" > ```` * ?@ `$@^ `2`!ax  ,> > c@O" @> `$ @@I4 @4 `$  `,2 > > > !aP@!? c *  $ ax  > > c@&" >  `@"@Z ^&@!> @ݦ&@o!`> b ?"b   @@ba`" ?$" @ݐ`2 @ $ @ $@&@ +  4  @  " &  &   @& !!x`> > c@Ґ" >  x@͒0 > @%!`>  @۬"  㿐@` `* *`"'P    ! 2 > > > !a@" 2r ,!> ",@  &q",@ْ _&> "@Ғ > @",S&|  "|> 4*`!2 $` "``"` *` `2"!" (44 " ,`, $ ,"`"`, ,$> ڐ"(> ##`"㴐 "` # "" > c@ > > `@7" -`> -` Е2@/2   -`2 @     (   > > > !a@q"G-` 2 $@@ > #@`> > `@" ->  !` @3`P`#@`> > `@" > -`!8  @ޛ3`5 ^> #@`> > `@Ґ" `- 2 > #\!`@ǔ%5 @ C@ * @  % " @> > > !a@"t `*`@b@ @4   <` ` @`&  ` "@" `> > > !a@"" 6`+6`) #@`> > `@v" `- 2 > #\!Д @k> "@ 5> `| "`|44  $" %$ - 4@ > #@`> > `@F" > -``! 2 @=44 g `;> #@`> > `@/"  > `-` " #\24@$4 % ! @ؒ     ` @`&  ` "@"56`> > > !aH@e"+ )> #@`> > `@"  > `-` "x#\ 2@4> "@+ > `| "`|44  $$ "$ p0   @*> #@`> > `@Ð" `-`>  - "#\ 3 #`@3`4 `""`?"$$> "; ?  @9 > > > > !a@"#@`> > `@" `-` >  - "#\ 3 #`@{3` 4 `"  "` ?"%% > "@> `|?"`|@P-$2 @*2$P 2 `! *`! ! Q,` L` $@G> #@` > > `@;" > `"@5$n5& '@P ,`( `!$ P  ` `! *`! !`2> #@` > > `@ " > `@# `! *`!@ x>  a'? @*  2 *`',`ܒb0BbX@@ !axG> > " @c8> @#H>$ > !ax1> > c8@" > #P@'ȓ5`?@#> !ax> > c8@" > #`@c &K> b$  ' `! , `$2  /> > !`@~  >  6> (`B :(b  "b $ $ > #@` > > c8@X" ,> #p5`@Q2g & "G  ! A `' 6 2s c3> b(Ȑ ' !, $2  ( c c $/> *!c 3 [쨒 &쀢 q0` 6 - 6 "A c3 ! z; c3?В @  *4 2 4 c3 " c @  `, Ӗ 4 c @   c8*`, 2`4 c (+&@\*4,  4 2 " c @  `, © 4 c @   c8*`, 2`š4 c &T  @ 7 @O  6> (`B `C:( c& ?#d`#\#`5  6>  `B : !x  > > " @wc8> @t#  6 `B < `  c&  #d`#\#`@DN  `> ! @'Ԁ`ߒb0BbX@>T  "+  `$ 2 `$`ţ  "  `$ 2 `,`  `   `  `   `P  2 `,  `," `T|`p    2 2L  `T   蝔`0 "A  `T 2 `T`P@4  "6  `T 2 `T`P@>  "+  `T 2 `T`0`@I  "  `T 2 `\`@  `D   `H  `L   `0`@  2 `\  `\`"`x" c$ ` @? b8  `B @? bH :@  @ B @: @ 'Ԧ (  ` 3 3 < +"  ,   z  w`2t  #\  F  3 *  * ^#\  1 ? * c #\   {耢 2#\5    l r耢 !  * @i#\   T *` '7ԀT (  P &#\`w `  * @"Ԁ = (  / c3Y  *U,0S  * @)Ԁ ' #\ؖ  汚 ?ږc c $? 2  6> `B : 6>  `B  :  6> `B :`"  c&  #d`#\#`@BH  㿀> ! \ @ # B"0B"X@ `2 `` ` I> `2  `C>  `( ?>  2` 9 @2 2` `  ,  *`*$ 2`  4 ` 2 #`  44 #   B@ 2 @  > !  B: 7` #&   `#d #\#`@@  @> 3 '  > > > > !a@ܔ%W#@y ' @` B  "      *` "l  2 (g  bB#\* k X  2 .쀦 P?# 8  " 3  < (- ` @82`"` *  ' . . . *  ' .` .` .`""` "@  (& `   4 ` > @_#㿘 (`" @> @z;# @`> @z5#0\> 3`'H d  ' @ 2 B> > > !a@%B  " `"   ` 8*` *`"    ` 8*` * 2   "@  2 B@   B2#\H* 㚚  2 ,`쀤` w?# `  [  d> !!x`> > c@S" > @P E>  A *`  ' , , ," `" `  `     *`  ' * * * @`" `   `"  '      ($@ `   ` 4   &@ H2*@/@`"-@` (@"@@  > > 4!`b" > #@`> > c@ː" > @Ȑ (> @Ð ?c  2@`$` @"@@ > #@`> > c@" > @ @> @ @?c  2ɀ`ŀ@`` ` `X"@> !" '`" 'Вb@ ??# . **"@_"* `ڰ ` @ > ` " > `"4 "@ > @<4> !!x`&> > c@7" @>  X    0` "   1 "@   2 @  3@ !ax > > c@" !>  x#@^@~ax  > > c@~" >  @~ ax  > > c@~" @>    @~ ax  Ӑ > @~א  6`0`B >`0 2G4 `2C4  24 `  44 `"44 "04@`",4 "(4` #!@> !!x`> > c@~" > @~!@ > @~  6 0`B < 0k 4 -) ` $`@ 2`2> c@ @   > > c@~c" > @~`!0U > @~Y : `7> 3` ! 2> 3@# ` <"` ` 2"` "  `<"`` "``  `  "``   2`> 3  > @\!` > 32 `,Ȣ '`!  #\  .`0 2 @ ( ږ 6 4 $@`  `   ߀  @` > @\f!"`" ` ` ?  ` @@ ?`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @k  &` &`&` &@`6$ $$@  㿘  @I &  㿘 @7   "  20   " " "     2 0   " "  ``"2 <""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @Ԓ    㿘 @    "     2 0   " "  "     2 0   " "  ` >5(        㿘 !(@wy   && & & & & $`8 8 8㿘  @!% @w`%$@w h> ֐"ذ@#u 㿘NN /" N 1> !ې  $h㿘N  1> !N /" ސ   @!t$@V$@w$`@v /  ,@Đ `!``@wn$L@`i,(> h@x!@#  > h@x "2,L@ @Vߐ ? ` %@Vؐ`h#%@" F  @!  @v̔%$ $ (@w, @`  h`h$@w%> a@v$$@v->   ``$$ w ()$h$%,@@v / 2,L@ @" $h㿘 B> !>!`:`$ 6e 2! .!$ *   4  `"`  8 8!> X"!` "!Ɛ $!@"p  $hĀ㿘&"\.#9.#:N  r  @ $@V$N / @v$8.#9a`" ,J`h `h,@v$N . B@u / ",.@#9 .#9N`.2 LN .2LN /L > a@v9$@v5$@uz /  > @vb  .#:.@@" `> a`2&"\> @v" > @v"`@!  e  "e㿘.b\ "y c9  > a$@v"b\`h@u$Xc: @ $@Uw$!``h,@@v $c9 6b\1> @u! / "*"@uє$c9  &b\@U h@v   b\> h@v"@! . b\@Ut h@Uqb\L@ hi@Uf @u$@! c:  N > "> "ؐ@u$ 㿘"\`e ?> @v]" &"\ "e"\$h&"\㿘 h@u\`h   ?㿐!> ۠"> > #\!c#P  @m > > #\ c    @m > > #\!c0 Ȕ  @m > > #\#c@ H  @mw > > #\#ؚcP   @mm > > #\#c`   @mc > > #\ D Pcp  @mY @-> @.eL@)> `8`8  @p > c> "0:@ 4> a"$ $> "#> "b> E!> !"!"> "!"> #"#"`> > " "a> #"#"`}?#bh x %L"%`DT#a  <p#a  - Z %` %`4%`L%`@%`%`%`%`$%`<+c$#b%`%`%`%` %`,%`0%`8%`(%`H!> !@TG!!Ȑ @Ʃ$!x$!|>> L@ 㿘>>  〒 @Q > @s#?  0  ?  0  㿘_ "K  4E `   + " *  @@ 27  " *  "    + " *  0@@ 2"   " *  $@"  $* @` `0``b쀢2a`a ?(, ,",( ","(`(",` "`2(㿘 ?%> @1 _ @@-Ȓ  (` ,"`,&  , ("@$ ,$ (P@n? 㿘 b 2 a><`0b` "a@%a`a"a& a?a"@&a&a&bb 8bȀ 4a 0@c@cbb@@' @%b@`0@@0ǐ@0Ő 2 bXb` "bX@%bX@-b "a> !@m㿘   @s  "7 L  , H,``* `H2 @"@,02`#P@ P @    @s @ L4 H`` $ L`$$ `" $` H  $ L$ $  "@&  H㿘`.`2 `H2@`@so @0`2`H㿘.`6``!?H@L? "L`"`& "@"" @ 0`2H㿘> Ӓt l* 2 㿘. > Ӑ l2`> l`* `H0 `@``H2@``L"`L㿘. > Ӑ l2`㿘 $ 2  @ F* 2 & ? 㿘 $ @  㿘 $  @ }  > c@r 0@rߔ 㿘> Ӓ t* 2 㿘. > Ӑ t2`R㿘. > Ӑ t^2`㿘> !@ $ ? `" "` "`  "$ $ L $ @P= > @l# 2   > ch>  "ch$ " 㿘> !` > #h > + a $ ? `" "` "`  "$ $ L $ @O > @ln# 2 %!㿘> !` > ch w H /`  > H 00h* ! > a> h> @  "# # J"a'> L $ 2 @O= 0  @I   2L $3`" "` "` ? "$ $ L $ > #0`@X@O+  "@O  ">  > @k# 2 H 0%!㿐@i  ( !\  @M0!D !` `` ''H /f * ' !D@N H 0㿐@ie 2 " !d@ !D@MC 'H /f * '  @MH 0㿘` .`# &* $@0`4,&, 3@?$@@`&%@*  `$&% 㿘`,  &.`"4* @  .`0 @ $@ `,&, @?&@`&$* $ 㿘`$@$ `$ "  %`( `(@ `%@  @ @ `@ @ `(@ `*@ `,@ `-@ 㿐`0`@PZ@ؒ`@PS@ѐa@PL@ʐc7@Ĕ bd'@齔 b'@鷔 c'@鱔 c '@體 c@駔 c'@顔 c'@雔 c@闔 c '@鑔 c$@鍔 c%@鉔 c-@酔 c(@達 c)@} c*@y c+@u c,@q c.@m c/@i c0@e c1@a c2@] c4@Y c5@U c7@Q 㿘`a y .`"4* @  .`0@  M > !@H CH /` * ! %@*`$ (@ ,   #@   # # "  " @ Ő`%@*  "$@ $$%H 0 (> 3 '@Ϩ  ' ( "$@w $ , *  @  *$ $@ " ڐ"* "@!   ֤8@> #X;#X;`  > @N# 㿘@*O 2     㿘@,{@> =!D> 3`' 0" P@"~;0'@"x`U@"r`@l`&&@@"g0 0 `W@"\ 0 @"V0 T  2`Y@ I`Z@H0 @E ذ 1`>@`<@40< @"70;`0@.`/%@0h @"* %1`;@!`:@16@ 5@`I@`J@"D  2`@ `@ 0D   s1`;@5`:@j0  W@"g0`'@"a`@[`@`T@U0 20;`0@ `/@K0 @G0" P0< @@0h @= ] 1`G@`F@2`@@$`?@,`<@* L D16@ 5@`I@`J@"D : 2`@`@"  0 D   % !> @] d!> @J dH /`0;* !0;/@ 810T@ " W U@ " R> ) &@ "[>  @ ">>  @>  ݰ  @m!>  ְ  +@ "p> 8 N *@N>  ʰ @  Ű @ "0 V@ " | @"%  @"  '@ "@"  (@"  0 `Z@ s)0 @"N0 R@ " 8 S Q@" @  @"   `W@" H0 2@ 0 s`Y@ F 0 n0"`P@ 0 [@ > 0 @" J \ `O@  0 V04 )@ " @>  K 0; -@ 0 D D@ ",? <@ ",& @0< %@ "Y 1@ " 0  A @Y ) 1 :@ ".  ;0h @>   @".  @ "$,8  B >@,$(@>,G$(13@ "T>  H@ ",8  J F@a,kK @ ", } M@ 0 7@" 5@"k> 7#2`@"?.`@"7. ̰ `@U`@" ð !h`> 4  !̐ ` hd  t!!̘  8`x  > @m#0 !h`> 4!x"h  "t> @m#0 : "  44   2  (."* 0@  >.> #@ 2 { !> !@eΒ " f#P  `$b 8$b\$b$bX$aa$a$b$b$a$  @ "$b" $bL` " bh@%` $bX`!@& bh $L`@; " L`Ѐ "LaP`В  $bLa "$ba $b LaP " La@aP* `4c La " c55a* `4c  c5 " c& c% "  c& ",c' c' 8 S `0N " c-  c-ϒ 2  c-Ȑ 2  2 > #Ā  L 2  ( LaЀ  a@ $b` d  "d # c$   2 c5b\ "a c5  a "  a  $b #!@``p?  @ 2""@ "@ `  '  #@ 2   8   "  j44   ."* `"&"* @  . 2  (!> !@d= " Ր#P  `&b 8&b&aa&a&bN``&a@$o` &bX!ߒ@$ bh&bXbh $N`@ " N`Ѐ "NaP3`В  &bNa "&b*a &b NaP " NaaP* `6c Na " c5a* `6c c5 "c&c% " c& ".c'c' 8 ΐ `0ɐ "c- c-J 2 c-C 2  2 > #Ā` ǒ 2 `(`NaЀ  a@+ &b` d  "d #8c$   "b\c5  b\  a "  ^ 0'a  &b>bH>b0>b@>b8>bP> /#  $* @ + $* @  !@* @  쀢@  쀢 22 `    $, @ @?1"@ $&a*@ a`&a@ `"@ "` 2 a&a&a""`&aa"a$* @a""&a$* `"$* @@ " $*`@  %@ @ 0 ?x '>  Nx   |@i 2 ,  &a|@80o@  > #D&t a `  @6s  ``,` R&>  ? "K&_ ` `t`    `" $ 2T`"D %@2LD $( C $tHX "<E @NB "2u pDr "(N " Nx`XJ` `@i 2Nx " ``|@ix 2 `  @6  ``t,``&Ȁ  ٰ @+ ԰} *`* * @ ' " @*;0   > c4.`"* &  @ > #Ѐ $ "  .`@* v``  .` `* "@*`@ (.`"* &!Ȓ*!@&-0x > #H@H. 0q#H@hǔ 0l!@H% x> "x@H! > "@H !> 4!̖!L!Z$!t @&  0U 'I`?@ "M H "E       N  "1  2I 2 I 2I "" I  2 IB " @ " I/. /t@H.,4@kB,4@X ` `t.@ $ U @6D $N0@6F 8ݰ > ""l* 2 &"*"l" `2&6&>@?: &> "*"l> Ӑ 8*  &`> Ӡ 8*`  @c 2  * "&> "#@!@`  :b0:b@:b8:bP:bHa`2:b00 @'>   L $ 2  " >  "c0!x`g> @ht#0c @'>   L $ 2  " > "#0!x`L> @hY#0H> #h@ C > #@` " -  L`$ `$ $`ܐ@a 0(> !$`@ @g  2 L $ 2  $`@Dڐ @a{0 > !`$`$`"!"`/>  &@` >  &``2> #&> #@ 2 >  @`  ```*``   0> #@ ˰ >   @ '   *  r@D  .& #> c̐ "c&@ 2 8   2 !>  P@_ " : DL`0 " @ '`0 $`@@ V @! > $`(c``($`,`"s"`&  #\  "h @`d &`(`20[  #\     @`"  ``(` *`(` D06? K 8   2+ ː   #\ "  0!>  P@_j "  ۸ DL`0 " $`@@`0 $`@@Ԓ @!# c " @#*`@@Ԓ  P@`V  @2@` @     (   * ( "˰   (` ,"`,&` ,? ("$ ($ ,@"1 @@ >  P@`$@ $`(``($`,`"@&`2  ( ,`($`,$`( ," $ ,`$`(`("`,`(&` ($ ($`,@`&`0( " &!  $> "V? v  & 2 0h? d `m& 20Z n .!  $> "*? "#N   (@e @N퉒??    (@e~ @N !   D@ @$< D@ (8@-0 $( D@ (<@0$( D $(@a$0$ D $(@$0 D@ (8@ 0ڰ$(װ D@(<#\0@4@v8ʰ ǰ D@ @$<  D $($8@$0  D $($<@$0 D@@#\#`#d$($4$0$8@$<  D $(@ K$0 ` D $(@ $0{ x D $($8@ $0n, j D $($8@$0`, \D@#\$($8$0$4@$HP@aL@ϐH$2E   @$$( @}  @G  آ$   !L   $ @- @CВ$( $@dj$ @O  @ $  @s$ `@@ $2   @'$$( @"  @> H$ Đ  !$L  $ @Ӓ @Cv$( $@d$ @  @   `@Ȥ@ $2   @ Ր$$( @ Д  @ $ r ``0L  ]> !`'> #h$!@    $ $ G  4*`" *  `0 $ " @\ @Y C `@ @; ק$ #   $0$ @6 @Bْ$( $@cs$  @  @#   . `@ˤ@   > #d? , ,&  @ ( > #O? ?> 4!̀`9 ؁ `0 "`p"&`0`p`t$@&`p"@&`t&`t`l$`d@  &`hځ`h@D0`h"@&`h* Ԑ `̀̐,&?  '>  "`"` 2 > ?#    "`t"`X   ~"!p#? 2 0 x  $4` xD  X `> ?  ""``""`j `2`$ X $ ts 20`"E&dM A&d`> @]> 9"cD7"#D@&̀ 2  @ x ,@  '@! #@3 @/ @* @'  @" @   @ @ H 0`@bd> 3@Pd> 3  > @A nXn`npnnpp0d"2 䨀<䬀"䴀"<  2"d"d  "d䨀2  ""d"  ""䬀" 䰀 2"""> 䬀" 䴀2 ""3 2"d"d  "d䨀2  ""d"  ""䨀" 䰀 2""" "d"" ݘ  2ld䴀2 "dd䨀"d d d@2""" "dd䨀䴀 䬀n"k 䴀2d2" 䬀  䰀 "2"""" dd "d䬀2 d䨀"d d d@2"""m 䨀 "dd䬀"d d d@2""" "dd䨀䴀䬀"  䴔 A"䴀2d䬀2"   䰀 "䨀2"""" dd "d䨀2 d䬀"d d d@2""" "d "2d2"㿘d2d@d =䨀 "䬖$ 2䰀" "&$ 2#$#$䰀" d"d"d"d"d`"&d2"d"dd"$d 2"$  $ 2$`dd" "&$2#$#$` 㿘@   @ $$&d&d&d &d`6$$$$$@  㿘  @ $$ 㿘 @ܒ $$$" $$$$2$0 䨀 $"$䬀"$$" $$$$2$0 䬀 $"$䨀"$ `㿐> > #\#Ě`$ؔ  @Wʘ > > "D`#\ `  @W > > #`(#\ `  @W > >   @ `8  @W#\>  0 *0>  + (pp> (  @_# 㿐|  @ ; @> "6 $  0 , @T 2%  H /` * ! @`" $H 0$`" > @_ H&$ h> 3 > 4''P'̺'L x  ! @] ϰ @ "ʰ   İ ° > ! @i L 'Ԁx 7  'ȴ    0 K ذ  @    @ @   /뀦 2 Z  /ꀢ@ //뀦   Ȑ@k  2V @ @/& L'Զ  ɔ  ? L LL`` @@֒Ԁ   H /`4'А* !'̐@|Ԁ PH 0Ё P@MP2"@  @@?Ԁ L@ה@ > 3  > @= xp> 3 'P' xؠ  @ r 2ذ @ "Ӱ   Ͱ ˰  >   @> @;+ 6( ' /   0 a  @  @4 2*[ `  c'Ԫ/    0 6 ذ p @  i  @  2 Z/ꀢ@" [    /뀢 Z@ [   *["L'Զ  Ŕ  25     ` ` P  H /` * ! @Ԁ  PH 0P 2"    @> 3  > @< X> 3> 4'a'T\'`'H''L'P'X''Ѐx  !d@ u   @ "     > ! @    @AL '''Ȁn H4  ؐ.  0a @ ذ /@5   [   . [ Zꀢ@(& L'Ȑ /" @   /@` 2 @ǒ @ /& L'̐ /`'L    L L`` @ `Ԕ@ 6P`2L@P"@q &Lؑ* H* @)@  /Ъ  2X   LՔ  LN `  @̀& H /`4'Đ* !'@^@@  TH 0ā T@(T "X" 2"P`L"@@   @p@̀H@L@  > 3  > @;r x> 3  ' _8 @ < 2h @ ͐ "c $ ] W / ؐ   B0? @  耢 逢``7 @ @K " / Z   /뀦  Z " ٔ    ` `  `@ 2& ` > @: 㿈 @ ” 7 @ Q "2 $ 2$, @&% @:ڒ  ''$3>[''$b@達 b$@{  `> $ &@\  㿀> 4!̀~ @ } Z @  "U $ 2$O @ I&@:  ''$' 'H /` * ! $3>[b@. b$@( `  @ @U ` H 0  `> $ &@[  p> 3 'L' x   @   @  "  L{ 'ԀM 3 ܔ   0  ذ Y @h  R @ݔ     //뀏 κ  2;    & L'ԴL`     H /`4'А* !'АԒ @  H 0Ё 2& L@є> 3  > @9!  ?0/  *? %` `0J 8? `88 J(J  ?  ?㿈&@@9q   '$  '>[b@ > @Z!($  >[b@  > @Z!X&㿈@9G $#>['b@ > @Z!$b@ > @Z!P> 3 '@9( `  @ //'$2`@ `/`/` ''''$``   ``0&`$ @PH /* ! @ H 0 #  @\  2   X  Y`0`  > @8!؁㿘`> #!> "D!"@RJ 2   `` *0*1"42  *0*1"8 "< "@ "D  *X *Y *\*Z㿘 @ L 㿘 P`> @S'  \ > #@S 0> "D@S㿘@ #> `L ` @ "&`T@Ya$&$㿘       @Ȓ &`T$  $$㿘@   @ L `$"@&$㿘@`@`L`㿘 %#> H /`* !  Z`?. Z P`@R`& PH 0& T L x> 3  ',`) ̐  / /뀎 ̆  `Ͳ  `ݠ ` > @7" 㿘@7 `` ..  "@?* $& "& "@?* &  ..    ?   *``"`  *`*`  & p> 3 '@7q 0`X  $"$H /` * ! `Y`X `   4 В `0@㤘 H 0` ? > @7("8p> 3`X `'$"$H /` * ! `Y`X `   4 В X`0@䔖 H 0` > @XG"P? > @6"x㿘@6 ``X. `Y. `Z. `4 & `8&`<& `@& `D& > 3@ ` `'>P"* €. [ [ 2 `& L`"``&``?`&`ؒ`Z  "`  &``?`&`xH /`* ! P   k  P f 0 @6p @6m  /H 0 T@ '` ` ` ``E `` `U&` Z 2R `??L&`&`J  X # ` X `>" X Y>    4> ``" 8"  <" @"``" " "  $"$2# ` \ `" \ Y>  c  8> ``"( <", @"0 D"4``"8 "< "@ "D  > @5"㿐< @ K @ > D !'? '> @ @V0⠀  $ ` $$$$'`J ` H /` * ! @  `H 0`2&@ 㺰> 3 > 4'̀|  ''@ / ;$(   l$(  C@@ 8 > `'8!Ȓ 2Dd @P  "   @ "N$ $d'O B`@5D$! "7$dȀ   @ ".$d$  '8@  L "d'$dȀ 2 " d @n "$ d 8 ? $d$d'`({$( H /` * ! @:@\  H 0@ 2& @ > 3  > @4Ő"㺰> 3  '|l 'H ', * * k$( * * ʘ$(K  @l > !  d   ?@ "$ d ?$d$d'  H /` * ! @Ր  H 02&  > @4G"㿘?2F @D ? @l 8 @> &1 !? "`%@i   d(ܔ$( 2 0d($( `> & "@U\ 㿐> 4!̀>2 @  @  x @&q  'H /` * ! > !?A@ 8 5H /` * !  du$  0dɡ$ H 0, 2 H 0$$'" @G `H 0`> & "@TВ 㺰> 3 > 4'̦ lR ', + $(   J$(9  @ > ! "d'd(ڰ$( H /` * ! @  H 02&  > @3 #(㺰> 3  \'|m 2 2 2~ '@T ), * * ǩ$( * * ֔$(]  @  <> 8! & d `"@* $d  @ "$ $d'd  2` H /` 0  * ! @  H 0 2'`2'@ > 3  > @2r#8㿐} ; p > 4 !'9? $ @  $ ?$$$$'ݐ 2$ @` a $a&@ $a$2& 㺘> 3  \' m"ʰ  @ C   " a$ " a@"$  #>  &$ 'al 2+$  @   $$'N  @1$ؒ$@R Oa " $$Ȑ@֔  "d'$$Ȁ "  @Ȕ  @ o <' |   0 Ǯ P   "I   2 2; * !& L' `ɲ`$Ā "$ @ $ `@$$ ?'d'd $$Z@ @ 2& 2'  @ @ ې > @1P#H㿐} 9 8 "4 !$ "0 !@2, > !'? d @t  d ?&d&d'` 2d @$!$2& 㿘> 4!̦ | [  "V a$ "R a@> L !Β? ` d @0  &dd  o 2d $ H /`  * ! @ 2d  H 0j$a$2&2& `> 3 $'d? $ 2_$ @k Y$ EԔ  &O''''ĐrԀ   L W "$ T Z Z@"L'Ȓ *[$ L'$ L'̠2 LЖ  1АȒM א$ $d&$$d$d&$$d$d&$$d@ $ d `< C  @l  ?@&$  > @0,#X㿘N$ '> b@P " ?N$ 2?$@0T` J ``$J @ 2 ?$ ? ?㿘N /2N#N   / `J@ /  $"$"@P& N# ?@0d:  N `d*N  㿘`@> "@N  > ش ?! "ȁ㿘@@P@  㿘 @$ 㿘> !> b@$Ȑ  "b@  "$$ @` 㿘 $@$Ԁ 㿐`"`"`<`> [!$Ȁ` d? "d$$  ߐ@ > b@?"b@`$    #`2 &$ $Ā "&$ @v &$&$ 㿘  @$ 㿐    H /` * ! $(@/! 0$X@/ 0  >$>$H 0&$㿘> #@H!"   Ċ$( $ &$a  "a $@ْ $@Ԓ @ 2&$@  㿘 $@ 2$㿐`  \ E$ "$@ $ "$@ $Ā "$$̀`"> a ?"a ]$> #@I^㿘$d@Oc @O㿘> !㿘$  $Ȁ 2$ 3   `@> "0"  $> axh $> !p@  ` 2  ` `Z`?"$$`B >$`B >$ 㿘$ \  $Ȁ 2$ f   @> "0"  $> ax% > $!p@ح  2  "  Z ` `@`> @Oj#p /`*,`@ $( `B ;$X @B #:` $ @ P 2 P>  @G!$ P P /`@  `B : P  @B;h> 3 '!@-Ւ$(@No ``h@Ni$- 2&$> 4!̔  `$ @-$ 2&$Ȑ   Ӓ  &$$  &$$ ` > @-#㿘$`> @Nܐ#0 &$$  p> 3 `'?  > "4 2$ > !x$ 2$ $Ȁ 2$ `?2@6 ` @~ > $ `B k>$ `Y ``8`4&>  >  '  M֔ `XД `X  `Y`` &@$ `B 0>$-> +> ``$0$ap@| YI `ؔ> ࠘V  ڀ`  > @,ː#؁ 㿈@,Β  '耦'"$ $>[b@q㿈@,  ''H /`* ! ``&`X &`\ 2``>[$b@N````>[$b@CH 0H> 3 B '2'  C 2#  2 *  2``   B2#\* ؚ  @ ` > @,G#㾸> 3  `'`2  ? @2   ?h?P?X ?`  7b  /jf 7f p'L@$ːL@L  ```* f@ ``(7b7fp/j@֐`@L  2 (쀠x7` t?#Dh ` /hX 2*@ Y*$ 4 `"``   `&  X/d/eX2*@ * 2`X/iX2*@ * &`X2*@ * `D @* @'D. . . D Xf 7fX2*@ * `?X   h> #@`?fb@ X#\h2` ` j;`#h>  H>  P#lf$2 > ("> >  X P `#pdf` #ta"> >  X P >  `#xi> #|  @L> !P@ (  ` > @+, h㿘` G 6`> #@`>  @Lx89`?6` # cc(> 1> 3`3` c # c2@2  2!x`( L  @LK, 2!x`>  @L> 㿐!> ۠"> > !`#\ l  @C > > "|#\`   @C > "!㿘'> Ḁ )>  $"#> $a@Eh 2@Ea"|Ḁ x p  ? x+> ? z |? ~7 7 7 //7/?ؐa@ آ -)> @ !>   @2  @J 2 , ,@J 2  L L@J "B  2 > !@D " -5 "|@C "  > <`<`<@<` p<` x!4` z "4` |4` ~4` ,` ,` $@@C,` a"|@D @ l, +, K, k@$$@ 㿘 "  `@2  ` @2  `@2  ` " @4   ` @ 2  (  ` @`" @,T`*  2 (!$ ` @`"s @,B`*  2m !   ` @`"a @,0` 2[  \ ( ` "R `@, *   `@+{*  2  F@,%*  2: %@+j*  2  21 03 ``)`(`@+  `@+T  !@+%ܑ*  2 ܒ%  `" @+`*  2 0 `@  2P   "" `  2  ` 2  `2  `2   `  2   2""` "`"㿘  @Ii > a`% @"` `4 |` 4 x` l4 ~` 4 z `, `$ , 0 ``2@ p> ! F? ? ? ? 7   7`(7耊 * 7 !ؔ >  L#\L ,  ,@J 0> L ! @J,0  2 `"2 <""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @ɐ   &`&`&` &``6$ $ $@  㿘  @    㿘 @    "     2 0   " "  "     2 0   " "  `㿐!>  | > ےb#\> > a@#@   d@> >  @"`  @%> "c<> @ !P $ |> @E!X㿀> 3 '@&  @F%> P  Ȓ @   @F > 4a& &  &  > @%!x㿘`` >   &   & @E!㿘 7`" `>  ?> @G!0( & ?> @G!0& @E!  >  |    > g @   2   " ``"  @" ``2@ 㿘?H /` * ! > ` 0 "`R 2$ > @E0" $>p& P @  $ > "0@E"@~H 0㿘 P !H /` * ! >  $`"@  @]$ & P\ H 0㿘H /` * ! > `" 2" > @Dؐ"& H 0㿘 H /` * ! >  `""&  H 0㿘H o *@ a > `" > @D"@H 0㿘" \$  X  2 H        2  H  8 (  t  p> 3  $ ' >  #@@>!!" " H /` * ! > bh@DՐ 2> !PQ$`L`L "j`H~ @Ð ` $`T` А $`TВ@D  %`> bp@D  % > b@D  % > b@D  % > b@D `T "> @$b@$_ "@> `T@E> " "!`H? $`Hd  "d  %`L,`a,``$@$`"@`L" & @/`LH 0 `H  l "`L͡`L "#@ #@@>H 0 ` > @#Ӑ"㿘 "  @  ` `  `  2㿘  >  L H #> > @Cy"$`@  T@  a`$$А㿀`> '`"  @(!> ``!> ``  `@@`2` #d#\#`#<` 湚 > `"@DĔ$㿘 o  `k@`"d` `  2^` "X` \ P \ "K`   `?? ">`  `26`   20`   "    `  ` @t  4 2`"@`@ `@``2@㿘>  )>  @#* !@$* >  #(*  @k  > #X@D10W!> * #<*\#<@+ $#<% ` 4 > * c<* $@" ,``,` $` ?$ ?$` $` $`  @  ? @? ?@4` ` 2  @ :@* ,@ ` :` ,@  (,@㿘 $ B `>`L :`H 6H /` * !  `"  "` L"  ?`@" "` " `L|  " L `H > "`H @<#@& H 0 $ ` `L`\`X" 㿘H o *@ a > `@"H 0㿘@Bɔ h!> 3 '@B H /* ! > 7  2 `H 0m  Ӕ `В @!ې`'ؐ''''Ȁ``@!ϒ `a@@!̒ ȀG ?`  P` @! @``@! @> 4!3$``` `` a@*` * *` `*`* * **@  B8@ B  ;$*`ב*`2H 0 > @!k#㿘 H /` >  H 0A * ! >   ? ,@0 2 @ > 4!$ T `Ȑ Ȁ ːX  H 0& 㿘  N @Aw  @!B @ ?А @A "  ?А   㿘H /` * ! >  ? ’  $ D H 0 㿘H /` * ! >  n? 8  $  H 0     `` *`"`` *`   *@ 㿘> " L> `  `<"@@6"@> @6x 㿘`N "( @  > E &" @A 0> `T !>r>r>rb$h  @& l&!4&!,&!0. h&!P. j@3&@2 D u@-Ė @H /f * ' > LL`&"""b "L&" >  .`" H 0  㿘H /f * ' ">  *`" "`"" " "b " ?""$"$" H 0 @-@4 @P  㿘H /f * ' !T &!T!D` ` &!D&!H"`!L?&!LH 0 `@  0ځ㿘@  @2   \"@2 \2 \ P\> 3` d ' `` 2c'o?>  *` `"h `D c@ @  =c$// / /''''b?''쀤b' '``(@@  c&   $   ''ܐ#?''b b􀢠''/ 2 `` 4 `@*`4 ``B <```@ 8C <``D @@+˜   > @ #lt㿘> @5 㿘`j >  "`А"Ȓ @釔 1> Ӏ ]&  8#"#"#"#" 5 #"#"#"#"#"#"#"#"#"@n <  $"(4"$>  В @@c 0  , h> `T , j >}cD>}>sH0$!4$$!0$!P%@ $!, >`@", >`@"D >a@"\ >ch@"t@1@1> c@:  D @,#   㿘@",@"D@"\@"t>  Ѐ`@?@,$@2!>   5(@ܰ  @ْ $ 㿘H /f * ' !T &!T!D` ` &!D&!H"`!L?&!LH 0 `@ 0ځ㿘   @  > #@7!&@   㿘@< `t  &  !> 4&  &  & $`t & ( & , & 0 & 4`t *`2`2`. 8. 9`t"*`2`2`. :. ;`x& < & @ & D & H`x & L & P & T & X`x *`2`2`. \. ]`x"*`2`2`. ^. _`t %. `t $. @>`|`d ߔ `!̔" 222. . . w. 2 2  `2  (+` * @  . . . . !̀@. . .  . !̐"@2 2 2 . . . . ` . `. `. `. ` "`  . `   .  `2`2`2`. . . . `,2 2 2 . i. j. k. h`02`2`2`. l. n. o. m`4222. q. p. r. s`8* 2 2 . u. t`:*`2`2`. v. w`<. x`=. y`(    . a. ``( . b`( 2`2`2`. d. e. f. g. c`D2 2 2 . . . . `H2`2`2`. . . . `L222. . . . `P* 2 2 . . `R*`2`2`. . `T. `U. `@    . . `@ . `@ 2`2`2`. . . . . `X 2 "    . . .  . 2 2 2 . . . . `\ 2 "    . . .  . 2 2 2 . . . . `` 2 "    . . .  . 2 2 2 . . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . 㿘   * *`@ *      > #@`> #@=ޒ    j 2 > #@`>  @=Β`   * *`@ *   >   *  **` @  ?> ` > !@$ :> $*@> "bĀ``b `! !"> !@5ڒ t  耢2 $  <@G $ H@B  D@=  @@8  <@32 4 ( L@, 4 X@' 0 T@" , P@ ( L@ 8 \* 9* ]@  @  : ^* ;* _@  @tD D `0 ` ( >  @ 8 $ $ $ $$  ($ ,$ 0$ 4$ 8 9* @4  : ;* @4" ,%  ,$ <$ @$ D$ H$  L$ P$ T$ X$ \ ]* @4  ^ _* @4" ,% ,$  d  > 4 *  *`@a̕*   a̖"$ $   * “*`@ *  Ð bl * "@ # $   *  “*`@ Õ*a̔   $  ,  ,  ,  ,  , G   *` *  *  @$  h i*  j* k*`@  $ , l m* n* o *`@  $ 0 p q* r* s *`@  $ 4 t u*` 4 8 v w*` 4 : x, < y, = c`2  (`"  a 2` ( b*` d e* f*`@  g*  ( "  *  * *`@  $ D  * *  *`@  $ H  * *  *`@  $ L  *` 4 P  *` 4 R , T , U `2$ X @`"$ X 2` @ *`  * *   *`@ @ "$ X$ `$ \$ $ bb`$b$bsz "* b?$b  > #@5H> #@5B  @`" (> @58# (`> @52#> !@5.㿀>  P> Ӗ`B  P : P  "> !!h`ۀ  " `B < " `B < `,` ` *   @( @ 2  `B <   P(`B :(    P0`B :0 > 'cX@:I  " >s , €` @䢒 R`@  * *`@ *   H /`4J* !J  >  o? <oF2 `t,0*  > H 00L#l? l`8  `2 ` *`t  2 H 0$ ,"`*@(䢒  PH /` * ! ` 䀥@2@>  P%> 퀢  x    ꀢ  耢   !x`(`P@:ŐH`P`B  <`Pʒ  `@ՠ H 0р ,"`*@Ֆ䢒  PH /` * ! `@>  P 퀢    x  !x`> @:{ xP`B w=P   *` * * @ rg' 2 tm  "_ X`B Y=X `% w < x  ` ( hw  h i* j*  *`@ k, " $ Tf  @D`$, l m*` n* o*  @$0 p q* r* s *  @$4 t u* @48 v w* @4: x,< y,= c  (`5 a 2`( b*` d e* f*  g*`@( "    *  **  D@ " 4  < x@( T  @8 -!x`> >   >  @9H`B =H 2 "  2 @ -  @   @ h i*` j* k*  @$, l m* n* o *  @$0 p q* r* s *  @$4 t u* @48 v w* @4: x,< y,= c 2 (`" a 2`( b*` d e* f*  g*`@( " *` * *  @$D * *  *  @$H * *  *  @$L * @4P * @4R ,T ,U 2 @`" 2`@ *` * *  *`@@ " > 4 *` ‘*  Õ*!̔@ @ $ , 2r 퀧 " @qH 0 ,"`*@䢒 Ӕ PH /` * ! `&@>  P h  *` * * @ p' 2  X`B = X`r1, H 0ˀ ,*"`*@͖䢒  H /` * ! ` 䀥@N@>  P P    @  !x`> @8t!P`B 0=P   H I*` J* K* @ p_' 2 t@: Z X`B =X `% 7 <  ` ( T7  T @( 0  *  **  ,@ "     0 1*  2** 3 D@ " 4  < @( T  @@8 %!x`> !0@8H`B =H`" " " @n   @ ` (>@  *` * *  @$,  * *  *  @$0  * *  *  @$4  * @48  * @4: ,< !,= 2 0(`" 0 2`( *` * *  *`@( " 0 1*` 2* 3*  @$D 4 5* 6* 7 *  @$H 8 9* :* ; *  @$L < =* @4P > ?* @4R @,T A,U + 2 L@`" L ) 2`@ **` , -* .*  /*`@@ " L> 4 M*` N*  O*!̔@ @ $ P,`@ X`2" " @H 0N `,@T䢒  PH /` * ! `&@>  P   *` * * @ n' 2  X`B = X`pp, H 0 `,@䢒 Δ PH /`4"* !"  @J`K@>  P^  ` ` * ` *`@ ` *  '쀒@> 4!"%"> #%""%"x`> @6!p@E > !@B"\`n 2  X`B  < X 2` @ `" @H 0 " ` @䢒 V`@    0> ""t@<@!x`t> @6N!q > 4 *  *`@*  !Ȗ "" "t%"@%"!>  Ѐ Ȑ@1?!x N$ > @6'!J !x`D> @6!A ,`*@E䢒  P8`B 5:8H /` `H 0" H 0 * ! `@@ 0H 0 @Ð㿘@ h> 3 >' 0  a@*b a@" \a a@" \7  !@" \a@O ,0!@0 % " ? @6 \6 \ ((&H /f * '  l :@@ H 0 В @ b``0@4 b'bĔ '䀢   @!N ڰ  Ұ 2$b8 $b䀢 ǰ $bOЀ 'b $bH /f * ' @b$b$bH 0 ?*  2`4@ $@,2  H /f * '  l`l@ b g l@ g8`l@w`l@$b  ?*  2`4@ $b`-8b 2)bR`\ @2 '$bH 0T 1b@ϐ  "@$bH 0D 7  4b,$,b > 4b8 @)> 4!>  !Ȁ$b@ > #@`$ > @4"(> !̓*@ @Gbt @z  H 0  @H 0   > @"H㿘" " l*@Ւ &" &""*`" *  & l㿘 @}  `` `B Y<` >s ȓ, € ,b*` * " *  b b  $b*` b*`" *   @   2  @Ő` B'<`(  Ȑ"@&   & & &  ,, ,  , > #X    &> !@bD0> !@b,㿘>      ̰ D    8 @    @$$  H /f4* '  a  $H 0    @)K  $H 0}  ,/> 4 ` (,`&/> 4Ā "   @2H  2` *  *`@*  ` "ޢ`  `  Ȁ`&` `$ # #  @ ,Ȓ" ` ,``,2 2 2 ,`i,`j,`k,`h`02`2`2`,`l,`n,`o,`m`4222,`q,`p,`r,`s`8* 2 2 ,`u,`t`:*`2`2`,`v,`w`<,`x`=,`y`(    ,`a,```( ,`b`( 2`2`2`,`d,`e,`f,`g,`c`D2 2 2 ,`,`,`,``H2`2`2`,`,`,`,``L222,`,`,`,``P* 2 2 ,`,``R*`2`2`,`,``T,``U,``@    ,`,``@ ,``@ 2`2`2`,`,`,`,`,`> 4`̀@,`,`,` ,`̐"@2 2 2 ,`,`,`,`        { 2M  $H 0   "I `  `` *` * " *   Q`, Q  X *  X""  X$@& `2 2 2 , H, I, J, K```, P ` `+  `—* `Ñ*  3 3 3 , M, L, N, O  (`    ""  $ @*ߔ `2 2 2 , , , , @ Ā`  ` @H 0㿘>   S " 2   " $"  ` `@ " $"7  `""@$""  "" ` ,`" $"@   H I* J* K *  @2`2`2`.` .`.` .` `"@@F㿘>  < H /f4"* '"  @* L"  $"H 0 ` 6  "`"` "6 6 ***`* @0֔ @H p@㿘H o*@ g@ H 0㿘H o*@ g@ H 0㿘" > @͐>  Ѐ`$ " &"` >  "`"` D> 4"2`2`2`*****aȐ""@ 2`2`2`***@*㿘 H /f4"* '"  @" ""\ 2  8   "@   `  2"> #"@ "2  " &"&"@ }&"> #@` > @0ܐ"X"@  &"" @NH 0㿘" ` )&"> !̓*"t@ h@ H /f * '    > #@`> @0"x0@H 00!>  &" &"@?> #@ $ > @0"@ !"t㿘@ "," 2 D &"`&" @ " @W"&"&"@㿘@ "D" 2 D  &" &"@` @㿀> 3 "' 8" @b@6  `` ?`&`&`  @& ` ` `` &`2 `> Pp`B A:p<* @ *@@ $ , `@4 4   4 ,  , @4 $ "8 @2"`"6`"> $ "`P&" `"`B < `   @ h  ` x`B < x@Ȑ` > @x"؁ 㿐 *  **` @  >    > H /`4'* !'  * * *    ,@e@   !* (+ ) * *+   $+` %@  "( &* + ',  #*@    02 2 02  02`2`2` `  `. $-`, . #. (. ). *. +. %. &. '+. . !. "ad     -* ` *  .*  *`@ `` 2 `(  H 0 )>  !*  "* #*`@  ad ( )*` ** $  %+` &+  +* '@  *   @8`H 0 0 #@`> @/"> PX`B :X㿘>  ` ΰ `D b 8b @ b  @$b$bH /f4b* 'b   qb  $bH 0    "bZ [b  $bH 0 2  /- ) *  *`@*    2 0! ,@2 0 !@-^  2 0 - ,- 0  & `b 0b0$b 0# # @ , 2`2`2`,,!,, !,,`!d222,",#, ,! 2`2 2 2 2`2`,(,),*,$,%,&,',+ b bĀ`  - АH 0㿘`    *   >  P @   㿀> 3 0b'@    @O &  @] @g   > @ #(㿘  @  2"   " > `""`" " 㿘>  ? "$ "@"" @ز  2㿘>  "  @,` 2 2  > "  2  㿘  㿘> " > @"# !> > " "ȁ㿘$В @֛  d @~t &$> @ @- 0"L?>>>> !#\b%Ԇ  !& l6 \. h. j&"L&"P&!4&!0&$`&$d&!P&!` &!`> `x  `x >.$ b.$ .$ .$.$.$@А$@#@&@3ː D 3@J H /f * ' > ԖԀ`&$p$p"dt&$t"ԑH 0  㿘H /f * ' $p`"$t$t"dt$t?$p"$$p$$t@$H 0@3ѐ@$ "$@ڒ $ "$@Ԓ $ "$@Β $ "@Ȓ @Œ  > Ԁ " $|2 $p$2$p$x  2$| 㿐!>  Ԁ 1`/ ʔ  Ԁ $  $p $ 2$p 2$|> @,#H  >  0@,w#x  $x>  0@,n# 㿘> "D`> c@r #> Ӡ%> ӑH /f * '  `  ` $`""`?"H 0 `"!> @ 0ݑH /f * '  Ԁ`  ` $""`?"H 0 `@ 0݁㿈 > `  #8 @   ` "@    '> @+ 0 @$ 2 > @+   @@>  H@+ 0 ` *   *`  @ /> "@+ϐ x0#@ @~ `   @ f @  @ *  *`   @ \  "3 `Y0TJ> 20LDE0GF`@ 2 > !9  ܐ 21`00.`@ 2 > ! ! @ `@ 2 > !8 ' @!P> !h> !x /> a@* `$'> ,2 `@h  * ?2 c  ?!> @@*8!*`2 ` @*/0֑,2 `@ ` P ʔe €`0bu`0`2 d|>  Ԁ`> @*!0 > !@*`00 d "@  @  $d $d "d "@֒  @  $d$dd4d4d @W4d $d|$d@ " d`\ > "@*`0d> ʒ`*`_ @P0^`\d@84d`\ > "(@*`0 $d|@4YddX@0IH@$d`\ > "H@*`0$d|> x x,d ,d ,d ,d ,d d ,d@s $dd "d\@l $dd\$d$d4d$dğ@$d0`0> >  @*U >   @*M0> #8> "x@*F@{.㿘>  Ԁ`   > > > "b@(" 0@{㿘>  Ԁ`S    > > > "b@(|#@|ѐ `> @*#0=  @}  2 > @*#P02  `> @)#0(  %  *  3   * `D@ @ @|   & `B<`@-0@zx> 3$x `'2\@z=  A A"$|@z5 2  ??耢/" d" c$2 $2$2 \ 2@*}$`$> $|##\@) 0`? @6` $xB> !, ` > @ #㿘> 0!an @   a@a@0 !p@{1!o@Y@!N N "$@ i " $$x h  "l$$x l l?@8$ l$$x$  @>  $$@!  @^ @(p$$$ " @$  $$@!, @D f @(T$$$x``0@(K $.$` @(B"$. $` @(9"F . C $| &$&$&$&$& $5&$ -$| ( '@j$$$|$$$$> x x,$ ,$ ,$ ,$ ,$ ,$$x   l?@ e @0㿘 @xŒ  `  @y   2 @y2   $  $ $ $ 㿘$| ` > @& $  @X $ @P`@ǐ` 2 g 7 ,  , , , ` `:*@*$@*@  , ,$`  : ** $ * $l, , $  ,  ,  : ** $ * $M ,  , ,  ,$ ,$, $, $7, 㿘 \ >  @' 0$| L  "$00!> ʒ`*`! H /f* ' $  &$ \@ @H 00}*`" * <  $$ \?`&$>  0@' 0$@]H 00aH /f * ' $  0&$> x .$x .$ .$ .$ .$ &$|.$&$ " $ \ >  X@'} 0$> ʒ`*`. @$H 00#@ " $$ \?`&$> "@'] 0$> ʒ`*` @$H 00@5㿘$| * H /f * '  &$|&$  >  \ >  X 0@'&> !̓*$@̒@ H 0㿘H /f4$|* '$|    \ >  @& 0$x$@$&$|> x x.$ .$ .$ .$ .$ $ .$@ &$$ &$@ &$$\&$@6$H 0㿘>  0@&̐  $\&$|€> x x.$ .$ .$ .$ .$ &$|.$㿘$|   $  @ $ "$`@$ `@` 2k 7 ,  , , , 4`, ,  , ,$`  4, , $, , $  ,  ,$ 2 ,$ , $$$ $  ,  ,$ 2 ,$ , $w$$  ,  , ,  ,$ ,$, $, $`, 㿀> 3 '}  2`0 7 *  * 6`* * * *  ??"/ c2 /*****`? @3`!,    > @ 㿘$| 㿘$|  > a̔ $ 2@&$|@z㿘@-  G$| >@,ې0?@{    ?`$ $  @v        $ 2  `B >  * *$ 2`*$ * 4`* * D @ @, 2 㿘@   `a\"ad " " " " (" ," 0\" 4`" 8    "  "  " " " " (" ," 0" 4" 8 㿘   = 2; H /f       * '   2 0`" ` && "` ?& `" @u  4`& & H 0 㿘  5H /f       * '   2 0`" ` && "` ?& `" @u  ?& H 0 㿘>  В@$> @#2!㿘``< ( "?`  4;`  8+ @     d 4 2   (  @   B<    4  2 <   @(<  < <   4 `,   8`0& `,€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (㿘!> !( 2 @@:!( 2@> @$A!T     < 2& <K 1 @c 0@2 !(     @M <`   <  ?  ? @;< ?<   @n< < $ ( < & <@  1> ! 2 > Ӡ!  `>b@ @ &! 㿘 H /f4> L* '> L!,  ! "  !L `!0 " @  2!H 0`> Ӡ!  `>b@] @_ 0> "!㿘 < > &`&@!( 2`* @ *`@!&@ &` 㿘 ` ``  `  0 @0@Đ0@ !㿘@  (   "$ !d  H /f4!`* '!`  \!D!DH 0㿘N $ !> @D0"!( 2  @/!( 2 > @!!8   0  0 @z0@0@ 㿘N $ " @20   0  0 @w0@0@ 㿘 `` `   @w@@ 㿘 `` `   @@@ 㿘     @@@ `! `29 `    * : "`  `02   ` @ `*  `(( `0 0 ``` Y `    * :  @"`" `@08 ` 0?` 8 (  ::8 2` *`` *  (( 2  *(000****㿈> !$` > > !> А@m"(> b"a,!(`X-> @+@[̪ > > P! @+#4@+@N " : 4`, @,`b2*@ *@ b 2`* @ *`B2*@*<  ;@ @ dd+ 3`@+` b 2**@ b * 2`*` B 2* *@9%((!> @ $!,㿐@]: 0(@(b2*@ *@ b 2`* @ *`B*2*;@ C0((㿘 x @ʥ  $ 0 $ ("$ $ `2$ > !8$ 2$ > !0$ 2$ > !4$ `$ # $$ 2 @"@ 1!+ @4  $    <>    * $ > !`@!-$     *  * *`" $ $ *  @?$ $$ 8@*ߐ㿘@p 8@   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿐 0 # (@*& 0 <"@<* "@ *`"  @*  " * @ ?`$ `@Q 8< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @Z "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@qZ? H`B > H P @ ; B > P 㿘&@ $ @q@  $ "P  * : D 00;9 `5? ` (` (  ::8 2 *!  *  (( 2`2  @ @2`2`2`**** 㿘@`  ` "&@"`` ?&`" 2 "00   "0@)< 㿘> !<  2  *$ 2   @ a< $ $$ ?$a<@|* $    ?n: &  2`,$ `` 㿘 ? & > a<2 "a<@ 2@"@@ʑ  㿘`@ `1`  @,`0: .@``, 㿘@$  @""@`$̀@"&$$Ȁ@"&$ȁ `  `(   (  ( 㿘    @ " @  $@$̀"&$$Ȁ"&$Ȥ`  㿘` @ 㿘`&`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@`& H`& L`& P@`& T`$& X@ & \@ ``\Ғ `㿐@ "&     H /f * '  >>>D0!b$#\#`K H p@㿘@Đ 2a`    @Ԑ%%@J & aD$$$  㿘  2&  R$Ȁ`"$$̀`@ɂ  㿀 "  ܀ 7 ,`    a``,``2`a"{     `   @@@> ! `> !@<[  < @"4`" L @"G 2E ̀ <?  <  2  >#h `#\ #`#d  @ > #\ #p #` #d #h #l@Ւ2  ,` ""$  <  "$Ȱ 㿘  "#   "  @ $ @ * @ 2"@ $̀"$$$Ȁ"$$Ȱ 㾐6   U ܒ  ! ! !& 㿘`   $> `0@!@nt) 7`0. 2 `$Ȁ 2& `@nf 7`@ 2   `$  $ `C <`B> >  7㿘 $@  ` $ @& 㿘   `  $!0 @ @㿘  , @  @ , $  2& 㿘 p    @G آ`@   @? \$@$`L 沒$`P$`$`"$`@@i$`<@$`$` $`8$`"@d"` @"$`d & :  $`,$`,`2  $`($`(`(h$`$2  $`0$`0 '$`T    2l@2#而 @ @@`*"  d@y*  = @$`\"` H /f * ' . ` @ $`H H H H 2 H& H"@$`H`P `@'`<$`D'`@@`  ``` "`@ @S"H 0㿘  H /f * ' 沒@ǐ"& & 8& "`2  & ,& ,2  & ( & ( (& $2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@ @%@     $ @o $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @S`H /f * ' @T`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ `9 @@O @L 㿀h@! $4  l4  `&` &`&`&`&`&` &`@#* &`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \>#``d#d#h㐘#\#l#p Κ &`> @"0" 㿐`   @$`? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @/?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @ǐ & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ 㿐@#       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l m  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2> @"8 `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @ݐ & `&@͐& 㿐@"    K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@P 2> @>"P` , @@?"@ H "@  ؑ* "  *`"  * " "   @O & `&@?& 㿘 @&   g㿘  ؑ* @`  `` <B`C <`<` ,  ,   #< <  <     = 4;    "@2 А"@@А"@@ @ 6И"?@ . ?/!  @ @$& И"?@ &   ?/!  `& & Ж"?@& @   ?/!  @ @& & `sд"@? `x `t " 2  $``($`$`<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@T`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4&   * ' *`%   @ & &㿘 @ΐ ` @ * "㿘   `@@h: `2`  "$"`  ?$ "` *`@ ?$@ 㿘 И &  p  l |@ " ``2 А"@@А"@@ 4 7 " 0 0 h> ʖ"  pВ@ "?@  @ ?/! l @ @& l& p Д  ԑ* `@& 4& @ l   >b@@㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0㿘> @0"h㿘` 2 d ` \  `8 `"`&`"` & &  㿘`2`  "&"`  ?& "`@gm 㿘` 2@} \2  ""@"` ?"`" 㿐@ r "&     H /f * '  >>>Dܘ!`#\#`͒ H p@㿘@ F 2a`     @V!$@& aD$! $   㿘  "  & @~ @ @! @ ` `">   ` 2   @  ".  ܀`( @  2#  ܐ $#\#` ' ' ' ' ' ' ' ' '@o؀   㿘  "  @  ܀  @4   @  ܒ  !`@ I! !& 㿘 @ "  ` @    ` 㿘` @ 㿘  "   `@@ 2    2& 㿘\ ?[`  @!  @ @& `&! 2  "   "`  " k& ` ` 88 8   4" $l 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @    @ `*"  d@*  b &   "` `!@  `  @ 0 @u&      @      @     @א 0 @T&  !(   @̚ "   " @ 0 @:&  !h   @ &&  $& & H /f * '  $? $*@  "   2 $?* 2" @2 H 0 !2$ 2  $`2`' ` 2`"`H 0 0- " @ "    `2   " @  " @  " @    "@ @  㿘 "z   t H /f * '   `" @ " @2`  " "` 2`  `  # ?* @ "@  !"!H 0@e! "    `2   `""` ` ""`  " @  " @  " @  @ @   2    " 㿘`   $> `0@b"0`0@ "`   " `` 2$ $@d;$ 7`@  !!`C <`B @I" "`?$`К` C :`B<<А@Ж"0@B<0`  @   `@0@0@㿘  2  $   & @ct?  $  `"`&`"` & &  㿘 ` 2@o 2  ""@"` ?"`"  㿘  `4 `B >!`! ; @ B >!@c&  ?" `?" `2`  """` ?""`2!ؐ  @+ @㿘 @ @n! &!㿘 @㿘[   @ 0 >   >  > >!  >!  >! >! >! @8 4 $ 8 4  >!>! 4 @ 0 0>`@ C > @  @ > 8@㿘 4 @ 0 0>`@ C > @  @ > 8@֐㿘 0@ >`C  @ > 8㿘      ` !```?&!`"{ X ! `"   p t@ H p@B* 2` 2 !!@2 > H H8 > H!( L@ > H!(  !(@B:2 > H:` : p  H > B   (@j!(2 !!,2 !!( @ b >!(> !    &!> xa&!a &!@> P !h   (@: (@T ,> X> ` X h@8  X2 h \ l@( h X P2  T"  @> P   b`㿘    `?  ( >` B > (!   ?`?&! " ,  H 8  H  L  H:@@j b !(@ (  x@ b @ B  > Hp H@8  t L@   Hp x@ b B> xp> H@ !!h ,@ ( `> Ӗ B!,> X Xf8  X2 X \(  X X f `@ B B > `> X X h@8  X2 h \ l@( h X P2  T"  @ > P   2t (!  : h??PT  8P2Ḁ (PḀ2P: h㿘  @d "" 㿘@/ a  ""@ @ 2" DD8a "a "a  a  a   @  2! DD( !!""! "!Ā 2 @a`a a aĆ?a""a"aĔ`]@`@ @UD`DP  @ 8 a2 DD8a # Đ? "" "   ) `&  ?`@ 2a`DD(a "  ""a""a "aĀ`2`@    @ ` D `"`8 88 2!`< <(!! 㿘  @ "" 㿘@J   "H H 2 LL8"!"!     H  2! LL( !!""! "! 2 Ha"`a a" a?a""a"a`]H`HX 2`LLP! H 8a2 LL8a?"a ""!"! + `(  ?`H 2a`LL(a"!   ""a""a "a`2`H!   P 8 !  T ! 2 P 㿘> !( 2`* @ *`@* 2`  㿘. 6` .`@b2`* @ *`B2*> a( * @  㿘  (0 (2`*  > ( 2  @̔ >@2(?? 3`+ @+` 2*@ * @췖 >` (  @Ꟑ  @쪖# , 4`@@4   >`@ꏖ ? c @ꅒ @ * 2` @ 2 E>`   + 3` +`* 2` (2    @{ >`   (?? 3`+ @+` 2*@ * @f >`(:: @: `: `: `: (` : 0`(: 8㿘 2 (q(  B : 2(@ 6@(,@@ @ YB c   ?,4 ??4 @4 @  @ * 2`  2 @ D@0B@c@b8   ?,4 ??4 @4   @ٖ  @Ғ * 2`  2 @ D @ B @ F 㿘 2Z  @8T    B & @@ !@c, 4`@ 4   @霖 ? c @钒 @ * 2`@ 2  @ E @ &B @c@d, 4` 0@4 @z ? c @p @ * 2`@ 2 @  (E  @ B @F㿘@` @``$@p 2> @k> h> _@]` F  r  `@ G 8@2>@  @>> `> `B> (d4, @,`   @"b     B 2 ,( , @ @b D,4@4  @ ? c @ * 2` @ 2 D> (>> > 㿘@&`& ` "& & `& ` & & & ` "& & `& ` & & & ` "& & `& $` & (& $& (`(> 0`0> 8`8> @`@> H`H> P`P> X`> `a& a& a& `> h`> p`X> x`h> `p> ``> `x_> > (> & ` & ` & a> a> a> a> a& `` & `` ` ђ `  `?(    (   ?( 㿐@Ґ "&     H /f * '  >>>Dܘ#b#\#`- H p@㿘@ 2!`    @ T & !D?" " "   㿘  "  & @^@r  㿘  "!  8  ܀*   @2  @s 2   ܐ   @q 2 㿘  "  @] ܀  @㾸峒  @J ܒ   @!~  & 㿘   , @ " @  ,  㿘` @ 㿘  4  , @"   `" @   ,    2& 㿘.`` # H /f * '   `@H 0  `.`  .` @ߐ @  @ڔ & .`` "@$`" 2  "` "  "`& & ` @4$` &W&   `4"` $l 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @y    @  `*"  d@*  Ő &   "` 㿘H /f * '   `" @   * "  @ *` * @"# ?# H 0    `  @ @  㿘`  ` `$> `0@ "@Zɐ& 7`0@ 2 `  2& @Z 7`@U 2 0`   $` 8`C < B> 8> 0 7㿘` ` 7 @|3 / * "&  ` `@L `?$` ` 2   $  `B <   ( @ ; B < (ד* 㿘  2    t & @ZO?    `"`&`"` & &  㿘 ` 2@J 2  ""@"` ?"`"  㿘  `$ `B > 0` 8 @ ; B > 8@Z  `2`  """` ?""`2 0㿘@&` & ` & `& ` > `(> `0> `8> (` & 0` ``ג 8`2  &  ( " ( 㿐` @.`? ?*@   .   ` 2 㿐`   + >@㿘> aD ">  "aDa@> !#Ȁ>  "a@@p" > D"  D㿘@8 > @_#0 > > @V#0 aH""" """"aH㿘> Ӣ!H@ @֒ "  2  $@ > @3#00Ő㿘> !H " @ "  2  2 㿘@㿘> aL  > !H  #$t@    F $   b`   $L㿘> aL  > !H "$aL@   H   $aL㿘P    & & & && & $t , 0> @# 㿘    G㿘!> !H > > @#@0!@#X!H > #x%>#> @C "> > ## @  @8@c  㿘@+6㿘" @!㿘  > ܀@"  ܀`   > ܝ㿘@  @ @ "  JK2 ` 2"  `@2@㿘  !> @##@ <   2> 3 '@ [  > !#'l'p'tv/x    @n  > X#`t#> %%> !> ct  t EC#Ȁ`@ ( f`t `Ft@ @  > '#> %cx@ x0@  /x@p p> !> !"c" > !#Ԧ 'p@ @l t> #@@ 2 @  ?'lt `t@t "& pxlt a> !P`> !#> !#> ! "cN@  > !#> !"c  > @#㿘N> f`?@Ȕ8㿘N> f`?@'8㿘>@M"8㿘N> f`?@*8㿘N> K fbb`?   #>@b8㿘N> f`?@( 8㿘N> f`?@(78㿘N> f`?@8㿘> G!p`> > @ 0@ 㿘@y㿘>@z8㿘`> 0 >@a8㿘>@B"8> Ӂ 0㿘> #$㿈> !c> !c'> !> !> !"c##"})#c> !c؀ )> '> %> #> !> @  "$@!$@@a#$> !#؀`> !"#܁㿘 > @"@> !}cܝ(> 3 '@w > )"@ *@k   > @a  `@ ` @@ > #" > "8@^@&` В,``` "@#\#`#d#hĀ   @ c > @7  > @"P㿘@M㿘@M!㿘@M!㿘@M 㿘@M 㿘@M 㿘> G ' a@! 4   @ `  @:`L "@ ` @  @  㿘>@|h"8㿘`> "p> b@      ` "`> t" > o"`2 ` * @ *  `0@9@   2 `",`0 @ * @*`   @  > "@ 2  @ > "@ 2`0  @@ `0̰ ( `> `> " @@`@*@@ ,?&`> # @W  > "> #8@N 㿘   2 *  *   0@ )>   2  * @*` `"@L 2 0 `@ ( 㿘    @ ?  *   9 "2  @ -"@ '  02  0  2  "  02   0"   * 2""㿘 r 2@&@&`&  㿘 [  1/ '> #8*  ``" *`  +*8` `  / *8*8*8 &*8*88@  @ *œPô¨´Ĝ,`ƨdƌp,㿘J@ !> Ԑ!(@^ x" !(@p> 3 '𴆿 `L  `Ĥ@  > @ `8> @#`> !"c̒`1> *` €      > #h@ܒ! Д    @> #x@ǒ|   > #@o Д    @Ґ> #x@Z  > #@Mݔ  > #@@Д  > #@~3 Ô  ^ > @p#%> @k#   ^8> > @`#@\#   0   @zl@a "L@_L`@66`> !"c> @#pN> 3 `'> *! !?* : `G*`>!H €>8@ } <>  Ж   > #Ȕ@ .>  Ж   @%> @# > > #> #ؔ@ > > #@ >   ^8> > @ސ#> @ڐ#> @א#  > @#㿘> @ /8> @Đ#`@y    (+  2 2 " 2+J " ?㿈@ # @ !> %> = > `@# >  `@# >   #@` >  @@` >  (@X >  @@Q ?'@  @F쀢  >  P@U@0@?'@㿘!> !   ?> !"#̐ 2$#Ё㿘@u  > %#@k < > 3 ` > &  > !# > ! # > !# > !#Ȱ $ @ Ȑ@ @ > X x@; >  xP @. 㿘@,   2> < x  $ 2> - x  $ @㿐Ӑ / 0=  >  x   >   @l'@K '@^?wT'@? π ̀ @ $@㿐 % @? !>   Ð x  " @'? @ $@㿐Ґ , @?  #> !> Đ `x   * 2 @k'? @a $㿘̐``є````Ө`t`H<`````````````````````````````````````````````````````````````````````````````````````````````````````````ĝ㿘 N@,  %c "@$c> %c c*`: @,v.@#`"@*@ې c #֒"@ #"$#㿘!> %%> % ##> %Ӑ"# cΐ"c$$#㿘`~>!*` €1> %> %##@ ( @,< #?> %> %#c:ܰ @,/J# &#> %> %# ͪ @,  #c? &#ð > %> %#  #@, J@##  &# > %> %#  J   o c@ J  0> %> %c \  > %> %c 0> %#> %c|" I y k 0u> %#1> %#` m J *#@+*@+ #@+J#@+J^ > > !#@  "#> a $!> !'> Ԑᰔ@%> %+> %)> %1> !a  ? $!$!!J`a*!ᰀ@a#ߒ` @$!$!c$v%##ߒ` @$!`$!c!%#J`e `c*@ᨒ`#cJ  S#> > !!@  J@ > !> !cߔ  `ᬐ  "#!! "!J !ᰀ> > !#ߔ@  $! $!+> %!ᰀ)> %c%> %%#J`  c*@ᨒ`#cJ  #$c#d"@ >  ^ 1> %> %##@( U"@> %# ["  > > ! +> % )> %4'> c#@  K`"KK@@2K> !> !c#   " `@" KK"KK@" K c#@ #ᰒ`$!+@%#Y c# ᰖ #> !#> Ԅ! *ᨐ  #!$!* $ᰰ #$!* 0%#> %> %# @*| % ^ > %ㄔ   *ㄔ 8 *#`$@*a%##"@# ƒ"  㿘@> %> %> %> %  "#"c""@*8 @ #*#c"@ߴߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠߠP@ Hߠߠ(08ߠߠߠߠߠߠߠߠߠߠߠߠXx㿘!> &  x   > %> &" " > &> %> & "#> > % > &@?J@`"> ԁ > ԁ 㿘> a "a@ 㿘> > "!"a㿘0? ?߀ ] ?Ѐ ` 0 > ! O o T  t X   x>  !> &"  s5$ /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ??Ѐ  ? ?  _>  x ?  ?  _ \C > % \ #S ?2,> } ,> &  %> #> B? ?  ?Ѐ  _ \ :2, \2 ,, ?2,W, P`0,H `??*`>! €> <   .4 0 . , * ( & $ "       <   >  > @!?㿘> > Ȧ a@ > !̒@d@r[ @@$@( @( `@> $ȁ㿘> Ja a#>  %> L@(w L @(d c"$a q a ?a?$a$a $aL   L@(V L  㿘> !Ѐ` > !Ē ??߀ ] !> @(6> !> Ԓ`"!@ a@(' > a$!Ȑ "a$aa'$! @( > > Ԑ > """a !> #> !a@͐q! $a > a "a@' > ԁ㿘> !> "@ > @ܐ!H㿘> !؀   > !P> !X >  !`> !h> !p> !x 6" @㿘!> #@  > @!0> $#@@!> > !@r"> @!$#@`> 3`>  >   '@ :A> Ĥ'> @a̖ @   @s̔@ @ Ā> #< > ̀> > !@[ Ȁ    z > @N!> @K""` @ ǒ> Ēaw`` > @"㿘H@;  " @ ? "  " &@8  > & `& & > &&@   &"$ > &`? "`> & `> @"3> @"     " 8  㿘> &       % > &` #` `   $ @> &ऀ  ँ   Jp"  > &> &> &> &> &> &> ! " #`""ଁ# 㿘N> &p`? 3> &5> &7> &9> &> ! #&` &&' 㿘N p`?3> & ;> &> &5> &7> &9> &> !&` '`&&' Jc> &   > &> &> &> !  " "`"㿘> !> Ĥb> "H> "P@i0`)> &@> > #,`#,$@% @    2> % @K"㿘> Ԗ!ܚ @   ``+``2`` > ܑ+`` #`"`""@ "@?㿘> Ԣ!ܠ  , @ " @% 2  > "@0 > Ԑ!ܓ,  "  "  # " 㿐@7 > #H@* *`` :*  **`'􀢠#H㿘@ 2N    @`?㿘@ 'D @D  㿘N  %> Ԫ!L : , ` ,`@`"`@ 2`` :`,> #L 〢 :@6 > Ԑ!ܓ,`@%> &  @W `$`@  㿘@L`@SL  2L@Д 2L` F> > # @H0#(@D㿐N  %> Ԫ!L@ :`,@  , @`" @K 2   : ,@> #L@ 〢 :'', > Ԥ!ܠ$ @)> '>`" `@#0@3`? 㿐> #4 `  @; > ԰!ܦ    @Ð  ` `  㿐> &?> Ԧ !ܰ '"`   @@:` % `` &㿐 !> &&@ @  &@&8> #8> 3` ' 8ה-> #<@ ) @ &> #Hƀ   @   > ƀ#P``@  > #Xƀ` @  { > ƀ#H` > @#h㿘> &`@L㿘> &`@U㿘> &    㿘> &  €㿘> &    㿘> &   㿘> & ` `@㿘> &    㿘> & 㿐 ' > Đ '> Ġ! A> & ` > @#x> &> &> @# "> > @#!@#Ȑ! 1> ! &#> !Ā` > >#Ԗؘ"8 @n > G!p` "> > @{#> @x#> @u 8! 㿘 *> > > #c@  #> %@~c  *> > "`耤 #> %@lc &   *>   㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ 㿐I > _  > X ; 3א > J - > C ͒2  @ "@ 㿘> c ">  "cc> '">  "c@  > "  㔝㿘 > > @!0,# @9 "   2  >  2  > @!(0 @!0 @$ $$ $ > $"#㿘> # #  "  8   @ $@0   2> @_!@㿘!> # > > @T!P0@Q!h# > !%> #>  a  @>#  㿘ߐ㿐  Аq㿘㿘> c  > # > # #>   8  cԟ @  2 $㌁> ԁ 㿘> # $ > #큒 "   @: 8 8    @* 2` > "# h> 3N ` 'h"  l b>  !> !   ?+> !*)> !>8 !> !    @!> !Ȗ    @̐ e Ք 2&> Ԑ!А&%#%c > @!(X@px㿐`p ?`j> *` €> Ԑ[!> ԐU!> ԐO!> ԐI!> =!D`> ې "<1> "<'@ 29 "6 82 &"</ > =!D` > ې"@@}"1> "@'@ 2 " (&"@   > Ԑ#@z -㿘> !Ā`@Ep0j@@#@#`㿘> J!`!> "0 А  *`: ?Ѐ4 L@: @ Ġ L 2 ` * : ? 8*`N *`:  -@  L  > @"@ a?N`_2 @   z$?> @"H`> 3N s'2 NЀ /> Զ /> ԰ܢ  `V  ???'Ġ  #> Ԕܠ , `2  "8 v* aܢ)>'Ȓ"Ȑ' e'Ȑ"vÙ J@ :`$J@   ?  $J 2  `e> 'b "bВN@  ?`#J  L@   @ * :  "`J@ 2 @ +* Đ" 'Đ _* Ā z`'> '!> '%> L@   + `  *`: ?+J 2 " $"P"@â M`` > @m"h  @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*@*`*`*`@ * @*@*`*`*`㿘Ĕ㿘  @* ` * `  `(`  @(`  `(`  @(`  @* ` * `  @* ` * `  `* @ * `  `* @ * `㿘+,,$,$,$,$,$, ,,$,$,$,$,$,$,$,$AAAAAAAAAAAAAAAAA`?> 3>  `"'@ ?>  ;>   7>  3>   />  $ 2 ( ` '>  ( 2 , d >  , >  0 >  8 >  @ >  D  >  H >  \ `> @[#&`4 &`8&`4&`0&`\ @"@ > &`4@J#`h  @@  @5> &`4@9#@ h  ` h a > TT&`&`&` &a&a&aT&a &a&a &a&a&a .`.`@6 @3 @@@ڐ?&a'''&a4&a<.a@&aD&a8&ax&a.a&a&a|'A ;ܰ' H€ 3> Ԑa8c@U> Րa|`@M> Րa`<@E> Ԑ##\> > "cpa4@> Ԑ#> > #\"cxax@ ' H€  > @D#``""!ā 㿘 &!@ d@ `H /l * - !? &!> !> *`" *!@ô  > #@r H 0@a @^ h> ! @ 6 > "L>Œb  "L `@ 0 2` @F   @A   @<   @6  `> 3 '' @<  ' 4 H€ 0 İ?` > @ͺ#㿘\@ @ ~ ?  &@@ 6 ( @**@``$, @@ 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@ 2(`@ * %`*`$ k``4*" &``  &`(`@ *@`2(㿘@ ,`@ @팒 2 @`@텒 2  @ ''@` 㿈  >''H'@А > @T#Ȱ 㿘` ">   ">  > "> >  "##@쪐#> @2  㿘 0 4" T &@ L` @ &`   @D &` `   㿘 4 P  0` 0` @ 㿘> Ր` ?  2` `* @ "0 !Ā " 4*  2!%  ` `$!`  ``2  @’@ђ!? $!@*!㿘     0    0 @@ 㿘> Ր  ?   2` * @ 2!(  "!#  ` `$!`  ``   !@' !? $!@Ґ!㿘> Ր  ?   2` * @ 2!(  "!#  ` `$!`  ``   !@ߔ !? $!@Ø!㿘> Ր ?  2` * @ 2!*  "!%  ` `$!`  ``2  @˔@1!? $!@Z!㿘> Ր  ?    2` * @ "% !Ā "!  ` `$!`  ``@ !? $!@%!㿘> Ր ?  2`  * @ "%?!Ā "!? ` `$!` ?`` @1 ?!? $!@!㿘 `$ @2 @+  ? & & c&  . ;@& & & & (& ,& 0& 4. 9. :㿘 4ؐ h  =   t x 0" Đ &  "  = "     0"  㿘   @"*  :  "?b͐ &  bɐ&  x&  t"@&   `<  `4€`0 {&`X&``&`d&`.`.`&a$&a,&a0 `<  .`< `<  .`<2-a`4 h  ``4`ha  a> TT&a &a&a &a&a&a T&`&`&` &a&a&aa > ` p> @뫐 %   @ꉐa 'a'a'a'`'`'pa'|`'t'x//.`.`&`l&`@  2`4  `4 @`0&a0.`<.`=㿘H /l4 4* - 4 4  !0 " 0 =  0€ H 0㿘H /l * -   4&!(`4 0€ H 0㿘L〢 Ā 4  2BL9 @͐$@"@ " @ސ @]0@R@@: H /l * - $$@ H 0 >L9 > @ @,90 H /l40* -0! > ʨd+> !̔`h*`" * > " $d! @İ`$d 0 > ʑH 0㿘> հ  . @ 4H /l * - ` " !0  40,@". 0@ 0.  `&  "`N 2 4A 2  4``" 4@ 0 4 ,@ 0. `@ 02 <`  < = `. <. = 2 <`2 &!0 < = `. <. =&!0& XH 0 㿘>   . @`hM ;   a0  `= |` H /l * - `a("@ %> ?p``> " $`` ! @O aİ`$``  3`a("@ 怎H 0a @ɹ`@ `a @ɯ@fa(@$a(`  0H 0 #H 00H 00H 0 #H 00`  H /l * -   *!> `  L` @ ɀΔ x``> " $`` ! @Ȗ aİ`$``    ۪  - 9H 0  ""@@& a @)`@ `a`0a @@  %@ H /l * - % % - 9H 0`  㿘H /l4 * -   `  `@ & ` 4 0@ 0.   d  d@| & d 4 ,@ 0. H 0㿘` 4  !  h _ 2 _2`@:`$`@Ȥ_`  0 $ 㿘`2  䀢  > Ԁ  ! > #_~@-#Ò㿐 2 &///@Y/ & @n `>#T*` €   U * /  @  `.@ > 3 p'!    `  ` @8 8@&@`   ` > @ 㿘>   . @L;  ` $  $$0  =` `&`@ B >``2;`, "7`^ @: `@ B >`@ې`"@&`,"$,``2` H 0ذ #H 00> @ ,9ɰ  ư H /l * - $ !> Ԕ d> " $d ! @ İ`$d  $  ,9H 0$ "@  " @u@q@&`* @` $@0^N : H /l * - $$L:`$ @7% @2%  @% "@ ,:,9  L8 @p`H 0 "` " @ 0`|`  >>   . @!`4@ٰ ,!@ "`!@ "[ `!@ 0B@"a> @ "`8!"!@"a03 @" @+  b}@".!$@ "!#@ 0 !@"!@ 00!@"b~@ 0!@0"!@ 0 "$`X`X "$`X  `H /l * - Z " `=H 00,`  ,` `   @  `=   ` @xH 00a, ]3a aa, ]-a`]*@ؐ&H /l * - `&```l@Đ" &`t``|$`" &H 00H /l * - ```"@ ` : `&```@ƚ" &`$`&H 00X@`U&=@gMސ H `D@`0@ 8 `<& €`053& \@`0  < `0€ #!$a0p  @͐ `=`'@L2 0 \@`0 &  @㿘` L @` ` d@ @-&@@ X " @  @y 㿘> հ  . @ H /l * - `A!0 2  = "  !(@`0 @` `!0  =`2`2 !, 2    Đ    @9 L`@4 @H 0㿘>   . @ 4\@ 0 "9?X "5? @  /?L ; 2$ 0 , ;   y H /l4 * -  N @4H 0 0X @㿐 4`d ! #\`d> 0# t x l `(> 0 t@ l 2 .  㿐N 〢 2  4  @6 4  ``  #\``> 0#    `$> 0 @ 2 .  㿘 <  4` @4`` $`` $``(L`;`$`(`` >`$` 0@0`"$`L`9 "` ,`:` @4$%L`8 "`0`4$`4$`0!,@&!, 쀢 '   `` "    @ (/`"@ * & ! 2!`  `!& 耢 & !@`  ! 0``  ` :` `$``$@ D$` 쀢 &  @ ` #@@  @  (/``@" * & ! 2!`  O``!& 耢 & !@`  ?! 0```  3`` 2 =`$> 0`〟@ " = = "!0L`8 2 !0` ` 4!0 !0  `  㿘 < h X 4 @3    $  $  (L ; `$ (`d B>ϔ `( @ 009 L 8 ` $  4   @ @ $ 4 $&`dL 9 2`d 0   @ @ $ 0 $  $  " $ `d  `(>  0@ 9 ``   "`2 ``-  "`` 2` "`` 2` "``>„(`` "`  `   㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 H> 3 '.`"  4' H€ 0 26 4  '' D€ 0  .  > @{ ЁH> 3 '` 4' H€ 0 "`6 4  '' D 0€ ` 4@ ' @€ 0 `@̐` > @@ x> 3 ' &     Y: &  :  @"Y1 & : @2` `2'g B[ ,'`4 '`D`0€ R` H`$`4  @2  ?'ؒ ΀ 03 / `4 '`D`0€ (`  `$`4 "`? 'ؐ "` "`  @,  > @ 㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && h> 3@  ''Ѐ'`z ''͖ؐؔr` /' 4 '`D 0€ b`  \'ܖ`$`4  @2` ?'ؒЀ HР A 4 '`D 0€ 5`  '܀@ ''" , `$  `4 'ؐvȀ `Ȗ  ''` , ` @'@'Ѐ  &.*`&@*. @& @"@. > @ې!x> 3 '2@I F ` 'ؐ> 'ܰ  `$`0 2`@ 4'@ 0"` '܀`' `$ @@`'" 4 2 4  @€ 0 `@ ` > @!x> 3@ `' ` 'ؒ  4' D؟€ 0 "` "  ```"@` ` ``@`  > @<! @> 3 4 ``8' Ͱ     '  '!'!'!'! '!'!'!'!'! @'' ? ' `8?"` ' ` ?" 'Ī` ?"`'`?"'Ȫ`?"`'`?"'̪`?'`ِ 2y`ѐ 2q     '' `    ''Ԣ``? 2`ߐ`   . = . = =` !0  `. ="]`t\@ 0 2 =` `?''' '2  =?'''' =  0@ 2` `''' ' ''''&! &!&!&!&!&! & & & &!&!&!`t   l$?"$$`$?2$`t&`$$? . Y `$? . O `!`$? 2> #V( #V#2`V$@ `_ `"!$`$? 2> #V #V2`U`$@ 䀢 2$> $?  . `$?  . `? 2``!x 4 ? 2ݒ!4 % `?!x+`g 2??"`3 !4R 2*`3 !x`3A 2 3 "` !4 3, 2`!x 2`p?"`!  4`s '''/@؟€ 0 2`?" =  B = "` @ 0 2̰ "K`xH /l * - ' 1  l" =F =    N  q  =     N ;H 0 2`x?  8 (  T & `|   ?8 Tݐ & `x?2 `|?" `0   Ȑ" 4& `0 ` "( 0. `0 2# 0 2 0 = " 0H /l * -  H 0 " 0+ ` "' . 0 2"  2  = " H /l * - H 0  ` > @[!0x> 3  4`8' 2  !4&@! &`8!&`!$ &`!$ &` !$ !x$&`!D`k$!&``H``3! 4  '''D؟€ 0 2&`p&`p&`p`f!@' &`! @# $  А" &`(  "@$(!$&`,$, .`0 ,0 ؀@ .`1 @ ,1,2.`2 <2  .`6 < `,6 .`7 ,7!@ &` ! @ h$ ! @ l$$ @!  &`$ @ &`x @ &`|&`|&`x`$ &`t =&`  > @!@ 㿘2! !  h @ǒ&`  @Ò&@ `" &`@ $&` @ &`&`  㿘 \  \2  &@ 0 2㿘 \   @ɒ  2 㿘>   . @֒ 㿘>   . @0!@ + 4 ! !@ "}@  0:@"0!@ 02    @͔  \" "$ \# `8&@`H`D€ 02`@ € 0  `` @ 0 > * R`   > Մ"`8P> Մ"`8D"` Ր > 3 `' `"? a|? 9 2'ax / `? / $ "`4 H€`0 2ax  " '   > @!P㿐 4. > @!h"  @* !> '. $#@*` @ #!> ' $#Ā` > @W!# "#@V #Ā #@P 0 %> ''>  #ᰐ@ސ Ԡ?`> " > a#\   @Ҏ @ @)$> 'c*> 3" * '$ > $'H$@C   > @ ! ̒ * * @4 $ '|  v   @$@"H$  M   @   O{$`@)  $`h @[   2| (@*'|  @  B @ @  OȀ : @ @ dx`  2$@($$ $`H̀ @ @5 Ȁ` | &!: @&  &Ȁ`"̀ " @l @i P $%  ""̑*` * :$̦* @*` *$  2 % $ P$@1$Đ"%Ȁ` % @2 @/ > 3@* @'  (%  @@%   $> 3  > @!㿘 ̒  ,@4  Ȁ #&  ̢  @        @  <$ $ <   "@``@  ̨E @ h$        ̒ * @ $  ̑*`  *  @ " @:  *ؒ Ȗ: @א<<  Т *`  *   @ " *` *  *  *   ,`: " ` Ж*`  * *$ P8$@ Ȑ@E  㿘? 2  >  2 D *" > 'c*  @  8    ` * p `@ ` "  @6 ,` ` " l" h l$ l$ h l h $ p@ ԁ㿘?2  >  2 *) " > 'c*  @  " "  h  l l **@$ l **@$ h l  h @ @J$ p㿘 D? 2`  2 > '* "@*` `2  < 0  <(& 4& @& 00!  `@5  <& @H /d * % @H 00H /d * % @TH 0㿐@[`D *   @`` `p B ̢@ D *  @ `< 0`H-#\@,`0`|`t "`t@c Ā`<  0@   |t`"t@S<  @ <D% ժ@@U 㿈 Ȕ  'T  *?      > '>2`@8@ `,`* @ C @ C 4@ 2`@(`@ oe : @}? Ȑ@5    > ' >"?4 ?2  8?     ` %@  =  B?@ * @ @:  誂@ B  @ -`0* @ `<2  : @  " ? ? @9?,`*  "' * &!@?\#$`0 @p$0$x`,@ $,E "D`> a@ `0("`<`<&`@`<`@`0" @ @S_㿘 > "D` > b@ѐ  0(""  * @ଓ*`  " `>  " 0($ 0 4`" > $ 4" >  4"( @   & ਒    " ਀ "  #> '` <@\cc@Y @("> @j"H $ @㿘?2  > Ֆ`2 > '*" * @` >>c"ܘ#p @ 㿘?2  > Ֆ`2 > '*" * @` >>c"ܘ#p @  x? 2  > ը`5   > '- "* 0b- @ '`  e  e`g@`f@  m@  "@  0"@ @   h@"F`e r@ ,` e@5 0}  m@o 0w e g@  f@4 "@ 0j0"@f ` b #@[  W`Ԑ@Ғ  Q ' `''  @T*   @N* Iz* J$  @q " 9 ,    @ & +`@  ''' "  ,    @q & > '"@* @@x @Β @˒ @ 0> '- #Ē@*` JX &``&$`@.`@` @ΰ `Ԑ@H  Ǫ  `p*@  `h " ``l "`@  @%> '-     ``@` @ `̀@* ``  `.`@``@p `.`  2``@f `@c `ġ,  ?@$``@Y Ē @UĐ@I @H/ /@@ H 0Z @Ւ  T@ޖ @L `IW!F &`*`` =&`Ԑ@  7`$``@  2`@2`? 2  @?`5# @ `* * >`@Ԓbܰ` @H$` "  0  ` $` ?$` 㿘?2  >  2 6?*> '" c*  ` > 0  N " ?? *` ࠀ?? @ B > 0   ??  @'''''ܐ @}W < D  @``@~ , ``H@Ȗ   @ ``@~ 0H @ &   @``@}  㿘`@!`   6p&<`&( &, &0 J&4&8 > 6Hb`@ӳ  6> bh @Ӭ aW &&6r6J&X@|`? 2`  ?6   . 6 *>ڐ `b@㿘> ! 2 ! ? > '> @n"xcȀ cȒ @aN4  * > bL*@ 㿐> !`!> '#Ȁ `@b$#Ȑ @d  6 @d 6  `*`>  "L*  㿘>  ` > ! >  * bL* `@  㿘>  ">  l! 2  3  `*`>  "L*    㿘  b@1>    @  2&   ">  l! 2  0 `*`>  "L*  @㿘>  ` > > !`! !@X㿘>  ">  l!   2 `> *` L*  (@  ,  € 㿘> !` ``@㿘!> !   € !  €㿘> ! !>  ?$   €   $ 㿘> !    pH\4H ,,,,,,,,,,,,,,,,,,,,,,,,,,44$㿘  @  *@E `䠄? I  ` ? 2: 2  3  *   * `* > @  蠄?,  I  @ 렄? `*   $  `@>  `*@&㿘  D ` `䠄? Ig  ` ? 29& 2  2  .   `* > @  蠄?,  I=  @ 렄? `*   $& `@> հ&㿘'>!<! $@$8 8 $,` `  "? `,`   6 6&%&!*  *@ * *@  *@ `@㿘  *@H!  * a*@ "* @H㿘!    `@@ !  @` ! @B㿘 `"!@!  &!% 2     ``*H% &%@: `@㿘H /d4* %  > @H"0  `0>    @?# `& ! 2  !$ * *`@" ! @H 0㿘  0 ` `d> @ψ#(H /d * % `!  >   #P@ }!  > @h#x !    ``8`8, $ `4`#   ?# #   #  $# # # ! $!2$$! @ !  > @0#H 0㿘! 2! > @ #Ѐ 2 > @#  ܟ@ "!> @   ,  $,, 23! `"  $` `>    # !$,   > @u ($,$ &!&!  $ *`*  '"  $,>    @_ P $,! 2&! > @ː p $ *`* @" @ $!&!`@ $&!㿘  ` @! "! > @Χ "$> @Ρ &$$ *" * !$ !$@ " ?- ,@ a 8`8!$  2@    `@0&!@s! -   z>  @ !%` &!p&%, $"&!    &! `&!&%&%&%&%``0  >  @Ȓ $, &%&!&!&%&%&%   $! &!<&% 9b !3&%@2 !> !@ϟ &!! "  ؀"  !!@& € "   `" @   > !F6@;# @$ @N! "B! 㿐! " > @ݐ!@ >  而 @`> F  ̀ @2F   2 > !     *@" > ! @3 00   *@ )> Fe  "  `> !Д@  * *@  @  䠄? FG  ` Ք? > !@ U! 2  >  " * @ /> "( @ >! *, $0> !&!  &! &!!&!@&%&%&%&% *   $*@   `" @  |0*!`@ί 0#"P@Ψ !   &!*@Eݐ   c &%&%@  *@ *  @*! ?&!㿘a  `*`*@`*H /f * ' ` *@` *` $`E `? @ @ E ` @ 2 ` *@E ` ` "`*`*@H 0ӐT *`*@H 0` `* *`*@Eh ` * Eb` @'a?EY ` `@?  `*@EL ` `@2`` *@` *` *@`*`` @*0` *a `` $*@ 㿘!    * % @ %Ģ:D$@! ?&!%&%Ģ  @> `  䠄? E  `  ?   2   2 ` "!% 2 !   ``*D%! `&%&!! 2A `$ % 2 !   ``*D%! `&%*&!> ` `%*  &%% (: ``27 ``% ` .`$  % % @$ ` * > @  蠄? D  @ Ơ? 2 *@g `` 9>#p*` €]%  %   ``*D]% 5% "9!H ` ` B!% !=%  &! 8&!%   > "@ %> "@ % 2 %   ``*D)%  &%  `4( % ` &!   ``*D% &% * > @  蠄? C  @ ܠ? 2 *@ݤ㿘  !  *   *%` %%@zP$@%% &%&%%%  *  &%&%` 2&%>#*` € 2 > (" :     2  .%       .% > # @\  .% > #P@T  %K&% `@N>  C  `  ? 2> 2   28 2 %% 2 % *@Cd %&% >   *@ * CU  ` ?  2 *@ `4 % o` *@`"㿐!   *` /  *`// ///    F @` $ ,!%`  &!   ``*B% &% 㿘! ` @`> <#x *@4 r j !  `> Ւ`* @ > #@˛ 0[2   @> #!4` ` N    @2  ; > #@u $! "  !&  @) `*!   Ԑ!! !@ " $!$!% ` $!   ``*B%  $%㿐  ! *@   > & @,# 㿘! 2! > @ɗ 2> @ɑ ( m  @ @> @ H % ,X` @> Հ`  '> ? ! C -B9 d ` ? @2   > ,  €-/+'/#>  @!%`  &!   ``*B% &%>  x@ʻ `&%`")    @ " ! &! @ ! `" %      ``*A% &% ` >  @ʇ %`2 %   ``*A% &%`^``!> `&!!@j ```! `> !0 @Y &!!% (`4>  ``@A  `@" ? > !P@;   *  *@ `* *  @*  &%&%&!&! &!&!&%&%㿘"h>> @Œ  ! @ɖ @ !㿘#4 8  > P##@$6# 4 6##@  6###*` ;`#* ; *@ 2` @ #46#,&# &#6#(6#* +@`  0>n >>!@#c $!0$!4$>!4$!@?`"4 \!` $!` "P@ʖ$ > @ɵ#X@@@ʤ 㿘#`` @㿘#0  ""`"`#d€㿘H /f * ' @ @9H 0㿘"" "c,@ " @ 2#<?@ " @`2#   @a АB< Ё㿈> 3  8"4Z"'" 6#6#6#, "`"""," H, " ,", "" , ", " ""","Ę #+ , " #+ 8, ""#-, ""P, "Ԗ", "" A, ,@ؒ  ,#* 6#."#/, "" , "\! ",", #8`""@"", \`@ {@ 4\  > @f!㿘 \ $@ @cc@2! \$6 \ !D€  !D!` 2!p!D    &!D&!H$ !L?&!L t  2 D> @" @ c* @c*` cL @x@] <@*cc* 4c`*`c2  4c4cc`*`2  4cc`8b @cc "c> c!c@c 2c> @ƺ!*  b+ b`,c2* c) bȑ* @, b,b, bb , c`*`c2  4c4c g4Z㿀""" B- " #. | "" -  #.#*# " #@* @Ɣ#. #/"#/#+#-" "@ ? !  * + 2 > @֐"0#* #.> #\#,"`#d#`@Ȗ(#*@*> #,@ *2@w>   @pb B> 06#.#/#* "#--#.@2#.~"㿘#0 8  """ ,@ " @ 2" ,@ 4 `  ",@ ",@" @ g`# b" @  " @``" `B <"Ȗ @B<ࠒ `\ B ;<4\4Z#*`2 <6## 8" @## "#> #!#@Ŭ# 2#> @Ŧ!#* "+ "`,#2*#) "ȑ* @, ",", "" , #`*`#2  6#6# 5 Z`Bw<0"#D`B <#D`@0Ր0"" ,@ " """ @ @ " @" @2["԰ 㿘 H /f * '  a2 a1 Za a"2 \s 0!5ja"g 0 !6] 0`@< \ \ 6 \ ` 0V 8@0MҀ%8J  l 2F& l0D@  2  \ \ @-6 \06  `@ `@  ,0`((0"#0   @= 8@ȹ 8`4 \ @    @P"hH 0㿘. 8@[2 2  `B >  D`B >  @6 @ؒ 㿘 \! "6 \ `.@@6.@01`*? 6*"  @ܔ    \"6 \ `.@@ 6.@0@q 2 2 @  *@ .@ 2  ߐ \ =6 \㿘8 @  J.2 &  &  C,2  @C  5( ,`   ??" $@ & ,`2 8& H @$*`2     @   & Ƒ,0@| 㿘#"? #+ ?`# > # `@w   &# 㿘#0  #P`"�@ >  @]#0  � 㿘#0  #T`@�㿘 8#\`""h@"h@ϒ?@]@  "  * *  (2*0#@"# (0?  ?+@``(0# "*0  *2 @"` ` `  +@  @`2` 㿘W  @ *@   $ ##  @## (h@ ⬐ ⸔ *@(` @ `?   "(`  @ " ``@(*(㿘" *" ` ` @"`@ " " "  $ " $ # #""h*@>> @ > բ  . @ @   . @+ > X @( *@` > X @( *@`@ * @> X? ( *` ( *@@ * @> X? ( *@ ( *`@ * @> X? ( *` ( *@@ * @> X? ( *`*` ( *@*`@ * @> X? ( *@ ( *`@ * @> X? ( *@*` ( *`*` `> X   *@` > X @ *@` > X @ *@` > X @( *@` > X @( *@`@ * @> X? ( *` ( *@@ * @> X? ( *@ ( *`@ * @> X? ( *` ( *@@ * @> X? ( *@ ( *` > X @ *@` > X @ *@`  > X   *@`  > X   *@`@ * @> X? ( *`*` ( *@*`@ * @> X? ( *@*` ( *`*`@ * @> X? ( *`*` ( *@*`@ * @> X? ( *@*` ( *`*` > > XX @(  *@` > > XX @(  *@`  > X   *@`  > X   *@`  > X   *@`  > X   *@`㿘 $ (D !> (@pF @pD@p` `( #$h@=$ 1 ` "` $`, ? "$ $  H$h ?`$ H`> ( @=0`   #@p1> X! @  !> (0@p% 㿘  (l @5  b~@b}@##kf@"'ej@"!$ !#m@" #g@!#n0#o@ " 80#i@   #h`"  !> (@o @o@oא ` @ِ    #g@P cf@C #k@`ce@% 0ycj@rcl@"6Hq 0#i@ "E #o!#n@4!#m@> 0_@10#h@# 0W` @> !`J> > !`ax@&0B@? <$H@8@3@V.@w)@%@5 D 2  " @O "H@OH&L& $D$L$H@4@o>㿘 (`A !> (@o @o@o0 `( @ԟ`@o&  -㿘 (!> (@n @n@o `@. @ `2`(?%> (` "` $`, "@" "@ `(2` @f` ``H "`L@OZ`L @OT@nސ (@k L& ( 㿐> (>  a#\(ܔ  @͘ > '> #̒ a#\  @Ø > (>  @oa    㿐#d@J   L@i P> @na&``&`&`(`(&`,&` ` &`$@w 2  &`8 ` &`<` @K&`@ @k- L0 2` 2 > Ր ""`(&, ?",`0?"`0`, @y`0㿘@Ԕ㿘@m@ 㿘@q   "    0@ 㿘%> (@n" ``@n@n7?@@L@n/ 0@n+ 0Ho * "`㿘#> (@m` 2 @n`0 @m@n `@ `8@  2 > @!`" ` "``8@@m㿈> (@mɐ ` '   `a @ & @m֐= "  > > > !Ȓaؖ @Ҕ"@m@mŐ`8 "`0  !@` `<@  `@ `?2   `2` @ ` a-` @*`  @@m  @o@a$(tU @ @mT` 2 @mlӰ @mJ@mfT L 2 HT N@0Ā  ?$ H '@D   U @q ` a  H  @ T@$ X H @  \@$ ` H ?$ H@m+ @m` @m0" H  @ T  2 H X@x H ?$ H H @ \  2 H `@ H ?$ H@{`0!@"  H ``8 2 H@l0O  ?$ H  @l@lݐa"` `"@I$ @@l` * @l@lĐ`   2 @@l`  @l@l U #\@Ҕ0 @l0@l0@l㿘`  @u$`0" Ho !"`㿘`  @u$`0" Ho !"`㿘> !`> > @"0`@bH` 3 ` P@. @* )`6 L`*` 6 N 6 N`   H & H` "` H & H`& T` " H H @& H` & \ H @/& H㿘 h`@$ 㿘ذ  x  `  1  2 @h Lآ`@ $؁㿘؀ & 7`@+t 2`  L@f @0` ذ * @ *`$ؒhx$  &@"``"`@hs L㿘@ "$>   >  l>  !`> > `"X@Sbp`#8 @m 2  7&`!`> > `"`@;bp "u ` @   "k   2 "d `@ "^  "``! 2U ``"&`@&`` "`& $ ?"@$ $ $$  $"@& $   `5$ `!1$ !` > > `"V`bp@V` ` 8#  " ` @      2  V`   ` *@   H2  "  H5` 㿘> !`> > `"@b ">  0 ``  `2` & D & H & L` $ @J` $ @J p>> Ր 0a   > > @"`b@p``   " ''  `` ` ?''ܒ'''''@ `"@&`㿘> 0 @mT 2`02 @. #`8 8@b' % @! `  `!@@s] `8 2> =!D @㿘!> (@jC   @j]"`d㿘'> (@j9``2`@jQ0"dt@j/@jK 8 `  <@  @ @j90 $@#@  㿘  J` "`@fɒ L$` ` @:  a ?86   (+h'(% 8'  ` (  L@dː$$` /ǔ$` ` .d 2 ` `  d&`  @f L$` 㿘 t@6`  :  6 2-6+ @,& `   @  @. ё,&ҡ-D (  $"@D (@(D"D㿘 " D@f! L&  D   $ D?* & D"  D ?㿘!> (@iF   `@iA@i] 8 ` 0!@2   < @2  @ ` ",`hL`h `h @($ $`d,`h@i5㿘%> ( $@i %   @i@i# $ D@ ,`@ 2`    d @ h " @i @i  &  ?$㿘    2   㿘> !` > >  "@c  0Ho * "`#   H  ?& H@ѐ ` H " ` "` $ , ? "& & ` "`$  ?"&&  ?$  `@ > (@ 㿘`? &` 4?& 4``"@`@e% L@``"`& $`?@"&@&`> '#@l㿘> ( @P # @(`8`0$ $ $ $ $  "@ &  & &`Ho  "`  7㿘`4 @> '`8 > '`   2 @> '#@  > 1 !`> > #(cH@.` L&& & & & & & @b۔  & @&  * `@& `4 `0`$`4&  $`0& &`$& `$"@$`$㿘6 &dt  &dxd| @"@ `?$@@J 㿘\dt&dt7  "  "d| @"@ `?$@" @," 㿘`dt!  .dt +` +` +` +` +` +` @+`㿘``  &dt` @&dx㿘 $h`!   P 6 P2 &$h"  "? 2  H   & H&  , &  ,"$ , H & H @ge> 0!> #`@=  ?` "  H  㿘> ( @5  @͔(> a  > > `#pc@ݘ $$h`$h"`$t`?` 2 "@$  , $  ,"@& ,Ȑ 㿘> ( @  @(> a > > `#@c $$h` 4$r$  , $  ,"& , 㿀> 3 '''  @C -1 !В@L  `!В@L"!В@L"b`B ? @" ޶  > @#Ё㿐 /. " * @a  > (> @]#0"""  %> ('>  "@f!Ԡ?a> "!> `#\T   @ T@ T@8$㿘? 2  4 ` `*`4 g@ *  @+  @ 2` > ՘ !3  u + > (b" * !@f  ih`!, " ` < ] !Ѐ Y`!$@ 0P!$ d  ?d$!$ @I ?  2   * ` !$2 2  ` `  0/!$ !$*@$!$ !$$  `+ @ `" "   $  $     $ @f!ԁ㿘@O! d" &(&0&,a(@ d&4> ` &8@  6> `0@  a(   6p&<. !W&&6H6r6J&X@Ԑ?  26 @  .  @*@ @ 3  `@ `?@  @ ` *6> b@@ܖ㿘?  2`6  `* 6  g *`  .  2  > հa6  . ( > (b"* !@eՒ   `"      * *@$  * *@$  !  @ @eq$ X D? 22   ` *` F@ *@ *  @ 2`  2 * > ("@*` > 0$`  0 (& 4& 0H /d * % @2H 00 p < & @ 0 (& 4& 0H /d * % @2֐H 00$$@  4 `,'`@`>`@,  ̘@dY, @dE ?" @`&@,P *H /d * % > (!T@͒ H 0# <# 0 8# 4# 8`<? ?` # D# D< # H < B; p ,>"# ,# x# | #  #  #  # # '#  0# 4(# 0 @%"@& @H /d * %  0@ |`t "`t@1J H 00# t# @H /d * %  @8t`@$tH 0@ <`EJ㿘!\ 0 $@&!\ 0@ |`t "`t@c㿘 ? D F *`   2  2 > (* "@*` > "D`> `@@l  4 " @ 0($ 0 0@ & 0@0$ 4 @> ( <!T"@ $ @@at  < @`0 0" @ a\ 2 @at?$at @ @0㿘? 2`  6  * 6  *`  +  2  > ՘a3  > (+ " * @a$ >>c"@#p @c 㿘? 2`  6  * 6  *`  +  2  > ՘a3  > (+ " * @a$ >>c"@#p @cN  㿐  @ ` `h@     (*2`  㾘? 2  5  ` *`5  * @ @> 3, @  2`  ' @kJ 4> 6 > (,"" b* @ e r@ "ga$ e@k `  m@  h@i `0"@"a$  e`g@`f@  ca$0"@ `` @a  aԐ@bY  `Ȕ Z& `@U > P@Ԓ   > @ X@a  @' ''''$a$*@$a$ @\Q   a$ $a$ @\E e`<  ? 2 (2 <  @ba$@    @\@aB  < 2  $a( `@@`  @a%a$`*2 @ $a( @a֔$a, @% 2a$ * H H&& a$@    @\@aq`  @\A H$a@Fn@a($aa(  * 2@ * >a$> Քa `0$a$$`@o$`L@aNְ a$ SaԐ@a  ̶  `*@  `  ` @a1 @aЀ @w`Ha@]͒ @f`0H/ /@a@g!H 0 \?"&\\@ `K*`" "* a$`  @@_a, }``Ȑ@ܔ ZTX&`r&d&do&`$jޖ g a$$``&!^ a$$W `&`*`` Q&$L@aԐ@a  Ga$$a$`@W 2'a$ e g@2"a$? 25 @ * @ * @ @ 3  `@ `?@ # @ ` * >`@b@a$ ~@`$a$`2  a$" =$a$  ` > @ p> 0 @i$!0  @[8"!(  0(  (  '2"*!,"!,   ?''''''`@\֔!0!,@_Q !, @`s@\ے 㿘> !> (*`" *  !$ @!* "@b*` *!$㿘> 0 !$!, ? &!$> @ @  !0@[: @h!0&!(&!,&!0? 0 2 @ g `(2  ( *   0 > (2 * > Մ a($2(??  @T㿘?> )\> `  `  \6.`"\``*`ff(c3dϲg.`'a. `.(/`@`(0`!ʐ (> 3 ' @d> ) \`M` @)`!> )@Q P @)i2`(%-"@%@` P@)@ /   ///  @ ///%t/&@@ > )@ܐ`\``@t X@q > 3  > @^ ȁ㿐> ("` > 2.  |@ . @75 :` ` * Q` `" #@ `& & 4 4 :?  ; ?# :  :  : :2 > > a$ (" :    0 > (Px`B c:x$@$`$`2 %> '> ՠ > )@ P$> 2 |`@:<(@  $$2 "> (Pp`B :p@ P0;"> (* @" ""P ` `, B ; ` `$B (;@!. !  8 @B 8B :  > ) \`  > (" @"4@Y P㿐> (@"4#> (bPh!> )`B :h@- P#> /)> ՐP' '@?t P@@B 2@é"> 2" @C @Pa(!$> 2   |@ <$a($a( 2 &@P㿘u> (P, @B :㾐> 3 '@6 > ) `2``8 > )@ P> ("P `` !> 2 $  !!> 2 @c!!@cr P(@  <`C> ՔB"a,$8  @c8(@ P` > @ ؁> 2 㿘> 2 > ("`2 > @ "> !̕*` *> ("@ "@ԓ*`㿘#> (b 0!> )> (>"4b@ \> (> "@a|> 2|  @ @"  \$ \ #`> (""P@"> 1 |@$> 2 @!> ) P@7   $b㿐!> )@1 P> 2 @c= > (P> !,`B :#!,@= Ph%> 3!> )'@ P> 2 @c! > (P> Ւ@!,B  :#!,@! PȔ @b˒@c/$@c @[ @X! > @F!㿘`h!> )Ē0@ܐ P> 2 @b> (P> !,@B :#!,@ P㿘   8  @| @t? 0     㿘` |  @W o8? @2  `@`V> ܓ*` €O > )`\  F #> (P X> 1``C :X>  h ! @^ 2`\ 2`8> (P`B :w! `& :`?#$$,`,  %  S  @t( ` 2`@X 㿘`A`? 2`   `A> ) ```A> 2@b0㿘V`? ? > Ր!0> 2b&`8> Ր!@> 1`t&`8> ) \&` )@ P&`&@ P 㿘!> )@ P> 2b  "b2? "& @ P <`" `@ 㿘!> )@Ð P> 1`t  "`t2? "& @͐ P 㿘?  2  2`C  >  @V ` '+`@8*`2  @s ?` , *  2`, , 2`Ȑ ?` 2`? 2   > 2""@X 㿘 X@"@% "@ "J8""@9e @P`  "@ X b~@Tb}@ QR@!> )@+ P> ) ` P@C&G@d 2A #> )@`P> )`\`@ "`"`@-`P1@d  2+ !> )@ P> ) " `@c 2  > ) ``?!> ) #@ P> 2""@c !> )  @ P> ("P@K"@ P @ސ 㿘   `  "@ "   x@@zB<   p@є`"@ `@  ":@? "@ " h   @' ' '̐?'* '% '" `@Y   X $`"? ԰ Ԑ@+o !\' 'N@ =`?'܀ ز`'Ѐ `0`4  `p@  2 `0`t( `0  <`8  '<`8`<   @ > 28`B :8 '`p  @  "`8@$`8   @w r H   8`8  @ @ 8 C|<`8     !y7!\ "@  ܓ2` ``?@[؀ N@ ."!h򀢠7 M! @M! `A`8@! `  @7 t-` @`<*'<'`8 @%t-` @  $`@@T `@@M@* j@VV  `8  B<`8`88Z`8``<8T`8`2`8:  $`@`<P `8@:<  @  @#B @  H @+<`8䀢`   `0<`8 '䀢 "@#!@@+ʐЀ`` ?@U @$`@䀢  > 20`B :0 Ѐ `8<`0"6`@@"̒ @Y`@%`@@X@ @ 5  ̐@U` L*@H%`7 4̐@U  "@9907*@'%`  @@"@8ܐ"X@ @ @" `  ̒ @Y@%"@@+> 㿐  `@e   `?@  @"r '` H @ & '㿘> a> 2 9 @qp> 2> 2"bt"x 㿘> 0 '> 2%> 26` p t*  "  @2 2   @7 6` 0 2  㿘 > 2 2 p> 2t * " 2  @2 22"&& " D @M2    2   " "㿘 >  `    D > !(@: $ @XU `@9̒ 㿘 > `    D > !H@:Ȑ@+H " @8k$  @T :&  㿐  '  6`6``@     `. :   􀦠< H 26  @`!6` @2 ` @6`  2 ` 6`  2 ` 6`  2 ` 6`  @2 ` 6`  * @&`  * @&` `&`!m6`&` @!N㿐'􀦠 `  `  *@ :   􀦠'`H ` 2! ``=@ ` @@` ```&`&``@` ```&`&`` `@ ``&`&`&`&` @ 㿘 'l '    &`&@H 8X. * "* "`  @x* @, : & @n d@j? * @,`,`* :`& *  @["?. * *"@ *`@*" 0*  ``d ,:`*`" *  * "&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `(0d0`0 0p00p0p0p00p0p0p0p0p0p0p0(0p0p0p0p0p0p0p0p0p0p0p0p0p0p0p0L11|1X11`1111111111111111111111111111h   (@2   *  ( @* ` *  ` `(@*   *@ 2`"`㿘> @Ȑ!h@2 㿘  `(@`$F`0`2 `,@6  /,` > ! ` ! > !*` €  $ `$  `@r> => =!@ aX  > @!`, `,@@   `(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N > !`  > " *` €  > => =!@ aX   ?> @<!`, `(@2*``,2`@  ` `(&``$""@&`$2`$`$&`$ `  ?&`㿐`(> a`,`$@U" N !   !`ah  #\ `( `@`$0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@`  @k   @` @  " "   -@ْ`.` 2  "@@3`  @E   @'` @  " "   @``@  " " ` ?&` 㿘@N     `( (   `*  *` `( ( ? 02 ?@ ?  0?@ * @(@@ `  `㿘 `? @`@&`!X㿘``/  .`.> >` ` / ``..> >`  .  (.&`$㿘  2-    2% ` 2  > aȐ @ 2   2` > aؐ@  > a@  `" =&`㿐 `!`' `!ah@`2`  *` * + `  T "d`!`   ` )&` `  "`L@L@2 L`L @2 €` # ` (`@`: `` >` 9``: `  0` + .``8 B<  2` ``@A   ` ?@  H`` @ @T  2  €   2 ` '> Ր''ܔPLX6  !h x`!7'' '''ܐ !@J> մ!` Ĵ ?'Đ(`$  7> Ր'6'''Ĕ@' ` "#> &ada@     1&ada@  2?"'> 'ܐ"? 㿘.     ?.> "Ѐ"  ?* € . 㿐Leؒ ;) ;Y  А R, * @ ?Ѐ .`@*`@ ;$    ? +"@ )"@  ! . ; 0`;   ??? 㿐`\    =. `.X  ;` .F6QPQPPQQP|Q> 0 > a> 3@1Eb  > > b 3@1=! > @"807> > "`bh@/| /!'|@  | "@/||@N͒ 0> K"| " @  |#b |"@|b"`@ 0|@/ @   t  `$`@} @  b @6p @&(&&$&&,@+Ԑ e< "@2K\ >  `H& @2AR  @ `@NX `!@P @10: @Q`$@@2  @0  @2  `|L Y| Z`@@$ a|A Y| a@@֒$ atĔ t@V 00@1㿈` 'L' $ ''     @5 @4 > 3!@ x L   ` @7L k耢   L@P ? `l 0p ' 'Lc' @Pe? 2'(:   ~:  (?@k >  Hbx @  2  "` 4 :0 - ''&l 'X> b@a  " > b@Y  " > b@Q  "   2  @'c @'? * b> ?   9@K!l@!l$`P ` `+  P* `@ @ *@ $`a0ܔ "  +  *   *` $aT ` `+  গ* `@ @ *@ $aX$ah`$`@ ]$`?$`0`%0@;'"'   $ ' ' $' ($`$`$` l )  aT` *  : `?@ RH $a`l l ?&l`0 "`0@'l  $@` $a\ $a\a\ # !a0g "  *  *` * $aT ` * `@ `* @*@ $ah$aX`0 &`0`"`@͐`  "   `@` @   耢   L@N?`@L 9'"㿘@($`D   ,: ($`<<`p$`08 @} $`@@@C `> `Hbx @7  X T c$ޑ, K? * b B> (@”  8@  2 " 2 "  6&p(0<    B  6& .6&0  B  6&. !W @ &&6&&6r@e6 `0 $`0@) 㿘6` @0 b   ?# @N! @/ @K 9`$*@$`$$b㿘"!0!\ `?@M -㿘"  &`&`   ;  0>`>`0@ >`>` >`( `V Z!`R Z!taDN t&`t  㿐 `` & ` &@/0 & F㿘 @ 㿈"R &. > 2" @,  &" :@I >  D @C "`$$V$  @/( ""2J'6@ @. F> #"@`!  @.ٰ F> "@90?,  ;    ?@ܚ  @.Ű@L> "@#0 H @ @@. " @7 >  #@ @  F$  @.P$ 6@  ݐ X2`  `+"<>"*` €> 2" "`8> 2"|" 8@, > K`$ "`" 8@.:@/$'p@~tTh: @  l `@ "`@ &  2@ "`|"`㿘"@2Ò`  `0`4&& RRRRRRRb(b<b<abbb(b( H*  2+ 2' ,2# 42 2  2 <$"  < >(      㿘 <  o  @2 `   `$ `$ ` /$ T`$ `$ `$ `$ ,`$ 0`$ 4`$ 8`$ <`$ @`$ L`p< `p`t.  < 2*   @G$      $?'''''''''''@[耢 А$ < @I  $ D$ H` $ (`p< P <$ x  ' ,  6 @ 0' %`@zr `  ` " 8 p@b    `;  ;  쀢 ( `B `E >@<  @Gg!  . D@ :`. a"   >  `@zDp  ?t ?#`#\#d@a@I  ?@:`@'8 {`H@d*`@  p@  t@`0 "`0@   2b   E  㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @c#0 2>#8 㿘"" N" =`?  " !! 2!@P ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#" 㿀#P`   @Fo' '쀢 ,a,`,b,a,`$c0 $cD  2 '* @FZ $cD$cH $c@  cP@! b`2 bL! 2 b#,b  L! 2\ ,b\!`  h #\`? `f,b\`2c(c(b c(8ic( c,@8cc(  \  ,bΐ & ` @G^  cH""@"@ "c8@pc8?  c@@GH#㿐   `!\ " h ?`?0(    @ך 5 ` H   ( @= H   > K`#> K@!@Q    > K c> K!@Q@ 0!@  #  @b"> K!@:0  " $  "" "㿘  @J) @*b 㿘  @J @*X 㿘  ` @? D㿘  `  D@>`㿘` |<? > @#X p h@21 t t l@2, t  h  l p@J3 " t 0$ 4($ 0H /d * % @H 00,?2 t H@z <$ @ t?2 H /d * % @mH 0  > ` $ D#8*` € 㿘> @>#p 㿘 `@>| D`>؇(`!\`     %` $` "`     ??1 J@` +???"&" @?(82`?" 2?2 ??"" @?` @((882`?" ?: P> 3 '@(`0 $($`D<`p$`0$`<8  @v $`@@@ `H@  `HO ?Ēc ? @ (**`+` @  3   20 3` ?@{(%I  `0 $`0<`p$`<8 @v $`@@@V K `H@   >А  @  @  2 " 2 "  p(0<    B  6& .0  B  6&. !W  @&&66r&&@6 `0 $`0@Q > @xƐ#㿐`&@`@ l  #? @'? < =*` >+` 8@ 9( : ?(+  ;*`@ @  4`,  +?   ,+`- 5`1?   # ,` .6 . 6`-` @ )?6 ?6 5  5     ܔB*2@ ' < @B D'`$  D@ `@(I'@㿘 2 $ @   &@@ <@ @ 㿈@  $*'  @ 찒  !@t   @L?@# ?*  *@2 @ 2@ @@&@ xxpxpxpx|xxxxpxxxpx㿐!> ۠"> 2> #Hc#\!  @ > 2> "c#\ D  @ > 3> #\ c 0  @   㿈`$`2 `> $`$@##`$@d - ~  ]` @X &(&&$&&,@!Z N< "@'ѐE >  `H& @'ǐ;  @ `@Cސ !@F' @Gy  @B `  Y Z`@@wv$ a Y ֖ a@@wk$ 0@' ? (* 0*`2`    @   `  h'L'P'@+     '@) > 3!@ İ P`@ClP   ` @-dPP@G P @E?   @A X&b`> `  @$&``$@ &`&`$`!$` $` '$`   (?@ ԰ 2g`8Ԓ H 2``8ԒH'? ̔ @P1??# @*`+`  @ +  *22`  3`  3  (?@xz'Ԭ@'Ш( 2   (?@ ԰   H> 2A Փ*` ֕* ב*  @ @**` @ 2  @2` $` $`?$`  * *  *  ! ! * * +  @ 2 @ (23  @ @P M Ԓ  H 5   *  •* Ó*`@  **   2`   2 $` +` +  *`@ *   * (*` @2  @2 3` $`@Ԁ'Ԁ А @ d'ЀJH> B H`@@㡒   d @^C`<@`$`8L4 2}`8'`В+     `?@ ԰ > @: pd`8Ԓ! H{  '̐!`( ɔ @Ǹ'>  @!J `,?#`( @? @ *+`@ 2*  (@ 3`@ 3  0'Р[`В* `:    `, ?@ ԰ > @ `8Ԓ!1H > @ `'%" > @ې (`8@א `8 `@A֒ ` @Aђ `$*@&`$&bԀ P@P @C?㿘b6`  @&\ 9`@A   ?@+ ?@Cѐ@E3 !`@%c"` " T $@A  T " 8@A  8 "@A @A `$*@$`$$b 㿘"?`( `# `*` `* * ` @ @ ? @ *`+ 2  2` @! @ `@ "`@ -"   "`  "`  :`0:`:`:` :`( 㿈> 0 &b' @!   '> 2!@j's* :   ?@  > @  @c @%P! HC > @ 5 ? *` * *   +` +  *`@  * *? @* (3`@ 3 22 @  `  @>   $`@@@  0PH T@ '@찒  `@@@ @0:$`8$`$`  $`$`4" @#> ’ ` @8ɘ @`@ `` >! *` €          "`< &㿐 `` 2& &  2@8 "`    㿐`,?`-* `.*`@*`/   '?*  *2`  2  @>_ #? $ T `,`-*``.* `/* @ @**` @ 2 @ 2`@s `(`)*  * 2 @tǐ$ L`0`1*`2*  *`@`,`-*`3* `.  +`@ `/**  @ 2 @  2+`+   @  2   3 *@   :`*  ?@  " `, " T@  T@?ʒ 0X`-*`.*`@ `/*   *`*  2   H2 T K @  T " T T@? 5 01* @ *`2 @& $ P 8 9*` :* *  ; @ @*` @* 2 @ 2` ? 0`1* @ *`2 @@ ޘ  x> 3 a' / O ```@2@  `/` > ’a@  >  a@  , %`@a ?a *a*`@ * a  ? ** 2` 2 * @   > @r!0 㿘> 0 & @@L < 8@* `@_     82@Q  @!Ӕ    & 2 8@@  㿘> 0  ` @>â @@ < 8 8 *  ""  & " " & @ 㿘  @@ 8 < 8 * @`2> !H@ `"  "` ?"&& @ 㿐> 3 Ȓ @  >  &@@!p @? ,c -*  .(( /@ @ ? " @ #*`*0 (2`  0 2 *0  a  (( @* 㿘   ``<      @ $ %( (( )*  *+` &@* + '*  `< @&Ҙ㿘 `?@tƒ d   @t!`?㿘&` ? * c *2 g4 &@&@  *"@ *` &@ *"@ *`@ *` &@ *` *" *"@ *` &@ g*@ > ֐!d*`@ * * "@*`" @* &@  g@"@&@g@#@&@g@"@&@'Ѐ6!m* @*`" * @"*@  &@? * c 2`*  <@ *: x*`" @* "@&@x '' ' '`@  4"8"`'?"? 0 1* @ 2 *`@$ $? %* &* *  ' @ @ *` @* 2 2`   " ( )*  ***` +@  * *@ 2@ 2 @   H"`',ܒ4 T4$L8$<$@`< n $ D E*` F+  G* @ A@ B+`* *  C @ K   ?  0(? #?  4`,  *,5?   ( @ / 7`,`.6@ @ 1?7  ?@6  6@5 @@ 8`'ܐ@n=@ : ]  :`U: < =*  >* 8+  9 :* ?*`@ ;* @  ??  c0(  +?+` ,` 1? ( 5`-   #  .6 . 6` -`@)? ? 5 656      :`  "D"H #? '?"( < =*  >* 8 9+  : ?**` ;@ * @    4`,  +?   ,+`- 5`1?   # ,`.6 . 6`@ )? ?6 6 5 -`5     : P `< :X"    㿈     `' '?`@? < =*` >* 8+` 9@ :+  ?* ;*` @    0(  ,* +?1?  (   # 5`- .6@ . 6`@ @ -`)?6 ?@ 5 @6 5 @  @ @  4  / @+  "'  B4 $@ 2'@$@ ''@캒 @V `@`" 㿘> 2> @V!-  @#H<?  > @D!cH@ cH?# ?@ " `.@ .@ `cH@.@㿘> 2 @i#H ?@cH@j㿘      & "& *& @V6& ?㿘> 3 @3!"" " " 㿘     & ( 2 , ; & $ $ @ "  , `& (@  "    " & ,@:    & $@  `$? `%* c *2  `   & S  #@   > @!> @8ǒ  & -   @ $ $ & $ ; &  @ %& (4 `$  & @" `$? `%* c 2  `* &` > @\" & ( $ @ & , &  , &   ?@$  ?& 㿘  " ,@^ ,  > 3  "> 3@:4 > 3 @`'D> 3    '`' ' '` '` 4 , @8B 'Ē'''ܐ"@@D'+?`@ <1? =*` 8* 9 >+  :* ?+`@ ;*` @  ?  *   # -` .6  . 6`)?@ 5 ? ̆ 5` @ ?z# `v  >`;̐ `8 '// . //7'А   f   ? * *  *  @ @* @ *` 3`2`   '///7'А// 1  $ %*` Ȑ &/  `? `+  `* ` *`@  * *@ 02@@ '   * ?  /7'В ДE C> f " D! > @?"( D  #    :?` (D ` @9+  > 3"@D "@> 3  > @l"X -㿐 | p h@` t l@" h`: @j h  h@ "2 t H@l <??)< p l  p@< " t 0$ 4($ 0H /d * % @ H 00,?2 t H@lr <$ @ t?2`H /d * % @ ʐH 0  >  $ D #8*` € 㿘  ` @0 㿘  `  @0`㿘 `@0̐ 㿘 > `"h 8@} @2E > @x"㿈  `  "@  "  `: @i  @쀢 "   @iN <  2& h' '''`;?' )?' @ <+? =*` >* 8 9( : ?(* ;*`@   1?#' ' ' '?  '̓/`   .6-`   " . 6` 5   5 @  @ @:6ܰ  @ '찒  `   `J`. @)"؀   `<> K   ? *` * *   @ @ ? @ *`* 23 8 `B :8 ?3# `/  `Ԁ$  ? *` * *   @ @ @ *`* 3  2` $ %*`  &АS    ! > @i"  "( S 2$ A  ؀   "`<  > K0`B :0 Ԑ  @  ܐ "@:Β "@Ԑ  {  ؀    @ ѐ㿘   @: 㿘  E " @@&  @ "> 2@6 > 2"@I$  㿈 '@i?2  @? c * *`@ *   ? ** 2` 2  '@  * *  *  @ @ @*`+` 02` 3&@1@ 쀢 @&@@@8&@`?`*@  :`*   `?@: > `: @g H '@ "@z㿘 @?  # *` @*2     > > @]"Q #   *` 2   "c    > #@倢 > #@  2,`@8,`)  (`? c 1?* *@ 2  @2@ `,@ ?  *` * *   @ @**` @ 2 @ 2`     * * *` @   * *@ 2@ 2 @  T  2,`@8K,`)  (`? c 1?* *@ 2  @2@ `,@ r?  *` * *   @ @**` @ 2 @ 2`     * * *` @   * *@ 2@ 2 @  @f ? ( +  +  +`@ *  *  ? (+  (, 3`3 3 0 @ B .'' 8?  W>> #@ @\ 0P> @X# L  =* >*`@ ?*    ** 3  2   3>@>T, P '?L#  #?1? 8 9*` :* *  ; @ @*` @* 2 @ 2` @`6 <  㿘'@ `  @k d  @k!`? "mn`@퀌`  @k d  @k!`?   8      > ”#h,* @* "@*` * &. @h> ” 0#hS!T@ip!@kR!@kN .`'  @kE d  @k?!`? "    @k1 d  @k+!`? mlۀ `6@  @k d  @k!`?  '̢@    @  @ $  .`.`@i..`@j.@i  <.`@j <.`㿘` `- @?c *2 *"! "8! !0@ @ @@ӳ @b`㿘`&a`&a ` &a` `@&a`&a$``2a` a`H  `@ g > @e#@2a``@*`@ ``>2* "@` &`*`" ` $ a$ a $ @a $ $ $ ``@*`@``* "@` &`*`" ` $ a$ a $ @a` $ $ $ ``@*`@ʐ``>2* "` &`*"@ ` @ "`` a "`"`"`"` "`@㿘`&a`&a `c  2 * &a` `@&a`&a$``@*`@``>2* "@` &`*`" ` $ a$ a $ @a  $ $ $ ``@*`@r``* "@` &`*`" ` $ a$ a $ @a`  $ $ $ a> #`a  , $@```@ >2@E``>2*`" ``&`*"   " " " " " " @>㿘`&a&a  &a @&a&a$``@*`@``>2* "@` &`*`"   $ a$ a $ @+a  $ $ $ a> # a  , $@```@ >2@``>2*`" ``&`*"   " " " " " " a *  , &a@Ԓ> <> ֔Đ" ?> 3`̀8"`̐? 㿘@ א 2!@ $!< @SF2  @2  2   " ,    㿘'T?\ > &#  *   " $" 9> &   @&> c  +@ #@#@@2   '@`'@  `'@# `8  @ F"@  @ @* @! >2* "@  & *` " $ $ `$ @9$ @$ $ @"A @* @ >2* "@  & *` " $$ $ `$ @$ @$ $  @* @ >2* "@  & *` " $ $ `$ @$ @$ $ #   8  T @* @ >2* "  & *"@ @ &"`"`"` "`@"`"`T"x  #\#``#d#h#l @0 2`  > 3'T  D ''P''t'p''@p'\'X   <   `@3! \ X $` `!@3n 2  4 2 ް Ȁ " ,  @/@'\Ԑ\ 2䀦 > \#t@ `8 `` "  ``@` @@[ @,@T'!D @Q"> #  p @t@ 8 @ $` 'l  " @  @ 'l$@#dl#`#\l@5 2@$l#`#d#\l@( "^ @l@   *@"@T,@"@'!D `@&@ @A\'d 6'` 2`. XXT 'X'h  "@'h#\h d`  d@ h   @ "@P'!$" hd 'h`@Ġ @.  @2i\` @05 hT@"> 3 > @cĐ#x`  ` 3   '7/ 23 ?* 2  8, a`H " ,`@ # > @r#В ,  @.*az `?&a&a , @ '#> K `` # @} aa Z  倥` ,`2,",ޠ  2 > ր`Ѐπ`@> ֐"H&a4 . 4`?'> – @    > ֐"@`@ ``2`2,. 4, e ?'耢`Y'>, \*` € 2   ' "@'?'a`#\ 䀤`'䀊  a?&a(&aa  " &a &a" &a",a ?&a&a a  " &a &a" &a  , a ?&a a?2 &a@a> a @ @*@&a&a&a@`&a$  @-5 " *" ," @"" &a8&aD @.@-a@`"> K!@}B@. @-` Pa@aD`'E a8q  @.͒ > K!@}!@`01@+ & '  '' > # ''   ''''   ''''a<''' @@. > K!@|   㿘,,   @,a 9 ,* - 2&  d! @   @, a   `@2 ` @!` `0 * `@.D @.A 㿐`? 4`a'a( ) ` %> Ò`@  2C `  @ 8  @ L  2` , @ J@ 2`*@@ *L %    9> KJ@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` `'` `@-`!@/ @1P  ",`a( "> @ @Oa0 a(  &a(2` > ݐ!""`(2 , ?",`0?"`0`, "`@X`0` "` ?"a(  &a(@+  ? @+@%   ? @+% @ $ ?@+ $a( > `0@  H $@ @$V    > @ 8a0 ` @i$$&` @3 2$`a(   &a(``@+ !@{~a(&a,a &a( "a" a" . " 4a(   &a( ?&a(a0@  ```@+ `!4@{R `  @, ?  @, ?@/㿘  > @L p , > > > Ð `@2 `, " &  ?@** , " ]*  @ @, ?& 㿘  :    " @v   `  & @, ? && 㿘` @ "  +> ` ` 2 @`  $ € ```"``㿈`> , #`@ 2' ` 2#  "`  @  2` A#@` $ #`` #\#d@`  @㿀`2> #` * &`#\ ``  $@ * #`#d ?@? 2(  #`#\ @`#d`  ` #h`@*#l 2` 2` `  @  8  $ @ @ 㿈`> c`A`#*&```  $ * #``#\#d ?@@?  㿘<>&a&a >  c4 * &a ``@*```>2* "` &`*"@ a@ a a" " "`a"`"`"` "`"```*``` * "` &`*"@ a @ "`a a" "`"`"`"` "` `> 3>ch 0" $`@[@a@o> > Òa @x!@@k@S@0@@<@0@$@\@@G> 3"TT " "`$```$``""`$`> ;#T`#T$`#T`"` %#T$` > 4`$a4> ;L  $`<`<"`@L"$`@ > <@ #`@" "# > 4"`А $`D"`$`H> 3 a"a# "`0Ho  #`> ֒b  ,`5$a> ,a"a#! >a`x@Z>`ؔ@Z`> 3 Р " `3> 3@7I"``5> `-> 3"`9> F ;> @+> K@=2 > 3!D$`(@?K@  > 4` $``"1> 4/> 4ж#? :`:@`> !  @@< @4$!> #   :+    P < @  $> Ę  aT@Ib> !Ȓb $`$$`  $a<@0 @:@S>@: 0@]@@Z@@ @@@t@Q    $ @  2 @0H /f* '@o @ͪ@pH 0Ь > 3   @ "@ @]#d>5aL#\#`   @ > @}!@Q#t  > ۠ #tb@S] #t` > ې!h@F^ > Ò @ag"@> "8 "> ß > @}|"> K"$ "$> K  €` "`> @}j"0`"`@ <``@- `"` `" @ /`> 4a "` > 4a %"& #T`#  ` " "`@ $`$```2` @Q>> Ð#H @ ">5> @}&"X> Ð#h @t ">5> @}"p> Ð#‒ @h ">5> @}"> Ð#|☒ @\ ">> @}"> Ð Ⱂ @P > @|"@$n @D@|ϐ@> 5"`> ې!x@E > 3P"P@T@bP> Ð# @ '''''@  `> > @~X#0@~U#80@ "X> 3cP'̀ -> %> ֦ش7> 3  #> Ò #PcX@Rx #P` ̐> $"@ '#`#\#dԖ ?@? " $> @|#h"`耤Q> ê -/ `  s/ِڦ  * "$@'Аi'@\ܐ $@'В ^?''АВW ̠?P ?K Ȕ'''@ > Ð#@}ђ 2 -> @}ɐ#> @|;#㿘>`0@`㿘>`0@`㿘@ P@4 L@  '''''ܐ@&e =@,1 <    `@'& - > 4!|`1> 4!x "@> 4@S!a| "!x ` @' &!x$a|@ @$a| 2    $a|@@& 8> 4a|> 3  '2    `$ @7 "` #?:!#ڔ @6 @7@ 7`ؐ@' ب" '" 'Вb@ ?@h 7ДĒb?' '?/a ?> !> !@\" 7``` @\ 7`0 `,@=  7 ' 0  '!4 ` "? l?'  !O #\#`/#d#h#l  ( @&s  @7E` " ` > @[T#ȁ㿘@]a . c   6  `  # (.` 6 `.` @.`6 㿘> 4a  a>7> Ð @K  㽨> 3 >'`0`7> #> 4!> 45> 3> 1> /> -> )> 4O+>   ᄒ :@X @Z d(  24, (0!x $a|$!x@{ (̀`";%!`< 9 `X  a :@X @Zǖ d(   a|, 8̐ $!x$a|@z#ሖ! (@PYc!x`"a|`< 2`X  @%?$!x%!@  @%?$a|㿘>#> 4a| 0 `!> 4!x  `"!x @%?$!x$a|㿘 > > " H@:"`L> 4!`> 4> ! ""@[> 4"a㿘@=Ȓ 㿘@=’ 㿘> 0`-0"@)> 4 @  >   > !@U 2  @VV  >   > !@U > 4 @VE > 4!`2`L@m`L? $`L@ZK@ `v> 4!> ʀ a> P> 4a "P" "P> >t`> >"p"@ "t > > > 4!> 4 #> 4"1> 4> >"x B :"x"x`B<8xx#xx< x2x` x`B#8xДb?" ?/!"ᨒ`#ᨔ!@ "?/!@"!`$!$a!&!@V > !,>  *b%  0 㿐@ " А"@? &- (c (c& > ʓ, "@*`" * * > ʰа?@[R  !%@Z4 > ʠА?@[?   #㿘  &- (c`(c& > ʓ. "@*`" * * > ʰа?@[  !%@Zj4 ]> ʠА@[   #㿘 0 4 0Ho  "`> 4a  !"a> 4!`H /m * . > 4!> 4a> > "H@E"`LH 0㿘 0 2 0Ho  ?"`> 4a? "a> 4a  H /m * .  > > "`H@"LH 0㿘> 0>    `H`D  `$`D$`@> 4@a> 4@a @  0 "`@ @~`@? X$`@ L!"`B < ``B 8<```B 3<`" `@ 0 !@@}`@? 9$`@ > !(@ "`( `B < `(`B <`("`0`H" `0 ؒ`B < ` B<` `B <`0H $`@ l> 4aĐ  $ l>`0`  "`@Z㿀> > !> > 4> 4'!''a`'' @G2 H > 4"" H 㿐@=*`" *  * & &㿐ݐ*`" *  * & &㿐@*`" *  * & &㿐@$*`" *  * & &㿐@> 4``" &`" `& А"@@& &H > 4"" H ,0DtTPL㿐!> ۠"> 4> Đ"` #\ `  @p[ > 4> #\!Ԛ`(!(  @pQ > 4"#X:  * *"*   6 *  ? * "? @*`2,  㿐@ 2`0'  $`0(@& @I `0`,?`$`0@O`0 @ΐ@&ސ@@&㿐`@     ` A ` => !耤 @6 2`0&1  $`0(@&@ `0`,?`$`0@N`0 @@&Ő"> @v X@@&x@ @  a 2`0  $`0`` {>:"4*` €   `` m ` (j`0> !耤 c(@&A@ܰ   @3`0`,?`$`0@N_`0@&JĐ 2 `0ܐ@L `,?`$`0@NI`0@&40= @ 1&`  @ )*@ @ ?%*@`* :` ?* :  ` &`!  34`` ̒@`4` `'ؐ"~؟ 2`0` `@'`"}ذ "~` ?4`'` ؟`0T` 2``( <& `wذ &T` 2```("<  `"@  @"D   &`@(u 2!4  &``  `v` PT`  ``(꩔  2`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W ";   ~`0 z`0` 8 0Ho  "` ` ! 0Ho  "`   @@%CT` = `(`=  26`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W      @% @ 2 `0`  `0`,?`$`0@M `0㿘` #@  `0`,?`&`0@L`0F . `"" `0 $`0"    ?*` `&` `0`,?`&`0@Lݐ`0`> +   +@@"   2   3 * +@@"  4$ ` ' 0@ V@ 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @> @t 0*& 㿘 .` `2`09  $`0"  *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @> @t[ 02 0$  0@@ @㿘 @   (@$@$0 (`@ 2 0!  $ 0 ` 0 ,?`$ 0@L 0  @, 2'` p㿘@ 2`0-  $`0T` "`(  -`  "& `@ e`@$7@$ `0 -`0`,?`$`0@K͐`0㿘 />   `@8@ @&: <`   <`  "@,  ?2 ?2,  `2``  ?, ?2,   , ?_8??O `-    : "@,  ?2 ?2,   , ?:8?-  .`@@6$<`+  ` +@@"  2 3 * +@@" @4$ @$$ &   㿘  1 2* -` ' @* R-` "@@S[H@SS%@ `@ '` :`: ` :`: @7 ,` '@,` ' @ >  > . @S($ >  ?. @S$@ :  :  $ $@i '@f '$$$$$㿐   2u> 4> Ta耢0  @;`&  *@?2   2*`  * *#   ` * *" @